2I6DA

The structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
251
Chain Sequence
b'AMLSANQIKFLRSLRERKYRLREQAFAVEGPKLVGEMLPFYRCRMLVGTAAMLRAVSTPHDAEVVELPESFDFKRISTQTTPQPLMAVFDLPAEPEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASMGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVESLNVAIATAILCSEWRRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA methyltransferase, TrmH family
publication title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
total genus 73
structure length 251
sequence length 255
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2i6dA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2i6dA02
3N4ZA 1OY5A 1W41A 3IEFA 3LWQC 1Q7YH 2OTJF 4YQPA 2EGVA 2QEXF 4YPXA 4CNEA 4TZZA 3BBDA 1VQKF 3LWRC 3CPWF 2KTVA 3AI9X 3GYQA 1IPAA 3PAFA 3V7EA 4C4WC 2VGMA 4YQBA 3VMFB 4YQ9A 4X3MA 3RA6A 5A2QM 1QVGF 1NJIH 3CCQF 5CO4A 4YQTA 4CNFA 4FAKA 4YQGA 3OINA 1UAKA 3IC6A 4YQ0A 1T0KB 1VQ7F 5GAPK 4J3CA 3G6EF 2CZWA 2EGWA 4YQCA 3VI6A 1YJWF 1P9PA 2BO1A 1CN7A 1YJNF 1VQOF 1Z85A 3CC7F 3HJWC 3CG6A 2QA4F 1W3EX 1VQ5F 1X7PA 1VQMF 4YQRA 4YQKA 3CCEF 4KDZA 2AIFA 1NS5A 3I55F 5FJ4C 2WALA 1DT9A 1VH0A 4YQ7A 1VHKA 1CK2A 1E7KA 2ALEA 3KNUA 3PLAC 4YQAA 3KTYA 4IG6A 2QWVA 2V3JA 1K73H 4YVKA 1UAJA 1GO0A 1VQ4F 2QMMA 3O7BA 4YQLA 4E8BA 1Q86H 4YQ1A 3CCUF 3QUVA 4XBOA 3OIJA 4JAKA 4JALA 1YI2F 1ZJRA 1O6DA 3NK6A 2LBXA 4NUTA 1W40A 4YQ6A 1UALA 5EO3A 2HA8A 2HVYD 1ZWZA 3OBYA 1V6ZA 1NMUB 3SIVA 3L8UA 1RA4A 2CX8A 1QVFF 2VGNA 3CCVF 1M90H 3LWVC 3CMEF 1VQ8F 5GMCA 3BBHA 4YQ3A 3E1YA 1K8AH 3CC4F 3E20B 5GINC 2OTLF 1YIJF 4YQ8A 3KY7A 3N4KA 5GMBA 3RA5A 4KGNA 1X7OA 1YHQF 4L69A 4LCKA 4RG1A 3OIIA 1VQNF 1VQLF 3I56F 4YVHA 3ON1A 1MXIA 4YQNA 4X3LA 3CCMF 4H3ZA 1W2BF 5G4UC 2YY8A 3N4JA 5GIPC 1GZ0A 1M1KH 3AIAA 1SDSA 4YQOA 1Q81H 4YQDA 1VHYA 4YQQA 3IR9A 2I6DA 1YITF 1NXZA 1S72F 1K9MH 4BW0B 3LWPC 3G71F 1VQPF 3DCMX 4YVGA 4MCDA 5DCVA 4YQJA 2V3KA 3CCRF 2KG4A 3JCMM 1KQSF 3WXMB 2OHWA 2Z0YA 3N4YA 3J81M 4YQ5A 5GANK 4CNGA 3KW2A 3G4SF 4YQIA 4YVIA 1TO0A 5FAIA 4YQ4A 3NMUC 2O3AA 1X52A 1K3RA 3CCJF 4PZKA 1YJ9F 3NK7A 1PXWA 3JAMM 1VQ6F 1JJ2F 3CC2F 1GO1A 3CPQA 5G4VC 3NVKE 5FLXM 2KTUA 5EWRA 3CMAF 5GM8A 1RLGA 4H3YA 3SIUA 3E5YA 3ILKA 2QI2A 1W42A 4YPWA 3O85A 4YQSA 3OBWA 3HAXD 4YPZA 2FC3A 2LBWA 5GIOC 4YPYA 3LFOA 1UAMA 4YVJA 3J80M 1KD1H 1H7MA 3MCAB 3BBEA 4YQ2A 3OW2F 3CD6F 3NVIB 3AGKA 4MCCA 1KC8H 1XBIA 1Q82H 1VQ9F 2OZBA 1J85A 1V2XA 2JNBA 3LWOC 3CCLF 3CCSF 4BY9D 4CNDA 3CXCF 4MCBA 3FFMA 3J7AR 5D9FA 1N8RH 3AXZA 5IT9M 3V7QA 3ONPA
chains in the Genus database with same CATH superfamily
