2I6DA

The structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
251
Chain Sequence
AMLSANQIKFLRSLRERKYRLREQAFAVEGPKLVGEMLPFYRCRMLVGTAAMLRAVSTPHDAEVVELPESFDFKRISTQTTPQPLMAVFDLPAEPEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASMGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVESLNVAIATAILCSEWRRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA methyltransferase, TrmH family
publication title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
total genus 73
structure length 251
sequence length 255
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2i6dA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2i6dA02
3NVIB 3O85A 3BBEA 4YQBA 3I55F 1YJWF 3J7AR 3V7EA 2YY8A 1CK2A 5EWRA 4CNDA 5G4UC 4BY9D 5FJ4C 3WXMB 4YQDA 3VMFB 2LBXA 1K9MH 4YQ1A 4XBOA 1VQ5F 4JALA 1OY5A 3N4ZA 1ZWZA 4JAKA 4YQPA 3KNUA 3CCEF 3AGKA 3CMAF 3E5YA 2CX8A 1X7OA 3CCVF 4YQIA 4H3ZA 4YPXA 1VHYA 3KW2A 3CCRF 4YQQA 1W42A 5GIPC 3BBDA 1NXZA 5FLXM 4CNGA 1VQOF 3OINA 1K8AH 1RA4A 3QUVA 3CC4F 2HVYD 2HA8A 4YQ5A 3HJWC 4LCKA 1CN7A 4YQCA 5IT9M 3J80M 1VQ6F 1PXWA 3VI6A 4YPZA 5G4VC 1J85A 1S72F 3SIUA 5DCVA 1KQSF 3N4JA 3NK6A 3AIAA 3SIVA 2KTUA 4YQTA 2OTLF 5A2QM 4YQLA 1GO0A 1YITF 2QA4F 3IR9A 1UAMA 5GANK 3ONPA 4YQSA 1X7PA 2KTVA 4YPWA 1YIJF 3OBYA 3G6EF 1SDSA 4NUTA 1UAJA 3J81M 1KD1H 1VQLF 4YQ2A 2I6DA 1Q81H 4MCBA 2AIFA 3LWOC 1X52A 3LWRC 3CCMF 1Q82H 1YI2F 1VQ8F 1VH0A 1DT9A 3HAXD 3AI9X 4MCCA 1QVFF 4PZKA 1E7KA 4L69A 3CPQA 1V2XA 3JAMM 1VQMF 2Z0YA 4RG1A 2BO1A 3PLAC 4H3YA 1YJNF 3E1YA 1YJ9F 3CC2F 5GAPK 4YQ4A 1Q7YH 1NMUB 1IPAA 3AXZA 4YQNA 2VGNA 2EGWA 2V3KA 2WALA 1TO0A 4YQJA 4YVKA 4YPYA 3PAFA 1H7MA 2CZWA 1UALA 3MCAB 4YQ7A 1Q86H 5GMBA 5FAIA 3LFOA 4CNFA 5GIOC 1QVGF 1VQ9F 3ON1A 1O6DA 3DCMX 1MXIA 3IC6A 4YQKA 4E8BA 4YVJA 1VQ7F 3RA5A 3LWQC 2QMMA 1Z85A 1W40A 1VQ4F 2O3AA 2V3JA 3CCUF 1VQNF 1JJ2F 2JNBA 4TZZA 3CCSF 1NS5A 3RA6A 3I56F 1ZJRA 3O7BA 3OIIA 4YQ8A 3OIJA 3CCJF 2KG4A 2OHWA 3N4KA 1GO1A 1K3RA 4CNEA 3IEFA 3CD6F 3NK7A 1KC8H 2FC3A 1N8RH 1VQKF 3ILKA 3JCMM 4YQ3A 5GMCA 4C4WC 2ALEA 1NJIH 2OZBA 3NVKE 3KTYA 4YQ6A 2QEXF 4YQOA 4IG6A 4X3MA 3CG6A 3CMEF 3OBWA 3N4YA 4YVHA 1XBIA 4FAKA 1GZ0A 3CPWF 4KDZA 1YHQF 3V7QA 3CXCF 4BW0B 3GYQA 3LWPC 1RLGA 3CC7F 1UAKA 2QWVA 3KY7A 4J3CA 3BBHA 5GM8A 4YQ0A 1T0KB 3OW2F 3L8UA 1M90H 4YQ9A 1V6ZA 5GINC 3CCQF 3NMUC 3G4SF 2EGVA 4KGNA 4YVGA 1K73H 1VQPF 5CO4A 5D9FA 1W41A 3G71F 3E20B 2VGMA 1VHKA 4YVIA 3LWVC 4X3LA 4YQRA 1P9PA 2LBWA 4YQGA 3CCLF 1W3EX 1M1KH 4MCDA 2OTJF 2QI2A 4YQAA 3FFMA 1W2BF 5EO3A
chains in the Genus database with same CATH superfamily
