2I6DA

The structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
251
Chain Sequence
AMLSANQIKFLRSLRERKYRLREQAFAVEGPKLVGEMLPFYRCRMLVGTAAMLRAVSTPHDAEVVELPESFDFKRISTQTTPQPLMAVFDLPAEPEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASMGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVESLNVAIATAILCSEWRRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
molecule keywords RNA methyltransferase, TrmH family
total genus 73
structure length 251
sequence length 255
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2i6dA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2i6dA02
3RA5A 2ALEA 3O85A 4BY9D 3VMFB 2QI2A 1T0KB 3V7EA 3N4YA 4H3ZA 4CNEA 4LCKA 1VH0A 1K3RA 3QUVA 2QA4F 4YPXA 1YI2F 4X3LA 1Q7YH 1N8RH 4FAKA 4YQ8A 4BW0B 1GO0A 2EGVA 3G6EF 1X52A 5FAIA 4YQ3A 2HA8A 1M90H 1VHKA 3OINA 1NS5A 3OBYA 4PZKA 3CG6A 4YVJA 5G4UC 1K8AH 5A2QM 3LWVC 3BBDA 3NK6A 4YPYA 1VQ8F 4CNFA 3CCSF 3HJWC 3WXMB 1W40A 1YITF 4YQBA 5D9FA 1NJIH 2KG4A 2OTLF 1UAJA 4MCDA 2QWVA 1QVFF 4YQAA 4YQGA 3JAMM 5GIOC 4YVHA 2KTVA 1ZJRA 3CCMF 1OY5A 1JJ2F 4YQRA 3VI6A 2V3JA 3GYQA 4C4WC 3IR9A 5IT9M 3J81M 1YJNF 2EGWA 4JAKA 3N4ZA 1CN7A 3AGKA 1UALA 4YQOA 1NMUB 2KTUA 1O6DA 2CX8A 1CK2A 4YQIA 4NUTA 1K73H 1K9MH 5FJ4C 4YQ2A 3ILKA 1PXWA 3JCMM 3I55F 3CD6F 2QEXF 3CCQF 4YQSA 4KGNA 1X7OA 2LBXA 3LWQC 1MXIA 1NXZA 3BBEA 1M1KH 1P9PA 4YQ9A 3CCJF 3N4KA 3CC2F 4YVKA 4YQKA 1S72F 4XBOA 4X3MA 4YQ5A 5G4VC 1YIJF 1RA4A 2CZWA 2V3KA 1Q82H 3E5YA 3MCAB 1W3EX 3CPQA 1YJWF 1KQSF 1VQ7F 5FLXM 1VQ4F 3AIAA 1W42A 4YQQA 1Q86H 3BBHA 1RLGA 3KNUA 3OBWA 1VQMF 1IPAA 1VQ6F 3LFOA 3IEFA 3ONPA 2LBWA 2QMMA 1YJ9F 4J3CA 3DCMX 1E7KA 3OIIA 4YQLA 3NK7A 3V7QA 1XBIA 2OTJF 1DT9A 4IG6A 4YQJA 4YQPA 3CMEF 3J80M 4H3YA 4YVGA 4MCCA 5DCVA 4YQCA 5GMCA 5GAPK 3PAFA 1VQLF 1QVGF 4YQ0A 1VQKF 3G4SF 