1W41A 5HP8A 2MQEA 1Q7YH 3QUWA 2EGVA 4YPXA 4CNEA 4TZZA 2G9IA 3BBDA 2RHJA 5EYPA 3ZP7A 3VO8A 3B6NA 3PAFA 3AI9X 4YQBA 5CA0A 4X1YA 3KJJA 3QHDA 1FFXB 4X1KA 5A2QM 1QVGF 1RLUA 1COMA 3CCQF 4WBNB 3OINA 3RYHA 2AMTA 3VYSC 2CSLA 5EAZA 1J7HA 1YJWF 2GLZA 4F6RA 2BO1A 2IQQA 3ERNA 1VQOF 2W8BC 3LYBA 2IG8A 1H48A 1VQMF 4YQRA 3CCEF 3I55F 4JWHA 4YQ7A 1VH0A 3R0PA 1CK2A 3Q8HA 4JWGA 3VCZA 2Q1XA 3OONA 3KTYA 2QWVA 5JCOC 2V3JA 3VOBA 1K73H 3P4EA 4YVKA 1UAJA 1GO0A 2HS3A 1FFXA 4YQLA 4IIJB 3FD6A 5KX5A 4WBNA 3CCUF 3QUVA 4JAKA 3HKBB 2F9ZC 1W57A 4NUTA 1UALA 3JALA 5C8YB 4I55B 3C9UA 3L8UA 2ZVZA 5CB4B 3CCVF 3S06A 3BBHA 2V9YA 3RYCA 3E1YA 3KHNA 2VAPA 5GINC 2OTLF 4ERHA 3KY7A 2LCAA 1YHQF 5CA1B 1VQNF 5EIBC 3DC2A 3I56F 4ZHVA 3KJKA 4YVHA 4YJ2B 2NMUA 3C8LA 4NWOB 3N4JA 5C8YA 4G4VA 1GZ0A 3JASB 1M1KH 3GTZA 1YQNA 4JWFA 4YQQA 4TV9B 3BYQA 5CB4A 3LWPC 4MCDA 5DCVA 4YQJA 2KG4A 3JVHA 3N4YA 4YQ5A 5IYZB 4O2BB 5GANK 3FPIA 4CNGA 3KW2A 3FD5A 4C8GA 4YQIA 5FAIA 2EWCA 3E22B 3JAMM 1JJ2F 4X1IA 1QAHA 3CPQA 4TUYB 3RE3A 5FLXM 2KTUA 2UYNB 2UYPA 3CMAF 5GM8A 4PWTA 5JQGB 3RYIB 5LXTB 4TV8B 3VOAA 3HAXD 4YPZA 3I7TA 4O4HB 4YVJA 5MN4A 2VXYA 4YQ2A 4B45A 5IYZA 1Z5WA 2VAMA 3ZOPA 1JFFB 2JNBA 5LP6C 4CNDA 3CCLF 3CCSF 4MCBA 1XHOA 3K2XA 3FBAA 5BMVA 3P10A 4YPWA 4TUYA 3EORA 3VIUA 4ZHQB 5HY0A 1OY5A 1W55A 3HTNA 3IEFA 4B46A 4YQPA 3WPWA 5LXTA 1DBFA 3KE1A 3VYUC 3LWRC 3CPWF 4O4HA 5ITZB 3GYQA 1IPAA 3TD5A 3V7EA 4C4WC 2GZLA 4X3MA 1UI9A 3WGKA 4RQOA 4ZI7A 5MN5A 2Z1FA 4RHAA 4DRXB 1JFFA 2R751 1T0KB 1VQ7F 5HY1A 2EGWA 3M84A 3ZP4A 5AVMA 2QTPA 3CG6A 4HNAA 3JATB 1W3EX 1X7PA 2HP0B 3IEQA 3WGMA 2AIFA 5LOVB 4BT3A 5FJ4C 1NS5A 1VHKA 2DT4A 2GVIA 3PLAC 4YQAA 1TUBA 4EB6B 5ITZA 4U39A 1ODEA 2R6R1 3O7BA 1X25A 2ZODA 2OTMA 1Q86H 3HKEA 4YQ1A 3OIJA 1JD1A 4BVSA 2YXZA 3NK6A 5EO3A 3F0FA 5JCOA 2HP3A 3OBYA 1V6ZA 1NMUB 4I4TB 5FNVB 5GMCA 1TVKB 4YQ3A 3JARB 5LOVA 1K8AH 3E20B 1YIJF 4YQ8A 3N4KA 3RA5A 4E6EA 4C8IA 3MQWA 5HY4A 4RG1A 3OIIA 4BVRA 5HXUA 1H47A 2HRYA 2UYJA 1MXIA 4YQNA 2UZHA 4X3LA 1JY8A 1W2BF 3N2KB 5GIPC 2RB9A 5EZYB 2CHTA 4ZOLB 1SA0B 1FNKA 1YITF 2HS4A 1TVKA 2YYEA 3F0GA 1IV4A 3JARA 4G4YA 1FNJA 3N2GB 1QU9A 2V3KA 1KNKA 3JCMM 3QTYA 4O4JB 3IKFA 5HWEA 5J2TB 4XCQA 4B5CA 2FGYA 1TO0A 4PZKA 1YJ9F 3NK7A 5GONB 3IMPA 2K1SA 2PHNA 3N2KA 4IIJA 3ESJA 3HKBA 2PMPA 3SIUA 1IV2A 5LP6B 3O85A 1U3PA 3WGJA 3OBWA 4I55A 2LBWA 2CW4A 2BTQB 3LFOA 3TD3A 1GX1A 1RQ2A 5HY2A 3MCAB 4O4JA 1IV1A 4C81A 5J2TA 1KC8H 1Q8RA 3TD4A 3U0OA 2OZBA 1J85A 3D54A 1XRGA 3CXCF 5D9FA 2BTUA 5CA1A 3D01A 4BT6A 3AXZA 1W5AA 3WPXA 3OW2F 4YQ0A 2H6LA 2Z01A 3LWQC 4YJ2A 2H8EA 4EI8A 2QEXF 3DDNA 5LP6A 3JASA 4TV9A 4YQ9A 3JAWB 3VMFB 3HKDB 3RA6A 4YQTA 2ZOVA 5CO4A 4CNFA 4YQGA 4C8EA 3I3FA 3RYFB 4BT5A 5GAPK 4J3CA 3G6EF 3WGNA 2CZWA 3P0ZA 5KMGB 3C9TA 4O2BA 1P9PA 4EI9A 3VYTC 1U40A 1Z85A 3HJWC 4G4WA 5LYJB 2QA4F 1VQ5F 3HKCB 3E22A 4KDZA 3S0YA 1DT9A 2ALEA 2UYNA 5JQGA 4G4ZA 3RYIA 3LMEA 3JAWA 4TV8A 3S0WA 1VQ4F 4E8BA 3V3TA 2P6YA 4XBOA 4O4LB 4EI7A 1O6DA 1VHAA 4YQ6A 2AIZP 2RHLA 2HVYD 3HWUA 1CLIA 1RA4A 2CX8A 2CVLA 3LWVC 3CMEF 1VQ8F 3HKCA 4M8IA 4LNUB 3MDOA 4ZHQA 3S03A 2CWJA 4L69A 4LCKA 4O4IB 2HX0A 3MBMA 4IHJB 1VQLF 2H8CA 1W5EA 