2UYJA 4U3JA 3WGNA 4ZI7B 3F0GA 3BBEA 3I55F 3ELCA 3F0EA 5EWRA 1QU9A 5JVDA 4BY9D 3JASB 3VMFB 1K9MH 4YQ1A 4XBOA 4LNUA 1ZWZA 4JAKA 2DT4A 4YJ3B 3CMAF 4O4HB 4G4ZA 4O4IB 3UT5B 1X7OA 5HY0A 5CA1A 1VHYA 3HKEA 4C81A 3WPXA 4I50B 1FNKA 2UYNA 3OONA 3KIZA 1VQOF 4F6RA 1RLUA 2HA8A 2IQQA 4FFBB 4YQCA 3CYPB 2F9ZC 4YPZA 3VI6A 3JATB 2ZODA 4C82A 3C8LA 5HXUA 1KQSF 3SIVA 1W5FA 4ZK7A 3JALA 3RYIA 4YQLA 4M8IA 5LYJA 4JWGA 2ZF8A 5LOVB 4C8IA 4XCQA 3S02A 3I3FA 3S0YA 3G6EF 1UAJA 1VQLF 1KD1H 4JWHA 1Q81H 3F0DA 3RE3A 5EAZA 2FGYA 4O4LA 1X52A 3CCMF 1VQ8F 3AI9X 3JARA 5C8YA 1QVFF 3VYUC 3GTZA 2HRUA 1JN1A 2CHSA 5EIBC 5HY1A 1W57A 2Z0YA 1W55A 1YQNA 2BO1A 3WGMA 4DRXA 5HXZA 5MN4A 3CC2F 3M1XA 5GAPK 3MQWA 4WBNB 1SA0B 5GONB 3IKEA 4YQNA 4BVQA 2WALA 2HX0A 3C9SA 2UYKA 4YPYA 1UALA 1Q86H 1VQ9F 2BTQB 3ON1A 3IC6A 1MXIA 3JAWB 5LXTB 4NQ3A 3N2KA 4G4VA 1VQNF 3O7BA 3L7QA 1UFYA 4X20A 3VCZA 3WGLA 3RYCB 2HRYA 3N4KA 3N2GA 2MQEA 4O2BA 3C9TA 4TUYB 4B46A 3CD6F 3K2XA 2FC3A 3HKBB 5MN5A 2ZVYA 1VQKF 5BMVA 2Z1UA 1QAHA 4C4WC 2ALEA 3VTIC 1NJIH 2OZBA 1FSZA 3HWUA 4YQOA 3CMEF 4ZHQA 3S03A 1YHQF 2QWVA 4YQ9A 3CC7F 3V4DA 1QD9A 5EYPA 2HP3A 4ZOLA 3OW2F 3CCQF 4ZHVA 4KGNA 2GVIA 1VQPF 3G71F 5KX5A 5FNVB 2ZVZA 5LA6B 1COMA 2OTJF 2QI2A 2CWJA 4EB6B 3FFMA 4X1KB 3HKCB 3O85A 2ZOVA 2YY8A 5J2TB 4I4TA 2HP0A 5JQGB 1VQ5F 1OY5A 3E22B 4YQPA 3WJPA 3AGKA 1VH8A 1W5EA 3E5YA 2CX8A 4HNAB 3DC2A 1NQ3A 3CCVF 4YQIA 4X1IB 1PF5A 3RYHA 1W42A 1W59A 2CVLA 4ZI7A 4I55B 3BBDA 1SZQA 1RA4A 3IEQA 5MN6A 3JASA 5KMGB 2Q1YA 2Z01A 5AVMA 3J80M 2Z1EA 2YXZA 3U0OA 1VK3A 5EB1B 4YJ3A 5DCVA 3ZOPA 4YQTA 5B8FA 1TVKB 3UT5A 2EWCA 3VOAA 3FD5A 3HKDB 1GO0A 3ESJA 5HY2A 1UAMA 4I50A 1T0AA 4YPWA 4NUTA 3LDTA 2N48A 4FFBA 3S0WA 3LWOC 3WJQA 1VH0A 3JATA 3MDOA 3HAXD 3VYSC 4BT2A 1UI9A 5LP6A 1OFUA 1VQMF 4RG1A 1IV3A 1FNJA 4BT4A 4H3YA 2AIZP 4PWTA 3E1YA 3TD4A 1YJ9F 1JFFA 5LOVA 1YJNF 4YQ4A 2YYEA 5ITZA 1RQ7A 4TV9B 4TV8A 5IJ0A 3ZP4A 2VGNA 1JD1A 3M84A 4YVKA 2GLZA 1IV1A 5FAIA 1XHOA 5JH7A 5JVDB 3DCMX 3IEWA 3D54A 3KE1A 4X1YB 1VQ7F 4IIJB 1W40A 2V3JA 3CCUF 1JJ2F 2JNBA 3OIIA 1ONIA 3DDNA 4WBNA 2KG4A 3EORA 2OHWA 3R0PA 4B62A 5GONA 3IEFA 1KC8H 2BTOA 2RHOA 4F6RB 1TUBA 3FBAA 5GMCA 3NVKE 4B5CA 2H8CA 4G4YA 2QEXF 3CG6A 4YJ2A 3KJKA 3OBWA 3N4YA 4FAKA 5HP7A 3K14A 1R1MA 3CXCF 5J2UA 3GYQA 3RYCA 3RYIB 3BBHA 3P4EA 5LYJB 5IYZB 5CA0A 4G88A 5D9FA 3HKBA 4C8EA 1Z5VA 3E20B 4YVIA 3JAKB 4X3LA 5CB4B 3LMEA 3CCLF 1W3EX 5EZYA 4EI7A 1M1KH 1W5AA 1YGYA 4NWOB 4FMWA 4RQOA 1W2BF 5C8YB 4EI9A 3NVIB 4YQBA 3J7AR 3V7EA 2R6R1 3KJJA 2I6RA 2VAPA 5G4UC 5FJ4C 4YQDA 4DRXB 3VIUA 1FFXA 3N4ZA 1X25A 3VO8A 3KNUA 4R40B 2CSLA 2RHHA 5LA6A 5LP6C 5IJ9A 3JVHA 3CCRF 2KGWA 4EB6A 3KW2A 4X1KA 4YQQA 3HKCA 5GIPC 1NXZA 2ZAUA 5FLXM 4CNGA 3OINA 2UYPA 3CC4F 2HVYD 4LCKA 3N2KB 1RQ2A 1CN7A 2NMUA 1VQ6F 1PXWA 3E22A 4X20B 5G4VC 2RB9A 1JY8A 1U40A 3HTNA 3NK6A 3AIAA 4O2AB 4O2BB 3CB2A 4HNAA 1KNJA 2UZHA 4X1IA 3TD5A 2QA4F 3D00A 3ONPA 5GANK 4YQSA 4IHJB 3BYQA 4YQ2A 2I6DA 4MCBA 2AIFA 3LWRC 2H8EA 3CYQA 4MCCA 3WGJA 4JWFA 1DT9A 4YQAA 4ZOLB 5HWEA 3CPQA 3QHDA 3P0ZA 1TVKA 3Q8HA 3JAMM 3ZP7A 3HKDA 3C9UA 3PLAC 2K1SA 4B45A 2CW4A 4U39A 4O4HA 1NMUB 5EIBD 3AXZA 4O4IA 2Z1TA 