3KY7A 4JALA 3CC4F 5CO4A 1GZ0A 3LWOC 3J7AR 3FFMA 3ON1A 2OHWA 3RA6A 5GIPC 1VQPF 1SDSA 1X7PA 5GANK 1GO1A 1J85A 3CCRF 2FC3A 4YQTA 1KC8H 3AI9X 3CXCF 1V6ZA 3LWRC 3CPWF 3L8UA 3CCEF 4YQ7A 3E20B 3SIVA 4YPZA 1H7MA 5EO3A 2HVYD 1VHYA 1Z85A 5EWRA 3HAXD 2I6DA 2BO1A 4YVIA 3OIJA 1YHQF 3LWPC 3NVIB 3IC6A 4E8BA 3NMUC 3KW2A 1Q81H 1UAMA 1VQNF 4YQ1A 3CMAF 2OZBA 2YY8A 3CC7F 4YQDA 4RG1A 5GM8A 4YPWA 4YQ6A 2VGNA 1ZWZA 4MCBA 5GMBA 1TO0A 1VQOF 1VQ5F 3O7BA 3G71F 2VGMA 1KD1H 3PLAC 1V2XA 3E1YA 1VQ9F 3SIUA 4TZZA 4CNGA 1W41A 3CCLF 3KTYA 4KDZA 3OW2F 4YQ4A 2JNBA 2Z0YA 4L69A 3CCUF 2WALA 2O3AA 3AXZA 3I56F 4CNDA 1UAKA 3N4JA 2AIFA 1W2BF 3CCVF 3NVKE 4YQNA 5GINC
chains in the Genus database with same CATH superfamily
2ALEA 1PF5A 3VMFB 1FFXA 1U3PA 3MDOA 4LCKA 3JASA 2IQQA 3QUVA 3HKDA 2GVIA 4ZHQA 1UI9A 4YPXA 3F0DA 1YI2F 1JD1A 2EWCA 4BW0B 5FAIA 1M90H 2HP0A 1VHKA 5CB4A 1ODEA 3HKEA 3CG6A 4G4XA 3T80A 3JARA 1VQ8F 1ONIA 4ZOLA 4JWHA 5CA0B 3KHNA 4O2AB 5HY1A 4ZHVA 4HNAB 1IV4A 3WPXA 2ZF8A 4YQGA 3S0WA 5LA6A 4I55A 1IV1A 2OTMA 3QTYA 1ZJRA 4YVHA 4U3JA 2UZHA 4NQ3A 3VI6A 3GYQA 5IT9M 4LNUA 3N4ZA 1CN7A 3AGKA 4DRXA 4YQOA 2UYNA 1FFXB 1R1MA 3ZO8A 5JVDA 5FJ4C 3C9UA 4C8EA 1PXWA 5HP7A 4YQAA 3CCQF 1NXZA 3ESJA 2HS4A 4YQ9A 3CC2F 5CB4B 1XV2A 2VAPA 4R40B 5IYZB 3C8LA 1S72F 1QD9A 1VQVA 3BYQA 2CZWA 3E5YA 3MCAB 4O2AA 3CPQA 1YJWF 3P0ZA 2QTPA 5EZYA 5FLXM 1KQSF 3FPIA 3LDTA 1Q86H 3BBHA 5LA6B 4I55B 1RLGA 5HY2A 3OBWA 1SA0A 3P10A 4TV9A 1YJ9F 5CA1A 3DCMX 4C82A 5KMGA 3HKDB 4BVQA 1YQNA 3V4DA 2R751 4ZI7A 4YQPA 4MCCA 5DCVA 2HP0B 5GMCA 4PWTA 4ZHYB 5KX5A 3RYIA 4M8IA 2BTUA 3V3TA 2ZODA 2PMPA 3N2KA 3JATB 4YQTA 3AI9X 2RHHA 3L8UA 3UT5B 5LOVA 3CCEF 3SIVA 3HAXD 4DRXB 5HY0A 2Z1TA 2KGWA 1FNJA 3E22B 4YQ1A 3S0YA 2YY8A 5GM8A 2R6R1 2VGNA 1UFYA 2HRYA 4U39A 1RLUA 4ZHWA 3O7BA 2AIZP 