4BVQA 5J2UB 3V4DA 3ON1A 3MCQA 3CCMF 4H3ZA 5G4UC 3CYPB 5JVDB 4DRXA 1W59A 4YQOA 1VHYA 3IR9A 4X1YB 5HP7A 4X1KB 1RQ7A 1S72F 3D00A 1FSZA 4BW0B 2Q1YA 5IJ0B 3G71F 5MN6A 1VQPF 3DCMX 3IEWA 4LNUA 1KQSF 1VQVA 4O2AB 3JATA 2Z0YA 2HP0A 3F6MA 3T80A 5EIBD 4YVIA 3S0HA 4IHJA 4KWEA 3NMUC 5B8FA 1K3RA 5J2UA 1VQ6F 1OFUA 5LA6B 4EB6A 3CC2F 2ZVYA 5G4VC 3NVKE 1YGYA 2UYKA 5JVDA 3F0DA 1RLGA 3UT5B 3ILKA 2HS0A 1IV3A 1W42A 2N48A 1W5FA 5KX5B 5IJ0A 3ELCA 4I4TA 1UAMA 2Z1UA 3M1XA 5FNVA 1VK3A 4O2AA 3J80M 1KD1H 3JALB 4MCCA 3AGKA 3JAKB 1Q82H 1VQ9F 3LWOC 4JWJA 1XV2A 5LA6A 3RYCB 3K12A 1N8RH 3K14A 3F0EA 2CHSA 5IT9M 3ONPA 3N4ZA 2HQSC 4BT2A 5IJ9B 2OTJF 4ZHYB 4G88A 3UT5A 2L26A 5EB1B 5EZYA 1VQKF 4FMWA 2HRUA 1Z5VA 2DYYA 2KTVA 3M4SA 4U3JB 4BVTA 3GHZA 4BT7A 4ZOLA 2VGMA 1SA0A 3KIZA 1NJIH 1UFYA 4FAKA 1UAKA 3JAKA 3IC6A 3N2GA 2ZF8A 5EB0A 1PF5A 4YQCA 3WJPA 3VI6A 3WJRA 1CN7A 1YJNF 4YJ3B 3CC7F 1T0AA 4YQKA 4C82A 5IJ9A 1R1MA 2WALA 4X20B 5GONA 3ZO8A 4G4XA 1E7KA 3KNUA 2RHOA 4IG6A 4U3JA 4X1IB 2QMMA 4BT4A 2KGWA 4JALA 3CB2A 1YI2F 1ZJRA 2LBXA 1U3LA 1W40A 2IAFA 1ONIA 2ZAUA 2HA8A 1ZWZA 3SIVA 4YJ3A 1QVFF 2VGNA 1M90H 3WJQA 4DXDA 3CC4F 4X20A 5GMBA 1U43A 4KGNA 1X7OA 2BTOA 2I6RA 3WGLA 4ZK7A 5BMVB 3IKEA 2LBTA 4R40B 3VTIC 5HXZA 2Z1TA 3LDTA 1JN1A 3HKDA 2YY8A 1W5BA 3L7QA 3AIAA 1SDSA 4YQDA 1Q81H 4FFBB 3RYFA 2I6DA 1NXZA 2RHHA 5KMGA 1K9MH 4ZI7B 1W581 4YVGA 3C9RA 5JH7B 3CCRF 3CYQA 3WXMB 2OHWA 5LYJA 3J81M 4I50B 3G4SF 4YQ4A 4HNAB 2O3AA 1X52A 3CCJF 1PXWA 4B62A 1GO1A 3C9SA 2B33A 1VH8A 5EWRA 4H3YA 1TUBB 1NQ3A 4O4LA 3E5YA 4FFBA 2QI2A 4ZHWA 4YQSA 3HKEB 2FC3A 1SZQA 5EYPB 5GIOC 5JH7A 4YPYA 3S02A 5CA0B 1H7MA 1KNJA 3BBEA 3CD6F 3NVIB 4I50A 3RYHB 1XBIA 2Z1EA 1V2XA 2VAWA 3K0TA 4BY9D 3FFMA 3J7AR 1QD9A 1OAPA 4F6RB 4O4IA 3V7QA 4NQ3A
chains in the Genus database with same CATH topology
1W41A 1Q7YH 2EGVA 4YPXA 4CNEA 4TZZA 3BBDA 3AI9X 3PAFA 4YQBA 5A2QM 1QVGF 3OINA 3CCQF 1YJWF 2GLZA 2BO1A 1VQOF 1VQMF 4YQRA 3CCEF 3I55F 4JWHA 4YQ7A 1VH0A 1CK2A 4JWGA 3KTYA 2QWVA 2V3JA 1K73H 4YVKA 1UAJA 1GO0A 4YQLA 3CCUF 3QUVA 4JAKA 2F9ZC 4NUTA 1UALA 3L8UA 3CCVF 3BBHA 3E1YA 5GINC 2OTLF 3KY7A 1YHQF 1VQNF 3I56F 4YVHA 3N4JA 1GZ0A 1M1KH 4JWFA 4YQQA 3LWPC 4MCDA 5DCVA 4YQJA 2KG4A 3N4YA 4YQ5A 5GANK 4CNGA 3KW2A 4YQIA 5FAIA 3JAMM 1JJ2F 3CPQA 5FLXM 2KTUA 3CMAF 5GM8A 3HAXD 4YPZA 4YVJA 4YQ2A 2JNBA 4CNDA 3CCLF 3CCSF 4MCBA 4YPWA 5HY0A 1OY5A 3IEFA 4YQPA 3LWRC 3CPWF 3GYQA 1IPAA 3V7EA 4C4WC 4X3MA 1T0KB 1VQ7F 5HY1A 2EGWA 3CG6A 1W3EX 3V7QA 1X7PA 2AIFA 1NS5A 5FJ4C 1VHKA 3PLAC 4YQAA 3O7BA 1Q86H 4YQ1A 3OIJA 4BVSA 3NK6A 5EO3A 3OBYA 1V6ZA 1NMUB 5GMCA 4YQ3A 1K8AH 3E20B 1YIJF 4YQ8A 3N4KA 3RA5A 5HY4A 4RG1A 3OIIA 4BVRA 5HXUA 1MXIA 4YQNA 4X3LA 1W2BF 5GIPC 1YITF 2V3KA 3JCMM 5HWEA 4XCQA 2FGYA 1TO0A 4PZKA 1YJ9F 3NK7A 3SIUA 3O85A 3OBWA 2LBWA 3LFOA 5HY2A 3MCAB 1KC8H 2OZBA 1J85A 3CXCF 5D9FA 3AXZA 4YQ0A 3OW2F 3LWQC 