2EGWA 1XRGA 2V3KA 1Z5WA 4YQJA 3PAFA 4YQ7A 5GMBA 4YQRA 2HS0A 4CNFA 3K0TA 3KHNA 4BVSA 5GIOC 1QVGF 2G9IA 4E8BA 2RHJA 4YQKA 4YVJA 3RA5A 4EI8A 3LWQC 1Z85A 2R751 3P10A 4TZZA 3CCSF 3RA6A 3I56F 4YQ8A 3OIJA 3MBMA 3RYFB 4TV9A 3ZO8A 1GO1A 1K3RA 4CNEA 3NK7A 1Q8RA 3ILKA 4O4JB 4C8GA 4E6EA 1J7HA 3I7TA 4X1YA 3TD3A 4IG6A 4IIJA 1IV2A 2HS3A 4BT3A 4ERHA 4U3JB 1XBIA 4YVHA 3FD6A 3V7QA 3QUVA 4BW0B 1RLGA 4YQ0A 5HY4A 5HP8A 1T0KB 3L8UA 1V6ZA 2VAMA 4LNUB 4BVRA 2H6LA 3NMUC 2EGVA 4YVGA 1K73H 5CO4A 4ZHWA 1W41A 2VGMA 5JCOA 1ODEA 3WJRA 1P9PA 5CA1B 2VAWA 3ERNA 3HKEB 1SA0A 1U3LA 2UYNB 3F0FA 1VQVA 1YJWF 2IAFA 1CK2A 4CNDA 5LP6B 3IKFA 3WXMB 1W5BA 1KNKA 2LBXA 2LBTA 2HS4A 2V9YA 5IYZA 2CHTA 3JAWA 4JALA 5LXTA 1JFFB 4BT7A 1VHAA 3CCEF 5ITZB 4TV8B 5IJ0B 4ZHYB 3JAKA 5CB4A 3JALB 4H3ZA 4YPXA 3B6NA 4TUYA 5JH7B 4KWEA 2B33A 1K8AH 4YQ5A 3HJWC 3S06A 5IT9M 1H48A 4O4LB 3V3TA 1J85A 3JARB 4G4XA 2P6YA 1S72F 3SIUA 3IMPA 3N4JA 4G4WA 2KTUA 2OTLF 1CLIA 5A2QM 1TUBB 1YITF 3IR9A 3QUWA 3VOBA 1X7PA 2KTVA 3K12A 3LYBA 3OBYA 1YIJF 1SDSA 4YJ2B 5FNVA 3J81M 5J2UB 1Q82H 1YI2F 2W8BC 4PZKA 1E7KA 4O2AA 4L69A 5CA0B 1V2XA 3M4SA 5J2TA 3VYTC 1OAPA 1DBFA 2VXYA 5JQGA 1U43A 3WPWA 4JWJA 4IHJA 1W581 1H47A 5EZYB 1Q7YH 2PMPA 2BTUA 3N2GB 2QTPA 2LCAA 1IPAA 2OTMA 3T80A 4BT6A 1TO0A 2Z1FA 2HQSC 1H7MA 2CZWA 4YQGA 3MCAB 5BMVB 3LFOA 5JCOC 2PHNA 4I55A 1O6DA 4RHAA 1FFXB 3QTYA 2QMMA 3FPIA 4ZHQB 1VQ4F 2O3AA 5KMGA 1NS5A 1ZJRA 3F6MA 5EYPB 3S0HA 3CCJF 5IJ9B 1U3PA 2IG8A 1IV4A 1XV2A 1N8RH 2GZLA 3JCMM 5KX5B 4YQ3A 1GX1A 2AMTA 3GHZA 3C9RA 3KTYA 4YQ6A 4BT5A 3D01A 4X3MA 1GZ0A 3CPWF 4KDZA 3KY7A 2RHLA 4BVTA 3LWPC 4J3CA 1UAKA 5GM8A 4I4TB 2HP0B 3RYFA 2L26A 1M90H 5EB0A 3MCQA 5GINC 3G4SF 4O4JA 2Q1XA 3WGKA 1VHKA 3LWVC 4DXDA 2LBWA 2DYYA 4MCDA 3RYHB 5EO3A
chains in the Genus database with same CATH topology
3BBEA 3I55F 5EWRA 4BY9D 3VMFB 1K9MH 4YQ1A 4XBOA 1ZWZA 4JAKA 3CMAF 1X7OA 5HY0A 1VHYA 1VQOF 2HA8A 4YQCA 2F9ZC 4YPZA 3VI6A 5HXUA 1KQSF 3SIVA 4YQLA 4JWGA 4XCQA 3G6EF 1UAJA 1VQLF 1KD1H 4JWHA 1Q81H 2FGYA 1X52A 3CCMF 1VQ8F 3AI9X 1QVFF 5HY1A 2Z0YA 2BO1A 5HXZA 3CC2F 5GAPK 4YQNA 4BVQA 2WALA 4YPYA 1UALA 1Q86H 1VQ9F 3ON1A 3IC6A 1MXIA 4NQ3A 1VQNF 3O7BA 3N4KA 3CD6F 2FC3A 1VQKF 4C4WC 2ALEA 1NJIH 2OZBA 4YQOA 3CMEF 1YHQF 2QWVA 4YQ9A 3CC7F 3OW2F 3CCQF 4KGNA 1VQPF 3G71F 2OTJF 2QI2A 3FFMA 3O85A 2YY8A 1VQ5F 1OY5A 4YQPA 3AGKA 3E5YA 2CX8A 3CCVF 4YQIA 1W42A 3BBDA 1RA4A 3J80M 5DCVA 4YQTA 1GO0A 5HY2A 1UAMA 4YPWA 4NUTA 3LWOC 1VH0A 3HAXD 1VQMF 4RG1A 4H3YA 1YJNF 3E1YA 1YJ9F 4YQ4A 2VGNA 4YVKA 2GLZA 5FAIA 3DCMX 1VQ7F 1W40A 2V3JA 3CCUF 1JJ2F 2JNBA 3OIIA 2KG4A 2OHWA 3IEFA 1KC8H 5GMCA 3NVKE 2QEXF 3CG6A 3OBWA 3N4YA 4FAKA 3CXCF 3GYQA 3BBHA 5D9FA 3E20B 4YVIA 4X3LA 3CCLF 1W3EX 4EI7A 1M1KH 4FMWA 1W2BF 4EI9A 3NVIB 4YQBA 3J7AR 3V7EA 5G4UC 5FJ4C 4YQDA 3N4ZA 3KNUA 3KW2A 3CCRF 4YQQA 5GIPC 1NXZA 5FLXM 4CNGA 3OINA 3CC4F 2HVYD 4LCKA 1CN7A 1VQ6F 1PXWA 5G4VC 3NK6A 3AIAA 2QA4F 3D00A 3ONPA 5GANK 4YQSA 4YQ2A 2I6DA 4MCBA 2AIFA 3LWRC 4MCCA 4YQAA 4JWFA 1DT9A 5HWEA 3CPQA 3JAMM 3PLAC 1NMUB 3AXZA 2EGWA 2V3KA 4YQJA 3PAFA 4YQ7A 5GMBA 4YQRA 4CNFA 4BVSA 5GIOC 1QVGF 4E8BA 4YQKA 4YVJA 3RA5A 4EI8A 3LWQC 1Z85A 4TZZA 3CCSF 3RA6A 3I56F 4YQ8A 3OIJA 1GO1A 1K3RA 4CNEA 3NK7A 3ILKA 4IG6A 4YVHA 1XBIA 3QUVA 3V7QA 4BW0B 1RLGA 4YQ0A 5HY4A 1T0KB 3L8UA 1V6ZA 4BVRA 3NMUC 2EGVA 4YVGA 1K73H 5CO4A 1W41A 2VGMA 1P9PA 1YJWF 1CK2A 4CNDA 3WXMB 2LBXA 4JALA 3CCEF 4H3ZA 4YPXA 1K8AH 4YQ5A 3HJWC 5IT9M 3V3TA 1J85A 1S72F 3SIUA 3N4JA 2KTUA 2OTLF 5A2QM 1YITF 3IR9A 1X7PA 2KTVA 1YIJF 3OBYA 1SDSA 3J81M 1Q82H 1YI2F 4PZKA 1E7KA 4L69A 1V2XA 4JWJA 1Q7YH 1IPAA 1TO0A 1H7MA 2CZWA 4YQGA 3MCAB 3LFOA 1O6DA 2QMMA 1VQ4F 2O3AA 1NS5A 1ZJRA 3CCJF 1N8RH 3JCMM 4YQ3A 3KTYA 4YQ6A 4X3MA 1GZ0A 3CPWF 4KDZA 3KY7A 4BVTA 3LWPC 4J3CA 1UAKA 5GM8A 1M90H 5GINC 3G4SF 1VHKA 3LWVC 2LBWA 4MCDA 5EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVI B;  3O85 A;  3BBE A;  4YQB A;  3I55 F;  1YJW F;  3J7A R;  3V7E A;  2YY8 A;  1CK2 A;  5EWR A;  4CND A;  5G4U C;  4BY9 D;  5FJ4 C;  3WXM B;  4YQD A;  3VMF B;  2LBX A;  1K9M H;  4YQ1 A;  4XBO A;  1VQ5 F;  4JAL A;  1OY5 A;  3N4Z A;  1ZWZ A;  4JAK A;  4YQP A;  3KNU A;  3CCE F;  3AGK A;  3CMA F;  3E5Y A;  2CX8 A;  1X7O A;  3CCV F;  4YQI A;  4H3Z A;  4YPX A;  1VHY A;  3KW2 A;  3CCR F;  4YQQ A;  1W42 A;  5GIP C;  3BBD A;  1NXZ A;  5FLX M;  4CNG A;  1VQO F;  3OIN A;  1K8A H;  1RA4 A;  3QUV A;  3CC4 F;  2HVY D;  2HA8 A;  4YQ5 A;  3HJW C;  4LCK A;  1CN7 A;  4YQC A;  5IT9 M;  3J80 M;  1VQ6 F;  1PXW A;  3VI6 A;  4YPZ A;  5G4V C;  1J85 A;  1S72 F;  3SIU A;  5DCV A;  1KQS F;  3N4J A;  3NK6 A;  3AIA A;  3SIV A;  2KTU A;  4YQT A;  2OTL F;  5A2Q M;  4YQL A;  1GO0 A;  1YIT F;  2QA4 F;  3IR9 A;  1UAM A;  5GAN K;  3ONP A;  4YQS A;  1X7P A;  2KTV A;  4YPW A;  1YIJ F;  3OBY A;  3G6E F;  1SDS A;  4NUT A;  1UAJ A;  3J81 M;  1KD1 H;  1VQL F;  4YQ2 A;  2I6D A;  1Q81 H;  4MCB A;  2AIF A;  3LWO C;  1X52 A;  3LWR C;  3CCM F;  1Q82 H;  1YI2 F;  1VQ8 F;  1VH0 A;  1DT9 A;  3HAX D;  3AI9 X;  4MCC A;  1QVF F;  4PZK A;  1E7K A;  4L69 A;  3CPQ A;  1V2X A;  3JAM M;  1VQM F;  2Z0Y A;  4RG1 A;  2BO1 A;  3PLA C;  4H3Y A;  1YJN F;  3E1Y A;  1YJ9 F;  3CC2 F;  5GAP K;  4YQ4 A;  1Q7Y H;  1NMU B;  1IPA A;  3AXZ A;  4YQN A;  2VGN A;  2EGW A;  2V3K A;  2WAL A;  1TO0 A;  4YQJ A;  4YVK A;  4YPY A;  3PAF A;  1H7M A;  2CZW A;  1UAL A;  3MCA B;  4YQ7 A;  1Q86 H;  5GMB A;  5FAI A;  3LFO A;  4CNF A;  5GIO C;  1QVG F;  1VQ9 F;  3ON1 A;  1O6D A;  3DCM X;  1MXI A;  3IC6 A;  4YQK A;  4E8B A;  4YVJ A;  1VQ7 F;  3RA5 A;  3LWQ C;  2QMM A;  1Z85 A;  1W40 A;  1VQ4 F;  2O3A A;  2V3J A;  3CCU F;  1VQN F;  1JJ2 F;  2JNB A;  4TZZ A;  3CCS F;  1NS5 A;  3RA6 A;  3I56 F;  1ZJR A;  3O7B