3S0HA 4CNGA 2NMUA 1V2XA 4KDZA 1RQ7A 3AXZA 4ERHA 3NVKE 5GINC 1TVKB 3O85A 3CYPB 2HS0A 3N4YA 2ZAUA 4H3ZA 2Q1YA 3VIUA 1K3RA 2QA4F 4X3LA 1Q7YH 4FAKA 4O4HA 4YQ8A 2CVLA 2HA8A 3I3FA 5LXTB 3CB2A 3RYHB 2CHSA 2YXZA 3OBYA 3B6NA 5EAZA 3RE3A 3RYIB 5G4UC 2YYEA 4G4YA 2Q1XA 4X1YA 2GLZA 3WXMB 1YITF 3KE1A 1NJIH 5EZYB 3WJQA 2H8CA 1VHAA 4RQOA 3K2XA 3C9SA 1X25A 2KTVA 1QAHA 3CCMF 1JJ2F 2V3JA 4C4WC 4JAKA 5JH7A 5EYPA 3J81M 5EB1B 1NQ3A 1O6DA 1FSZA 3F0FA 2CX8A 4ZI7B 3D01A 3D54A 1T0AA 3ILKA 3TD3A 3JCMM 4I50B 3CD6F 1X7OA 3LWQC 3F0GA 3WJPA 1MXIA 1W55A 4JWGA 3BBEA 3VYTC 1M1KH 1P9PA 5LXTA 3KJKA 4XBOA 4BT4A 1YIJF 1XHOA 1Q82H 2F9ZC 1SZQA 1JY8A 1VQ7F 5B8FA 3HKCB 1W42A 2Z1EA 4G4WA 4TUYA 5GONA 1W5FA 1TVKA 3IEFA 2LBWA 3P4EA 2QMMA 3WPWA 2IAFA 5EIBD 3JASB 5HXZA 1E7KA 3V7QA 4YQLA 1XBIA 2UYJA 2OTJF 4IG6A 1TUBA 3JAWA 4BT6A 4G4VA 3JALB 2DYYA 3M1XA 4YVGA 2HX0A 2P6YA 4I50A 4E6EA 3I7TA 4YQCA 3GHZA 1VQKF 4EB6A 4O4JB 1GZ0A 3ON1A 4ZOLB 4G4ZA 1JFFA 2VXYA 4IIJA 5CA0A 1X7PA 3VYUC 5GANK 4BVTA 3LWRC 3RYCB 4TUYB 1H7MA 5GONB 1VHYA 2ZVZA 5EWRA 4X20A 4YVIA 3OIJA 2BTOA 3LWPC 2ZOVA 3NVIB 3IKEA 3FD5A 3IC6A 5EB0A 5C8YB 4O4HB 1TUBB 3JAWB 3CMAF 1H47A 3LYBA 3IEWA 4O2BA 3MQWA 4RG1A 4YQ6A 1U43A 4MCBA 5HY4A 1TO0A 1H48A 1VQOF 3IMPA 5EIBC 1IV2A 1VQ5F 1KD1H 3ZP7A 1FNKA 3E1YA 3N2GA 5LP6B 3CCLF 2Z0YA 2I6RA 4L69A 3CCUF 3HKCA 3L7QA 2WALA 4WBNB 2K1SA 4B5CA 1UAKA 3N4JA 2AIFA 3K14A 1SA0B 4TV9B 4BT7A 5EYPB 5IJ0B 4CNEA 4BY9D 3V7EA 2QI2A 1CLIA 3JALA 1GO0A 4G88A 4YQ3A 1W5AA 3HTNA 5JQGB 1W5BA 5IJ9A 3OINA 5FNVB 4PZKA 4YVJA 3Q8HA 5A2QM 3BBDA 3MBMA 4CNFA 3RYFA 3HJWC 4YQBA 5MN4A 5D9FA 4IHJA 1UAJA 2H8EA 3TD4A 2QWVA 4MCDA 3FBAA 1COMA 2V9YA 3IEQA 2B33A 4BVRA 1GX1A 1W581 2DT4A 2Z01A 5HXUA 2EGWA 3IR9A 1YJNF 4BVSA 5IJ0A 1NMUB 2KTUA 4NUTA 4TV8B 4C8GA 4F6RB 1K73H 1K9MH 3E22A 2QEXF 