4EI8A 2QEXF 4YQ9A 3VMFB 3RA6A 4YQTA 4CNFA 5CO4A 4YQGA 5GAPK 4J3CA 3G6EF 2CZWA 1P9PA 4EI9A 1Z85A 3HJWC 2QA4F 1VQ5F 4KDZA 1DT9A 2ALEA 1VQ4F 4E8BA 3V3TA 4XBOA 4EI7A 1O6DA 4YQ6A 2HVYD 1RA4A 2CX8A 1VQ8F 3LWVC 3CMEF 4L69A 4LCKA 1VQLF 4BVQA 3ON1A 3CCMF 4H3ZA 5G4UC 4YQOA 1VHYA 3IR9A 1S72F 3D00A 4BW0B 3G71F 1VQPF 3DCMX 1KQSF 2Z0YA 4YVIA 3NMUC 1K3RA 1VQ6F 3CC2F 5G4VC 3NVKE 1RLGA 3ILKA 1W42A 1UAMA 3J80M 1KD1H 4MCCA 3AGKA 1Q82H 1VQ9F 3LWOC 4JWJA 1N8RH 5IT9M 3ONPA 3N4ZA 2OTJF 4FMWA 1VQKF 2KTVA 4BVTA 2VGMA 1NJIH 4FAKA 1UAKA 3IC6A 4YQCA 3VI6A 1CN7A 1YJNF 3CC7F 4YQKA 2WALA 1E7KA 3KNUA 4IG6A 2QMMA 1YI2F 1ZJRA 2LBXA 1W40A 2HA8A 1ZWZA 3SIVA 1QVFF 2VGNA 1M90H 3CC4F 5GMBA 4KGNA 1X7OA 5HXZA 2YY8A 3AIAA 1SDSA 4YQDA 1Q81H 2I6DA 1NXZA 1K9MH 4YVGA 3CCRF 3WXMB 2OHWA 3J81M 3G4SF 4YQ4A 2O3AA 1X52A 3CCJF 1PXWA 1GO1A 5EWRA 4H3YA 3E5YA 2QI2A 4YQSA 2FC3A 5GIOC 4YPYA 1H7MA 3BBEA 3CD6F 3NVIB 1XBIA 1V2XA 4BY9D 3FFMA 3J7AR 4JALA 4NQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Z A;  1OY5 A;  1W41 A;  3IEF A;  3LWQ C;  1Q7Y H;  2OTJ F;  4YQP A;  2EGV A;  2QEX F;  4YPX A;  4CNE A;  4TZZ A;  3BBD A;  1VQK F;  3LWR C;  3CPW F;  2KTV A;  3AI9 X;  3GYQ A;  1IPA A;  3PAF A;  3V7E A;  4C4W C;  2VGM A;  4YQB A;  3VMF B;  4YQ9 A;  4X3M A;  3RA6 A;  5A2Q M;  1QVG F;  1NJI H;  3CCQ F;  5CO4 A;  4YQT A;  4CNF A;  4FAK A;  4YQG A;  3OIN A;  1UAK A;  3IC6 A;  4YQ0 A;  1T0K B;  1VQ7 F;  5GAP K;  4J3C A;  3G6E F;  2CZW A;  2EGW A;  4YQC A;  3VI6 A;  1YJW F;  1P9P A;  2BO1 A;  1CN7 A;  1YJN F;  1VQO F;  1Z85 A;  3CC7 F;  3HJW C;  3CG6 A;  2QA4 F;  1W3E X;  1VQ5 F;  1X7P A;  1VQM F;  4YQR A;  4YQK A;  3CCE F;  4KDZ A;  2AIF A;  1NS5 A;  3I55 F;  5FJ4 C;  2WAL A;  1DT9 A;  1VH0 A;  4YQ7 A;  1VHK A;  1CK2 A;  1E7K A;  2ALE A;  3KNU A;  3PLA C;  4YQA A;  3KTY A;  4IG6 A;  2QWV A;  2V3J A;  1K73 H;  4YVK A;  1UAJ A;  1GO0 A;  1VQ4 F;  2QMM A;  3O7B A;  4YQL A;  4E8B A;  1Q86 H;  4YQ1 A;  3CCU F;  3QUV A;  4XBO A;  3OIJ A;  4JAK A;  4JAL A;  1YI2 F;  1ZJR A;  1O6D A;  3NK6 A;  2LBX A;  4NUT A;  1W40 A;  4YQ6 A;  1UAL A;  5EO3 A;  2HA8 A;  2HVY D;  1ZWZ A;  3OBY A;  1V6Z A;  1NMU B;  3SIV A;  3L8U A;  1RA4 A;  2CX8 A;  1QVF F;  2VGN A;  3CCV F;  1M90 H;  3LWV C;  3CME F;  1VQ8 F;  5GMC A;  3BBH A;  4YQ3 A;  3E1Y A;  1K8A H;  3CC4 F;  3E20 B;  5GIN C;  2OTL F;  1YIJ F;  4YQ8 A;  3KY7 A;  3N4K A;  5GMB A;  3RA5 A;  4KGN A;  1X7O A;  1YHQ F;  4L69 A;  4LCK A;  4RG1 A;  3OII A;  1VQN F;  1VQL F;  3I56 F;  4YVH A;  3ON1 A;  1MXI A;  4YQN A;  4X3L A;  3CCM F;  4H3Z A;  1W2B F;  5G4U C;  2YY8 A;  3N4J A;  5GIP C;  1GZ0 A;  1M1K H;  3AIA A;  1SDS A;  4YQO A;  1Q81 H;  4YQD A;  1VHY A;  4YQQ A;  3IR9 A;  2I6D A;  1YIT F;  1NXZ A;  1S72 F;  1K9M H;  4BW0 B;  3LWP C;  3G71 F;  1VQP F;  3DCM X;  4YVG A;  4MCD A;  5DCV A;  4YQJ A;  2V3K A;  3CCR F;  2KG4 A;  3JCM M;  1KQS F;  3WXM B;  2OHW A;  2Z0Y A;  3N4Y A;  3J81 M;  4YQ5 A;  5GAN K;  4CNG A;  3KW2 A;  3G4S F;  4YQI A;  4YVI A;  1TO0 A;  5FAI A;  4YQ4 A;  3NMU C;  2O3A A;  1X52 A;  1K3R A;  3CCJ F;  4PZK A;  1YJ9 F;  3NK7 A;  1PXW A;  3JAM M;  1VQ6 F;  1JJ2 F;  3CC2 F;  1GO1 A;  3CPQ A;  5G4V C;  3NVK E;  5FLX M;  2KTU A;  5EWR A;  3CMA F;  5GM8 A;  1RLG A;  4H3Y A;  3SIU A;  3E5Y A;  3ILK A;  2QI2 A;  1W42 A;  4YPW A;  3O85 A;  4YQS A;  3OBW A;  3HAX D;  4YPZ A;  2FC3 A;  2LBW A;  5GIO C;  4YPY A;  3LFO A;  1UAM A;  4YVJ A;  3J80 M;  1KD1 H;  1H7M A;  3MCA B;  3BBE A;  4YQ2 A;  3OW2 F;  3CD6 F;  3NVI B;  3AGK A;  4MCC A;  1KC8 H;  1XBI A;  1Q82 H;  1VQ9 F;  2OZB A;  1J85 A;  1V2X A;  2JNB A;  3LWO C;  3CCL F;  3CCS F;  4BY9 D;  4CND A;  3CXC F;  4MCB A;  3FFM A;  3J7A R;  5D9F A;  1N8R H;  3AXZ A;  5IT9 M;  3V7Q A;  3ONP A; 
#chains in the Genus database with same CATH topology
 1W41 A;  5HP8 A;  2MQE A;  1Q7Y H;  3QUW A;  2EGV A;  4YPX A;  4CNE A;  4TZZ A;  2G9I A;  3BBD A;  2RHJ A;  5EYP A;  3ZP7 A;  3VO8 A;  3B6N A;  3PAF A;  3AI9 X;  4YQB A;  5CA0 A;  4X1Y A;  3KJJ A;  3QHD A;  1FFX B;  4X1K A;  5A2Q M;  1QVG F;  1RLU A;  1COM A;  3CCQ F;  4WBN B;  3OIN A;  3RYH A;  2AMT A;  3VYS C;  2CSL A;  5EAZ A;  1J7H A;  1YJW F;  2GLZ A;  4F6R A;  2BO1 A;  2IQQ A;  3ERN A;  1VQO F;  2W8B C;  3LYB A;  2IG8 A;  1H48 A;  1VQM F;  4YQR A;  3CCE F;  3I55 F;  4JWH A;  4YQ7 A;  1VH0 A;  3R0P A;  1CK2 A;  3Q8H A;  4JWG A;  3VCZ A;  2Q1X A;  3OON A;  3KTY A;  2QWV A;  5JCO C;  2V3J A;  3VOB A;  1K73 H;  3P4E A;  4YVK A;  1UAJ A;  1GO0 A;  2HS3 A;  1FFX A;  4YQL A;  4IIJ B;  3FD6 A;  5KX5 A;  4WBN A;  3CCU F;  3QUV A;  4JAK A;  3HKB B;  2F9Z C;  1W57 A;  4NUT A;  1UAL A;  3JAL A;  5C8Y B;  4I55 B;  3C9U A;  3L8U A;  2ZVZ A;  5CB4 B;  3CCV F;  3S06 A;  3BBH A;  2V9Y A;  3RYC A;  3E1Y A;  3KHN A;  2VAP A;  5GIN C;  2OTL F;  4ERH A;  3KY7 A;  2LCA A;  1YHQ F;  5CA1 B;  1VQN F;  5EIB C;  3DC2 A;  3I56 F;  4ZHV A;  3KJK A;  4YVH A;  4YJ2 B;  2NMU A;  3C8L A;  4NWO B;  3N4J A;  5C8Y A;  4G4V A;  1GZ0 A;  3JAS B;  1M1K H;  3GTZ A;  1YQN A;  4JWF A;  4YQQ A;  4TV9 B;  3BYQ A;  5CB4 A;  3LWP C;  4MCD A;  5DCV A;  4YQJ A;  2KG4 A;  3JVH A;  3N4Y A;  4YQ5 A;  5IYZ B;  4O2B B;  5GAN K;  3FPI A;  4CNG A;  3KW2 A;  3FD5 A;  4C8G A;  4YQI A;  5FAI A;  2EWC A;  3E22 B;  3JAM M;  1JJ2 F;  4X1I A;  1QAH A;  3CPQ A;  4TUY B;  3RE3 A;  5FLX M;  2KTU A;  2UYN B;  2UYP A;  3CMA F;  5GM8 A;  4PWT A;  5JQG B;  3RYI B;  5LXT B;  4TV8 B;  3VOA A;  3HAX D;  4YPZ A;  3I7T A;  4O4H B;  4YVJ A;  5MN4 A;  2VXY A;  4YQ2 A;  4B45 A;  5IYZ A;  1Z5W A;  2VAM A;  3ZOP A;  1JFF B;  2JNB A;  5LP6 C;  4CND A;  3CCL F;  3CCS F;  4MCB A;  1XHO A;  3K2X A;  3FBA A;  5BMV A;  3P10 A;  4YPW