A;  3OII A;  4YQ8 A;  3OIJ A;  3CCJ F;  2KG4 A;  2OHW A;  3N4K A;  1GO1 A;  1K3R A;  4CNE A;  3IEF A;  3CD6 F;  3NK7 A;  1KC8 H;  2FC3 A;  1N8R H;  1VQK F;  3ILK A;  3JCM M;  4YQ3 A;  5GMC A;  4C4W C;  2ALE A;  1NJI H;  2OZB A;  3NVK E;  3KTY A;  4YQ6 A;  2QEX F;  4YQO A;  4IG6 A;  4X3M A;  3CG6 A;  3CME F;  3OBW A;  3N4Y A;  4YVH A;  1XBI A;  4FAK A;  1GZ0 A;  3CPW F;  4KDZ A;  1YHQ F;  3V7Q A;  3CXC F;  4BW0 B;  3GYQ A;  3LWP C;  1RLG A;  3CC7 F;  1UAK A;  2QWV A;  3KY7 A;  4J3C A;  3BBH A;  5GM8 A;  4YQ0 A;  1T0K B;  3OW2 F;  3L8U A;  1M90 H;  4YQ9 A;  1V6Z A;  5GIN C;  3CCQ F;  3NMU C;  3G4S F;  2EGV A;  4KGN A;  4YVG A;  1K73 H;  1VQP F;  5CO4 A;  5D9F A;  1W41 A;  3G71 F;  3E20 B;  2VGM A;  1VHK A;  4YVI A;  3LWV C;  4X3L A;  4YQR A;  1P9P A;  2LBW A;  4YQG A;  3CCL F;  1W3E X;  1M1K H;  4MCD A;  2OTJ F;  2QI2 A;  4YQA A;  3FFM A;  1W2B F;  5EO3 A; 
#chains in the Genus database with same CATH topology
 2UYJ A;  4U3J A;  3WGN A;  4ZI7 B;  3F0G A;  3BBE A;  3I55 F;  3ELC A;  3F0E A;  5EWR A;  1QU9 A;  5JVD A;  4BY9 D;  3JAS B;  3VMF B;  1K9M H;  4YQ1 A;  4XBO A;  4LNU A;  1ZWZ A;  4JAK A;  2DT4 A;  4YJ3 B;  3CMA F;  4O4H B;  4G4Z A;  4O4I B;  3UT5 B;  1X7O A;  5HY0 A;  5CA1 A;  1VHY A;  3HKE A;  4C81 A;  3WPX A;  4I50 B;  1FNK A;  2UYN A;  3OON A;  3KIZ A;  1VQO F;  4F6R A;  1RLU A;  2HA8 A;  2IQQ A;  4FFB B;  4YQC A;  3CYP B;  2F9Z C;  4YPZ A;  3VI6 A;  3JAT B;  2ZOD A;  4C82 A;  3C8L A;  5HXU A;  1KQS F;  3SIV A;  1W5F A;  4ZK7 A;  3JAL A;  3RYI A;  4YQL A;  4M8I A;  5LYJ A;  4JWG A;  2ZF8 A;  5LOV B;  4C8I A;  4XCQ A;  3S02 A;  3I3F A;  3S0Y A;  3G6E F;  1UAJ A;  1VQL F;  1KD1 H;  4JWH A;  1Q81 H;  3F0D A;  3RE3 A;  5EAZ A;  2FGY A;  4O4L A;  1X52 A;  3CCM F;  1VQ8 F;  3AI9 X;  3JAR A;  5C8Y A;  1QVF F;  3VYU C;  3GTZ A;  2HRU A;  1JN1 A;  2CHS A;  5EIB C;  5HY1 A;  1W57 A;  2Z0Y A;  1W55 A;  1YQN A;  2BO1 A;  3WGM A;  4DRX A;  5HXZ A;  5MN4 A;  3CC2 F;  3M1X A;  5GAP K;  3MQW A;  4WBN B;  1SA0 B;  5GON B;  3IKE A;  4YQN A;  4BVQ A;  2WAL A;  2HX0 A;  3C9S A;  2UYK A;  4YPY A;  1UAL A;  1Q86 H;  1VQ9 F;  2BTQ B;  3ON1 A;  3IC6 A;  1MXI A;  3JAW B;  5LXT B;  4NQ3 A;  3N2K A;  4G4V A;  1VQN F;  3O7B A;  3L7Q A;  1UFY A;  4X20 A;  3VCZ A;  3WGL A;  3RYC B;  2HRY A;  3N4K A;  3N2G A;  2MQE A;  4O2B A;  3C9T A;  4TUY B;  4B46 A;  3CD6 F;  3K2X A;  2FC3 A;  3HKB B;  5MN5 A;  2ZVY A;  1VQK F;  5BMV A;  2Z1U A;  1QAH A;  4C4W C;  2ALE A;  3VTI C;  1NJI H;  2OZB A;  1FSZ A;  3HWU A;  4YQO A;  3CME F;  4ZHQ A;  3S03 A;  1YHQ F;  2QWV A;  4YQ9 A;  3CC7 F;  3V4D A;  1QD9 A;  5EYP A;  2HP3 A;  4ZOL A;  3OW2 F;  3CCQ F;  4ZHV A;  4KGN A;  2GVI A;  1VQP F;  3G71 F;  5KX5 A;  5FNV B;  2ZVZ A;  5LA6 B;  1COM A;  2OTJ F;  2QI2 A;  2CWJ A;  4EB6 B;  3FFM A;  4X1K B;  3HKC B;  3O85 A;  2ZOV A;  2YY8 A;  5J2T B;  4I4T A;  2HP0 A;  5JQG B;  1VQ5 F;  1OY5 A;  3E22 B;  4YQP A;  3WJP A;  3AGK A;  1VH8 A;  1W5E A;  3E5Y A;  2CX8 A;  4HNA B;  3DC2 A;  1NQ3 A;  3CCV F;  4YQI A;  4X1I B;  1PF5 A;  3RYH A;  1W42 A;  1W59 A;  2CVL A;  4ZI7 A;  4I55 B;  3BBD A;  1SZQ A;  1RA4 A;  3IEQ A;  5MN6 A;  3JAS A;  5KMG B;  2Q1Y A;  2Z01 A;  5AVM A;  3J80 M;  2Z1E A;  2YXZ A;  3U0O A;  1VK3 A;  5EB1 B;  4YJ3 A;  5DCV A;  3ZOP A;  4YQT A;  5B8F A;  1TVK B;  3UT5 A;  2EWC A;  3VOA A;  3FD5 A;  3HKD B;  1GO0 A;  3ESJ A;  5HY2 A;  1UAM A;  4I50 A;  1T0A A;  4YPW A;  4NUT A;  3LDT A;  2N48 A;  4FFB A;  3S0W A;  3LWO C;  3WJQ A;  1VH0 A;  3JAT A;  3MDO A;  3HAX D;  3VYS C;  4BT2 A;  1UI9 A;  5LP6 A;  1OFU A;  1VQM F;  4RG1 A;  1IV3 A;  1FNJ A;  4BT4 A;  4H3Y A;  2AIZ P;  4PWT A;  3E1Y A;  3TD4 A;  1YJ9 F;  1JFF A;  5LOV A;  1YJN F;  4YQ4 A;  2YYE A;  5ITZ A;  1RQ7 A;  4TV9 B;  4TV8 A;  5IJ0 A;  3ZP4 A;  2VGN A;  1JD1 A;  3M84 A;  4YVK A;  2GLZ A;  1IV1 A;  5FAI A;  1XHO A;  5JH7 A;  5JVD B;  3DCM X;  3IEW A;  3D54 A;  3KE1 A;  4X1Y B;  1VQ7 F;  4IIJ B;  1W40 A;  2V3J A;  3CCU F;  1JJ2 F;  2JNB A;  3OII A;  1ONI A;  3DDN A;  4WBN A;  2KG4 A;  3EOR A;  2OHW A;  3R0P A;  4B62 A;  5GON A;  3IEF A;  1KC8 H;  2BTO A;  2RHO A;  4F6R B;  1TUB A;  3FBA A;  5GMC A;  3NVK E;  4B5C A;  2H8C A;  4G4Y A;  2QEX F;  3CG6 A;  4YJ2 A;  3KJK A;  3OBW A;  3N4Y A;  4FAK A;  5HP7 A;  3K14 A;  1R1M A;  3CXC F;  5J2U A;  3GYQ A;  3RYC A;  3RYI B;  3BBH A;  3P4E A;  5LYJ B;  5IYZ B;  5CA0 A;  4G88 A;  5D9F A;  3HKB A;  4C8E A;  1Z5V A;  3E20 B;  4YVI A;  3JAK B;  4X3L A;  5CB4 B;  3LME A;  3CCL F;  1W3E X;  5EZY A;  4EI7 A;  1M1K H;  1W5A A;  1YGY A;  4NWO B;  4FMW A;  4RQO A;  1W2B F;  5C8Y B;  4EI9 A;  3NVI B;  4YQB A;  3J7A R;  3V7E A;  2R6R 1;  3KJJ A;  2I6R A;  2VAP A;  5G4U C;  5FJ4 C;  4YQD A;  4DRX B;  3VIU A;  1FFX A;  3N4Z A;  1X25 A;  3VO8 A;  3KNU A;  4R40 B;  2CSL A;  2RHH A;  5LA6 A;  5LP6 C;  5IJ9 A;  3JVH A;  3CCR F;  2KGW A;  4EB6 A;  3KW2 A;  4X1K A;  4YQQ A;  3HKC A;  5GIP C;  1NXZ A;  2ZAU A;  5FLX M;  4CNG A;  3OIN A;  2UYP A;  3CC4 F;  2HVY D;  4LCK A;  3N2K B;  1RQ2 A;  1CN7 A;  2NMU A;  1VQ6 F;  1PXW A;  3E22 A;  4X20 B;  5G4V C;  2RB9 A;  1JY8 A;  1U40 A;  3HTN A;  3NK6 A;  3AIA A;  4O2A B;  4O2B B;  3CB2 A;  4HNA A;  1KNJ A;  2UZH A;  4X1I A;  3TD5 A;  2QA4 F;  3D00 A;  3ONP A;  5GAN K;  4YQS A;  4IHJ B;  3BYQ A;  4YQ2 A;  2I6D A;  4MCB A;  2AIF A;  3LWR C;  2H8E A;  3CYQ A;  4MCC A;  3WGJ A;  4JWF A;  1DT9 A;  4YQA A;  4ZOL B;  5HWE A;  3CPQ A;  3QHD A;  3P0Z A;  1TVK A;  3Q8H A;  3JAM M;  3ZP7 A;  3HKD A;  3C9U A;  3PLA C;  2K1S A;  4B45 A;  2CW4 A;  4U39 A;  4O4H A;  1NMU B;  5EIB D;  3AXZ A;  4O4I A;  2Z1T A;  2EGW A;  1XRG A;  2V3K A;  1Z5W A;  4YQJ A;  3PAF A;  4YQ7 A;  5GMB A;  4YQR A;  2HS0 A;  4CNF A;  3K0T A;  3KHN A;  4BVS A;  5GIO C;  1QVG F;  2G9I A;  4E8B A;  2RHJ A;  4YQK A;  4YVJ A;  3RA5 A;  4EI8 A;  3LWQ C;  1Z85 A;  2R75 1;  3P10 A;  4TZZ A;  3CCS F;  3RA6 A;  3I56 F;  4YQ8 A;  3OIJ A;  3MBM A;  3RYF B;  4TV9 A;  3ZO8 A;  1GO1 A;  1K3R A;  4CNE A;  3NK7 A;  1Q8R A;  3ILK A;  4O4J B;  4C8G A;  4E6E A;  1J7H A;  3I7T A;  4X1Y A;  3TD3 A;  4IG6 A;  4IIJ A;  1IV2 A;  2HS3 A;  4BT3 A;  4ERH A;  4U3J B;  1XBI A;  4YVH A;  3FD6 A;  3V7Q A;  3QUV A;  4BW0 B;  1RLG A;  4YQ0 A;  5HY4 A;  5HP8 A;  1T0K B;  3L8U A;  1V6Z A;  2VAM A;  4LNU B;  4BVR A;  2H6L A;  3NMU C;  2EGV A;  4YVG A;  1K73 H;  5CO4 A;  4ZHW A;  1W41 A;  2VGM A;  5JCO A;  1ODE A;  3WJR A;  1P9P A;  5CA1 B;  2VAW A;  3ERN A;  3HKE B;  1SA0 A;  1U3L A;  2UYN B;  3F0F A;  1VQV A;  1YJW F;  2IAF A;  1CK2 A;  4CND A;  5LP6 B;  3IKF A;  3WXM B;  1W5B A;  1KNK A;  2LBX A;  2LBT A;  2HS4 A;  2V9Y A;  5IYZ A;  2CHT A;  3JAW A;  4JAL A;  5LXT A;  1JFF B;  4BT7 A;  1VHA A;  3CCE F;  5ITZ B;  4TV8 B;  5IJ0 B;  4ZHY B;  3JAK A;  5CB4 A;  3JAL B;  4H3Z A;  4YPX A;  3B6N A;  4TUY A;  5JH7 B;  4KWE A;  2B33 A;  1K8A H;  4YQ5 A;  3HJW C;  3S06 A;  5IT9 M;  1H48 A;  4O4L B;  3V3T A;  1J85 A;  3JAR B;  4G4X A;  2P6Y A;  1S72 F;  3SIU A;  3IMP A;  3N4J A;  4G4W A;  2KTU A;  2OTL F;  1CLI A;  5A2Q M;  1TUB B;  1YIT F;  3IR9 A;  3QUW A;  3VOB A;  1X7P A;  2KTV A;  3K12 A;  3LYB A;  3OBY A;  1YIJ F;  1SDS A;  4YJ2 B;  5FNV A;  3J81 M;  5J2U B;  1Q82 H;  1YI2 F;  2W8B C;  4PZK A;  1E7K A;  4O2A A;  4L69 A;  5CA0 B;  1V2X A;  3M4S A;  5J2T A;  3VYT C;  1OAP A;  1DBF A;  2VXY A;  5JQG A;  1U43 A;  3WPW A;  4JWJ A;  4IHJ A;  1W58 1;  1H47 A;  5EZY B;  1Q7Y H;  2PMP A;  2BTU A;  3N2G B;  2QTP A;  2LCA A;  1IPA A;  2OTM A;  3T80 A;  4BT6 A;  1TO0 A;  2Z1F A;  2HQS C;  1H7M A;  2CZW A;  4YQG A;  3MCA B;  5BMV B;  3LFO A;  5JCO C;  2PHN A;  4I55 A;  1O6D A;  4RHA A;  1FFX B;  3QTY A;  2QMM A;  3FPI A;  4ZHQ B;  1VQ4 F;  2O3A A;  5KMG A;  1NS5 A;  1ZJR A;  3F6M A;  5EYP B;  3S0H A;  3CCJ F;  5IJ9 B;  1U3P A;  2IG8 A;  1IV4 A;  1XV2 A;  1N8R H;  2GZL A;  3JCM M;  5KX5 B;  4YQ3 A;  1GX1 A;  2AMT A;  3GHZ A;  3C9R A;  3KTY A;  4YQ6 A;  4BT5 A;  3D01 A;  4X3M A;  1GZ0 A;  3CPW F;  4KDZ A;  3KY7 A;  2RHL A;  4BVT A;  3LWP C;  4J3C A;  1UAK A;  5GM8 A;  4I4T B;  2HP0 B;  3RYF A;  2L26 A;  1M90 H;  5EB0 A;  3MCQ A;  5GIN C;  3G4S F;  4O4J A;  2Q1X A;  3WGK A;  1VHK A;  3LWV C;  4DXD A;  2LBW A;  2DYY A;  4MCD A;  3RYH B;  5EO3 A; 
#chains in the Genus database with same CATH homology