1VK3A 2BTQB 4KGNA 4B45A 3WGKA 5IJ9B 3CCJF 4YVKA 1YGYA 5G4VC 4XCQA 1JFFB 3N2GB 5LP6A 1RA4A 4BT5A 3M84A 3ZOPA 1VQ4F 2UYPA 3KNUA 1VQMF 4X20B 1IPAA 5J2UB 3ONPA 1Z5VA 4J3CA 3OIIA 2CW4A 1DT9A 4YJ3A 3DDNA 2AMTA 4DXDA 4YQJA 4EI9A 4H3YA 1IV3A 3VOAA 4JWFA 3DC2A 5GAPK 3PAFA 3K12A 3WGMA 1QVGF 1U3LA 3G4SF 3KY7A 3F6MA 4X1YB 3HKEB 3CC4F 3ZP4A 5CO4A 3JARB 3J7AR 3FFMA 4JWJA 2OHWA 3RA6A 5GIPC 3C9TA 1J85A 4BT3A 3CCRF 4HNAA 4WBNA 1V6ZA 4YQ7A 1Z5WA 2CSLA 3E20B 2HVYD 3VTIC 4ZK7A 5JH7B 5LYJB 5J2UA 1YHQF 2RHJA 4TV8A 4F6RA 3NMUC 2UYKA 1Q81H 4YJ3B 2OZBA 3CC7F 4YPWA 3QHDA 1W5EA 1ZWZA 5GMBA 1OAPA 5ITZB 1KNKA 2HS3A 5MN5A 4BT2A 3K0TA 1OFUA 1VQ9F 3SIUA 1W41A 3KJJA 3OW2F 2JNBA 2O3AA 5AVMA 3CCVF 4YQNA 3ERNA 3RA5A 3MCQA 1T0KB 1VH0A 4C81A 5KMGB 3S06A 3VOBA 4FMWA 1N8RH 1W57A 1JN1A 2EGVA 4RHAA 1X52A 3G6EF 2L26A 4I4TA 4EB6B 1NS5A 2CHTA 4O4JA 1K8AH 3LWVC 4YPYA 3NK6A 3LMEA 2GZLA 4IIJB 3CCSF 1W40A 3OONA 3VYSC 2KG4A 2OTLF 3N2KB 3GTZA 1QVFF 3JAMM 5J2TA 5GIOC 3RYCA 3HWUA 1Q8RA 3HKBB 4X1IB 5LYJA 1OY5A 1KNJA 2LCAA 2RHOA 4YQRA 2CWJA 2HQSC 5JCOC 1UALA 5BMVB 2HRUA 1U40A 1CK2A 2RB9A 4YQIA 5C8YA 4YQ2A 4O2BB 3I55F 3VO8A 4O4IA 4YJ2A 4YQSA 2LBXA 3R0PA 5LP6C 4B46A 3N4KA 4YQKA 2FGYA 4X3MA 4YQ5A 3WGJA 2Z1FA 3QUWA 2V3KA 2W8BC 4X1KA 1XRGA 4B62A 1W3EX 5HWEA 3F0EA 3AIAA 2HP3A 4YQQA 4X1IA 3HKBA 3IKFA 1VH8A 3VCZA 1VQ6F 3LFOA 4U3JB 3M4SA 3WJRA 3NK7A 5BMVA 5JVDB 3CMEF 3J80M 5JQGA 2VAMA 4I4TB 4KWEA 5FNVA 3TD5A 1QU9A 5ITZA 4EI8A 1VQLF 4YQ0A 2H6LA 3RYHA 4JALA 5HP8A 3D00A 3RYFB 3LWOC 1RQ2A 3FD6A 2PHNA 4IHJB 3JVHA 1VQPF 1SDSA 2ZVYA 4FFBA 1GO1A 4X1KB 3JAKB 2FC3A 2G9IA 1KC8H 2IG8A 3ELCA 3CXCF 3CPWF 3EORA 4O4LA 4YPZA 3WGLA 5EO3A 3S03A 1J7HA 1Z85A 4EI7A 3S02A 2I6DA 2BO1A 2MQEA 5CA1B 4E8BA 4NWOB 4ZHQB 2UYNB 3KW2A 1UAMA 2RHLA 4O4IB 4YJ2B 1VQNF 5JCOA 4YQDA 2LBTA 3C9RA 5KX5B 3WGNA 1W59A 5IYZA 3G71F 2VGMA 3PLAC 4YQ4A 4TZZA 2Z1UA 3KTYA 2N48A 3KIZA 5J2TB 4FFBB 3CYQA 3JAKA 3JATA 1DBFA 3I56F 5MN6A 4CNDA 2VAWA 3UT5A 5LOVB 1W2BF 4O4LB 3U0OA 4C8IA 4LNUB