A;  4TUY A;  3EOR A;  3VIU A;  4ZHQ B;  5HY0 A;  1OY5 A;  1W55 A;  3HTN A;  3IEF A;  4B46 A;  4YQP A;  3WPW A;  5LXT A;  1DBF A;  3KE1 A;  3VYU C;  3LWR C;  3CPW F;  4O4H A;  5ITZ B;  3GYQ A;  1IPA A;  3TD5 A;  3V7E A;  4C4W C;  2GZL A;  4X3M A;  1UI9 A;  3WGK A;  4RQO A;  4ZI7 A;  5MN5 A;  2Z1F A;  4RHA A;  4DRX B;  1JFF A;  2R75 1;  1T0K B;  1VQ7 F;  5HY1 A;  2EGW A;  3M84 A;  3ZP4 A;  5AVM A;  2QTP A;  3CG6 A;  4HNA A;  3JAT B;  1W3E X;  1X7P A;  2HP0 B;  3IEQ A;  3WGM A;  2AIF A;  5LOV B;  4BT3 A;  5FJ4 C;  1NS5 A;  1VHK A;  2DT4 A;  2GVI A;  3PLA C;  4YQA A;  1TUB A;  4EB6 B;  5ITZ A;  4U39 A;  1ODE A;  2R6R 1;  3O7B A;  1X25 A;  2ZOD A;  2OTM A;  1Q86 H;  3HKE A;  4YQ1 A;  3OIJ A;  1JD1 A;  4BVS A;  2YXZ A;  3NK6 A;  5EO3 A;  3F0F A;  5JCO A;  2HP3 A;  3OBY A;  1V6Z A;  1NMU B;  4I4T B;  5FNV B;  5GMC A;  1TVK B;  4YQ3 A;  3JAR B;  5LOV A;  1K8A H;  3E20 B;  1YIJ F;  4YQ8 A;  3N4K A;  3RA5 A;  4E6E A;  4C8I A;  3MQW A;  5HY4 A;  4RG1 A;  3OII A;  4BVR A;  5HXU A;  1H47 A;  2HRY A;  2UYJ A;  1MXI A;  4YQN A;  2UZH A;  4X3L A;  1JY8 A;  1W2B F;  3N2K B;  5GIP C;  2RB9 A;  5EZY B;  2CHT A;  4ZOL B;  1SA0 B;  1FNK A;  1YIT F;  2HS4 A;  1TVK A;  2YYE A;  3F0G A;  1IV4 A;  3JAR A;  4G4Y A;  1FNJ A;  3N2G B;  1QU9 A;  2V3K A;  1KNK A;  3JCM M;  3QTY A;  4O4J B;  3IKF A;  5HWE A;  5J2T B;  4XCQ A;  4B5C A;  2FGY A;  1TO0 A;  4PZK A;  1YJ9 F;  3NK7 A;  5GON B;  3IMP A;  2K1S A;  2PHN A;  3N2K A;  4IIJ A;  3ESJ A;  3HKB A;  2PMP A;  3SIU A;  1IV2 A;  5LP6 B;  3O85 A;  1U3P A;  3WGJ A;  3OBW A;  4I55 A;  2LBW A;  2CW4 A;  2BTQ B;  3LFO A;  3TD3 A;  1GX1 A;  1RQ2 A;  5HY2 A;  3MCA B;  4O4J A;  1IV1 A;  4C81 A;  5J2T A;  1KC8 H;  1Q8R A;  3TD4 A;  3U0O A;  2OZB A;  1J85 A;  3D54 A;  1XRG A;  3CXC F;  5D9F A;  2BTU A;  5CA1 A;  3D01 A;  4BT6 A;  3AXZ A;  1W5A A;  3WPX A;  3OW2 F;  4YQ0 A;  2H6L A;  2Z01 A;  3LWQ C;  4YJ2 A;  2H8E A;  4EI8 A;  2QEX F;  3DDN A;  5LP6 A;  3JAS A;  4TV9 A;  4YQ9 A;  3JAW B;  3VMF B;  3HKD B;  3RA6 A;  4YQT A;  2ZOV A;  5CO4 A;  4CNF A;  4YQG A;  4C8E A;  3I3F A;  3RYF B;  4BT5 A;  5GAP K;  4J3C A;  3G6E F;  3WGN A;  2CZW A;  3P0Z A;  5KMG B;  3C9T A;  4O2B A;  1P9P A;  4EI9 A;  3VYT C;  1U40 A;  1Z85 A;  3HJW C;  4G4W A;  5LYJ B;  2QA4 F;  1VQ5 F;  3HKC B;  3E22 A;  4KDZ A;  3S0Y A;  1DT9 A;  2ALE A;  2UYN A;  5JQG A;  4G4Z A;  3RYI A;  3LME A;  3JAW A;  4TV8 A;  3S0W A;  1VQ4 F;  4E8B A;  3V3T A;  2P6Y A;  4XBO A;  4O4L B;  4EI7 A;  1O6D A;  1VHA A;  4YQ6 A;  2AIZ P;  2RHL A;  2HVY D;  3HWU A;  1CLI A;  1RA4 A;  2CX8 A;  2CVL A;  3LWV C;  3CME F;  1VQ8 F;  3HKC A;  4M8I A;  4LNU B;  3MDO A;  4ZHQ A;  3S03 A;  2CWJ A;  4L69 A;  4LCK A;  4O4I B;  2HX0 A;  3MBM A;  4IHJ B;  1VQL F;  2H8C A;  1W5E A;  4BVQ A;  5J2U B;  3V4D A;  3ON1 A;  3MCQ A;  3CCM F;  4H3Z A;  5G4U C;  3CYP B;  5JVD B;  4DRX A;  1W59 A;  4YQO A;  1VHY A;  3IR9 A;  4X1Y B;  5HP7 A;  4X1K B;  1RQ7 A;  1S72 F;  3D00 A;  1FSZ A;  4BW0 B;  2Q1Y A;  5IJ0 B;  3G71 F;  5MN6 A;  1VQP F;  3DCM X;  3IEW A;  4LNU A;  1KQS F;  1VQV A;  4O2A B;  3JAT A;  2Z0Y A;  2HP0 A;  3F6M A;  3T80 A;  5EIB D;  4YVI A;  3S0H A;  4IHJ A;  4KWE A;  3NMU C;  5B8F A;  1K3R A;  5J2U A;  1VQ6 F;  1OFU A;  5LA6 B;  4EB6 A;  3CC2 F;  2ZVY A;  5G4V C;  3NVK E;  1YGY A;  2UYK A;  5JVD A;  3F0D A;  1RLG A;  3UT5 B;  3ILK A;  2HS0 A;  1IV3 A;  1W42 A;  2N48 A;  1W5F A;  5KX5 B;  5IJ0 A;  3ELC A;  4I4T A;  1UAM A;  2Z1U A;  3M1X A;  5FNV A;  1VK3 A;  4O2A A;  3J80 M;  1KD1 H;  3JAL B;  4MCC A;  3AGK A;  3JAK B;  1Q82 H;  1VQ9 F;  3LWO C;  4JWJ A;  1XV2 A;  5LA6 A;  3RYC B;  3K12 A;  1N8R H;  3K14 A;  3F0E A;  2CHS A;  5IT9 M;  3ONP A;  3N4Z A;  2HQS C;  4BT2 A;  5IJ9 B;  2OTJ F;  4ZHY B;  4G88 A;  3UT5 A;  2L26 A;  5EB1 B;  5EZY A;  1VQK F;  4FMW A;  2HRU A;  1Z5V A;  2DYY A;  2KTV A;  3M4S A;  4U3J B;  4BVT A;  3GHZ A;  4BT7 A;  4ZOL A;  2VGM A;  1SA0 A;  3KIZ A;  1NJI H;  1UFY A;  4FAK A;  1UAK A;  3JAK A;  3IC6 A;  3N2G A;  2ZF8 A;  5EB0 A;  1PF5 A;  4YQC A;  3WJP A;  3VI6 A;  3WJR A;  1CN7 A;  1YJN F;  4YJ3 B;  3CC7 F;  1T0A A;  4YQK A;  4C82 A;  5IJ9 A;  1R1M A;  2WAL A;  4X20 B;  5GON A;  3ZO8 A;  4G4X A;  1E7K A;  3KNU A;  2RHO A;  4IG6 A;  4U3J A;  4X1I B;  2QMM A;  4BT4 A;  2KGW A;  4JAL A;  3CB2 A;  1YI2 F;  1ZJR A;  2LBX A;  1U3L A;  1W40 A;  2IAF A;  1ONI A;  2ZAU A;  2HA8 A;  1ZWZ A;  3SIV A;  4YJ3 A;  1QVF F;  2VGN A;  1M90 H;  3WJQ A;  4DXD A;  3CC4 F;  4X20 A;  5GMB A;  1U43 A;  4KGN A;  1X7O A;  2BTO A;  2I6R A;  3WGL A;  4ZK7 A;  5BMV B;  3IKE A;  2LBT A;  4R40 B;  3VTI C;  5HXZ A;  2Z1T A;  3LDT A;  1JN1 A;  3HKD A;  2YY8 A;  1W5B A;  3L7Q A;  3AIA A;  1SDS A;  4YQD A;  1Q81 H;  4FFB B;  3RYF A;  2I6D A;  1NXZ A;  2RHH A;  5KMG A;  1K9M H;  4ZI7 B;  1W58 1;  4YVG A;  3C9R A;  5JH7 B;  3CCR F;  3CYQ A;  3WXM B;  2OHW A;  5LYJ A;  3J81 M;  4I50 B;  3G4S F;  4YQ4 A;  4HNA B;  2O3A A;  1X52 A;  3CCJ F;  1PXW A;  4B62 A;  1GO1 A;  3C9S A;  2B33 A;  1VH8 A;  5EWR A;  4H3Y A;  1TUB B;  1NQ3 A;  4O4L A;  3E5Y A;  4FFB A;  2QI2 A;  4ZHW A;  4YQS A;  3HKE B;  2FC3 A;  1SZQ A;  5EYP B;  5GIO C;  5JH7 A;  4YPY A;  3S02 A;  5CA0 B;  1H7M A;  1KNJ A;  3BBE A;  3CD6 F;  3NVI B;  4I50 A;  3RYH B;  1XBI A;  2Z1E A;  1V2X A;  2VAW A;  3K0T A;  4BY9 D;  3FFM A;  3J7A R;  1QD9 A;  1OAP A;  4F6R B;  4O4I A;  3V7Q A;  4NQ3 A; 
#chains in the Genus database with same CATH homology