 3BBE A;  3I55 F;  5EWR A;  4BY9 D;  3VMF B;  1K9M H;  4YQ1 A;  4XBO A;  1ZWZ A;  4JAK A;  3CMA F;  1X7O A;  5HY0 A;  1VHY A;  1VQO F;  2HA8 A;  4YQC A;  2F9Z C;  4YPZ A;  3VI6 A;  5HXU A;  1KQS F;  3SIV A;  4YQL A;  4JWG A;  4XCQ A;  3G6E F;  1UAJ A;  1VQL F;  1KD1 H;  4JWH A;  1Q81 H;  2FGY A;  1X52 A;  3CCM F;  1VQ8 F;  3AI9 X;  1QVF F;  5HY1 A;  2Z0Y A;  2BO1 A;  5HXZ A;  3CC2 F;  5GAP K;  4YQN A;  4BVQ A;  2WAL A;  4YPY A;  1UAL A;  1Q86 H;  1VQ9 F;  3ON1 A;  3IC6 A;  1MXI A;  4NQ3 A;  1VQN F;  3O7B A;  3N4K A;  3CD6 F;  2FC3 A;  1VQK F;  4C4W C;  2ALE A;  1NJI H;  2OZB A;  4YQO A;  3CME F;  1YHQ F;  2QWV A;  4YQ9 A;  3CC7 F;  3OW2 F;  3CCQ F;  4KGN A;  1VQP F;  3G71 F;  2OTJ F;  2QI2 A;  3FFM A;  3O85 A;  2YY8 A;  1VQ5 F;  1OY5 A;  4YQP A;  3AGK A;  3E5Y A;  2CX8 A;  3CCV F;  4YQI A;  1W42 A;  3BBD A;  1RA4 A;  3J80 M;  5DCV A;  4YQT A;  1GO0 A;  5HY2 A;  1UAM A;  4YPW A;  4NUT A;  3LWO C;  1VH0 A;  3HAX D;  1VQM F;  4RG1 A;  4H3Y A;  1YJN F;  3E1Y A;  1YJ9 F;  4YQ4 A;  2VGN A;  4YVK A;  2GLZ A;  5FAI A;  3DCM X;  1VQ7 F;  1W40 A;  2V3J A;  3CCU F;  1JJ2 F;  2JNB A;  3OII A;  2KG4 A;  2OHW A;  3IEF A;  1KC8 H;  5GMC A;  3NVK E;  2QEX F;  3CG6 A;  3OBW A;  3N4Y A;  4FAK A;  3CXC F;  3GYQ A;  3BBH A;  5D9F A;  3E20 B;  4YVI A;  4X3L A;  3CCL F;  1W3E X;  4EI7 A;  1M1K H;  4FMW A;  1W2B F;  4EI9 A;  3NVI B;  4YQB A;  3J7A R;  3V7E A;  5G4U C;  5FJ4 C;  4YQD A;  3N4Z A;  3KNU A;  3KW2 A;  3CCR F;  4YQQ A;  5GIP C;  1NXZ A;  5FLX M;  4CNG A;  3OIN A;  3CC4 F;  2HVY D;  4LCK A;  1CN7 A;  1VQ6 F;  1PXW A;  5G4V C;  3NK6 A;  3AIA A;  2QA4 F;  3D00 A;  3ONP A;  5GAN K;  4YQS A;  4YQ2 A;  2I6D A;  4MCB A;  2AIF A;  3LWR C;  4MCC A;  4YQA A;  4JWF A;  1DT9 A;  5HWE A;  3CPQ A;  3JAM M;  3PLA C;  1NMU B;  3AXZ A;  2EGW A;  2V3K A;  4YQJ A;  3PAF A;  4YQ7 A;  5GMB A;  4YQR A;  4CNF A;  4BVS A;  5GIO C;  1QVG F;  4E8B A;  4YQK A;  4YVJ A;  3RA5 A;  4EI8 A;  3LWQ C;  1Z85 A;  4TZZ A;  3CCS F;  3RA6 A;  3I56 F;  4YQ8 A;  3OIJ A;  1GO1 A;  1K3R A;  4CNE A;  3NK7 A;  3ILK A;  4IG6 A;  4YVH A;  1XBI A;  3QUV A;  3V7Q A;  4BW0 B;  1RLG A;  4YQ0 A;  5HY4 A;  1T0K B;  3L8U A;  1V6Z A;  4BVR A;  3NMU C;  2EGV A;  4YVG A;  1K73 H;  5CO4 A;  1W41 A;  2VGM A;  1P9P A;  1YJW F;  1CK2 A;  4CND A;  3WXM B;  2LBX A;  4JAL A;  3CCE F;  4H3Z A;  4YPX A;  1K8A H;  4YQ5 A;  3HJW C;  5IT9 M;  3V3T A;  1J85 A;  1S72 F;  3SIU A;  3N4J A;  2KTU A;  2OTL F;  5A2Q M;  1YIT F;  3IR9 A;  1X7P A;  2KTV A;  1YIJ F;  3OBY A;  1SDS A;  3J81 M;  1Q82 H;  1YI2 F;  4PZK A;  1E7K A;  4L69 A;  1V2X A;  4JWJ A;  1Q7Y H;  1IPA A;  1TO0 A;  1H7M A;  2CZW A;  4YQG A;  3MCA B;  3LFO A;  1O6D A;  2QMM A;  1VQ4 F;  2O3A A;  1NS5 A;  1ZJR A;  3CCJ F;  1N8R H;  3JCM M;  4YQ3 A;  3KTY A;  4YQ6 A;  4X3M A;  1GZ0 A;  3CPW F;  4KDZ A;  3KY7 A;  4BVT A;  3LWP C;  4J3C A;  1UAK A;  5GM8 A;  1M90 H;  5GIN C;  3G4S F;  1VHK A;  3LWV C;  2LBW A;  4MCD A;  5EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...