chains in the Genus database with same CATH topology
3RA5A 2ALEA 3O85A 4BY9D 3VMFB 2QI2A 1T0KB 3V7EA 3N4YA 4H3ZA 4CNEA 4LCKA 1VH0A 1K3RA 3QUVA 2QA4F 4YPXA 4FMWA 1YI2F 4X3LA 1Q7YH 1N8RH 4FAKA 4YQ8A 4BW0B 1GO0A 2EGVA 3G6EF 1X52A 5FAIA 4YQ3A 2HA8A 1M90H 1VHKA 3OINA 1NS5A 3OBYA 4PZKA 3CG6A 4YVJA 5G4UC 1K8AH 5A2QM 3LWVC 3BBDA 3NK6A 4YPYA 1VQ8F 2GLZA 4CNFA 3CCSF 3HJWC 3WXMB 1W40A 1YITF 4YQBA 4JWHA 5D9FA 1NJIH 2KG4A 5HY1A 2OTLF 1UAJA 4MCDA 2QWVA 1QVFF 4YQAA 4YQGA 3JAMM 5GIOC 4YVHA 2KTVA 4BVRA 1ZJRA 3CCMF 4NQ3A 1JJ2F 1OY5A 3VI6A 5HXUA 3GYQA 4C4WC 3IR9A 5IT9M 3J81M 1YJNF 2EGWA 2V3JA 3N4ZA 1CN7A 3AGKA 4BVSA 1UALA 1NMUB 2KTUA 1O6DA 2CX8A 1CK2A 4YQOA 4NUTA 1K73H 1K9MH 4YQIA 5FJ4C 4YQ2A 3ILKA 1PXWA 3JCMM 3I55F 3CD6F 2QEXF 3CCQF 4YQSA 4KGNA 1X7OA 2LBXA 3LWQC 1MXIA 1NXZA 4JWGA 3BBEA 1M1KH 1P9PA 4YQ9A 3CCJF 3N4KA 3CC2F 4YVKA 4YQKA 2FGYA 1S72F 4XBOA 4X3MA 4YQ5A 5G4VC 4XCQA 1YIJF 1RA4A 2CZWA 2V3KA 1Q82H 2F9ZC 3E5YA 3MCAB 5HWEA 1W3EX 3CPQA 1YJWF 1KQSF 1VQ7F 5FLXM 1VQ4F 3AIAA 1W42A 4YQQA 1Q86H 3BBHA 1RLGA 5HY2A 3KNUA 3OBWA 1VQMF 1IPAA 1VQ6F 3LFOA 3IEFA 3ONPA 2LBWA 2QMMA 1YJ9F 4J3CA 3DCMX 1E7KA 5HXZA 3OIIA 3NK7A 3V7QA 4YQLA 1XBIA 4BVQA 1DT9A 2OTJF 4IG6A 4YQRA 4YQJA 4YQPA 4EI9A 3CMEF 3J80M 4H3YA 4YVGA 4MCCA 5DCVA 4JWFA 4YQCA 5GMCA 5GAPK 3PAFA 1VQLF 4EI8A 1QVGF 1VQKF 3G4SF 3KY7A 4YQ0A 4JALA 3CC4F 5CO4A 3D00A 1GZ0A 3LWOC 3J7AR 3FFMA 3ON1A 4JWJA 2OHWA 3RA6A 3V3TA 5GIPC 1VQPF 1SDSA 1X7PA 5GANK 1GO1A 4BVTA 3CCRF 1J85A 2FC3A 4YQTA 1KC8H 3AI9X 3CXCF 1V6ZA 3LWRC 3CPWF 3L8UA 3CCEF 4YQ7A 3E20B 3SIVA 4YPZA 1H7MA 5EO3A 2HVYD 