 1W41 A;  1Q7Y H;  2EGV A;  4YPX A;  4CNE A;  4TZZ A;  3BBD A;  3AI9 X;  3PAF A;  4YQB A;  5A2Q M;  1QVG F;  3OIN A;  3CCQ F;  1YJW F;  2GLZ A;  2BO1 A;  1VQO F;  1VQM F;  4YQR A;  3CCE F;  3I55 F;  4JWH A;  4YQ7 A;  1VH0 A;  1CK2 A;  4JWG A;  3KTY A;  2QWV A;  2V3J A;  1K73 H;  4YVK A;  1UAJ A;  1GO0 A;  4YQL A;  3CCU F;  3QUV A;  4JAK A;  2F9Z C;  4NUT A;  1UAL A;  3L8U A;  3CCV F;  3BBH A;  3E1Y A;  5GIN C;  2OTL F;  3KY7 A;  1YHQ F;  1VQN F;  3I56 F;  4YVH A;  3N4J A;  1GZ0 A;  1M1K H;  4JWF A;  4YQQ A;  3LWP C;  4MCD A;  5DCV A;  4YQJ A;  2KG4 A;  3N4Y A;  4YQ5 A;  5GAN K;  4CNG A;  3KW2 A;  4YQI A;  5FAI A;  3JAM M;  1JJ2 F;  3CPQ A;  5FLX M;  2KTU A;  3CMA F;  5GM8 A;  3HAX D;  4YPZ A;  4YVJ A;  4YQ2 A;  2JNB A;  4CND A;  3CCL F;  3CCS F;  4MCB A;  4YPW A;  5HY0 A;  1OY5 A;  3IEF A;  4YQP A;  3LWR C;  3CPW F;  3GYQ A;  1IPA A;  3V7E A;  4C4W C;  4X3M A;  1T0K B;  1VQ7 F;  5HY1 A;  2EGW A;  3CG6 A;  1W3E X;  3V7Q A;  1X7P A;  2AIF A;  1NS5 A;  5FJ4 C;  1VHK A;  3PLA C;  4YQA A;  3O7B A;  1Q86 H;  4YQ1 A;  3OIJ A;  4BVS A;  3NK6 A;  5EO3 A;  3OBY A;  1V6Z A;  1NMU B;  5GMC A;  4YQ3 A;  1K8A H;  3E20 B;  1YIJ F;  4YQ8 A;  3N4K A;  3RA5 A;  5HY4 A;  4RG1 A;  3OII A;  4BVR A;  5HXU A;  1MXI A;  4YQN A;  4X3L A;  1W2B F;  5GIP C;  1YIT F;  2V3K A;  3JCM M;  5HWE A;  4XCQ A;  2FGY A;  1TO0 A;  4PZK A;  1YJ9 F;  3NK7 A;  3SIU A;  3O85 A;  3OBW A;  2LBW A;  3LFO A;  5HY2 A;  3MCA B;  1KC8 H;  2OZB A;  1J85 A;  3CXC F;  5D9F A;  3AXZ A;  4YQ0 A;  3OW2 F;  3LWQ C;  4EI8 A;  2QEX F;  4YQ9 A;  3VMF B;  3RA6 A;  4YQT A;  4CNF A;  5CO4 A;  4YQG A;  5GAP K;  4J3C A;  3G6E F;  2CZW A;  1P9P A;  4EI9 A;  1Z85 A;  3HJW C;  2QA4 F;  1VQ5 F;  4KDZ A;  1DT9 A;  2ALE A;  1VQ4 F;  4E8B A;  3V3T A;  4XBO A;  4EI7 A;  1O6D A;  4YQ6 A;  2HVY D;  1RA4 A;  2CX8 A;  1VQ8 F;  3LWV C;  3CME F;  4L69 A;  4LCK A;  1VQL F;  4BVQ A;  3ON1 A;  3CCM F;  4H3Z A;  5G4U C;  4YQO A;  1VHY A;  3IR9 A;  1S72 F;  3D00 A;  4BW0 B;  3G71 F;  1VQP F;  3DCM X;  1KQS F;  2Z0Y A;  4YVI A;  3NMU C;  1K3R A;  1VQ6 F;  3CC2 F;  5G4V C;  3NVK E;  1RLG A;  3ILK A;  1W42 A;  1UAM A;  3J80 M;  1KD1 H;  4MCC A;  3AGK A;  1Q82 H;  1VQ9 F;  3LWO C;  4JWJ A;  1N8R H;  5IT9 M;  3ONP A;  3N4Z A;  2OTJ F;  4FMW A;  1VQK F;  2KTV A;  4BVT A;  2VGM A;  1NJI H;  4FAK A;  1UAK A;  3IC6 A;  4YQC A;  3VI6 A;  1CN7 A;  1YJN F;  3CC7 F;  4YQK A;  2WAL A;  1E7K A;  3KNU A;  4IG6 A;  2QMM A;  1YI2 F;  1ZJR A;  2LBX A;  1W40 A;  2HA8 A;  1ZWZ A;  3SIV A;  1QVF F;  2VGN A;  1M90 H;  3CC4 F;  5GMB A;  4KGN A;  1X7O A;  5HXZ A;  2YY8 A;  3AIA A;  1SDS A;  4YQD A;  1Q81 H;  2I6D A;  1NXZ A;  1K9M H;  4YVG A;  3CCR F;  3WXM B;  2OHW A;  3J81 M;  3G4S F;  4YQ4 A;  2O3A A;  1X52 A;  3CCJ F;  1PXW A;  1GO1 A;  5EWR A;  4H3Y A;  3E5Y A;  2QI2 A;  4YQS A;  2FC3 A;  5GIO C;  4YPY A;  1H7M A;  3BBE A;  3CD6 F;  3NVI B;  1XBI A;  1V2X A;  4BY9 D;  3FFM A;  3J7A R;  4JAL A;  4NQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...