1VHYA 1Z85A 4EI7A 5EWRA 2I6DA 2BO1A 3HAXD 4YVIA 3OIJA 5HY0A 1YHQF 3LWPC 3NVIB 3IC6A 4E8BA 3NMUC 3KW2A 1Q81H 1UAMA 1VQNF 4YQ1A 3CMAF 2OZBA 2YY8A 3CC7F 4YQDA 4RG1A 5GM8A 4YPWA 4YQ6A 2VGNA 1ZWZA 4MCBA 5GMBA 5HY4A 1TO0A 1VQOF 1VQ5F 3O7BA 3G71F 2VGMA 1KD1H 3PLAC 1V2XA 3E1YA 1VQ9F 3SIUA 4TZZA 4CNGA 1W41A 3CCLF 3KTYA 4KDZA 3OW2F 4YQ4A 2JNBA 2Z0YA 4L69A 3CCUF 2WALA 2O3AA 3AXZA 3I56F 4CNDA 1UAKA 3N4JA 2AIFA 1W2BF 3CCVF 3NVKE 4YQNA 4JAKA 5GINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RA5 A;  2ALE A;  3O85 A;  4BY9 D;  3VMF B;  2QI2 A;  1T0K B;  3V7E A;  3N4Y A;  4H3Z A;  4CNE A;  4LCK A;  1VH0 A;  1K3R A;  3QUV A;  2QA4 F;  4YPX A;  1YI2 F;  4X3L A;  1Q7Y H;  1N8R H;  4FAK A;  4YQ8 A;  4BW0 B;  1GO0 A;  2EGV A;  3G6E F;  1X52 A;  5FAI A;  4YQ3 A;  2HA8 A;  1M90 H;  1VHK A;  3OIN A;  1NS5 A;  3OBY A;  4PZK A;  3CG6 A;  4YVJ A;  5G4U C;  1K8A H;  5A2Q M;  3LWV C;  3BBD A;  3NK6 A;  4YPY A;  1VQ8 F;  4CNF A;  3CCS F;  3HJW C;  3WXM B;  1W40 A;  1YIT F;  4YQB A;  5D9F A;  1NJI H;  2KG4 A;  2OTL F;  1UAJ A;  4MCD A;  2QWV A;  1QVF F;  4YQA A;  4YQG A;  3JAM M;  5GIO C;  4YVH A;  2KTV A;  1ZJR A;  3CCM F;  1OY5 A;  1JJ2 F;  4YQR A;  3VI6 A;  2V3J A;  3GYQ A;  4C4W C;  3IR9 A;  5IT9 M;  3J81 M;  1YJN F;  2EGW A;  4JAK A;  3N4Z A;  1CN7 A;  3AGK A;  1UAL A;  4YQO A;  1NMU B;  2KTU A;  1O6D A;  2CX8 A;  1CK2 A;  4YQI A;  4NUT A;  1K73 H;  1K9M H;  5FJ4 C;  4YQ2 A;  3ILK A;  1PXW A;  3JCM M;  3I55 F;  3CD6 F;  2QEX F;  3CCQ F;  4YQS A;  4KGN A;  1X7O A;  2LBX A;  3LWQ C;  1MXI A;  1NXZ A;  3BBE A;  1M1K H;  1P9P A;  4YQ9 A;  3CCJ F;  3N4K A;  3CC2 F;  4YVK A;  4YQK A;  1S72 F;  4XBO A;  4X3M A;  4YQ5 A;  5G4V C;  1YIJ F;  1RA4 A;  2CZW A;  2V3K A;  1Q82 H;  3E5Y A;  3MCA B;  1W3E X;  3CPQ A;  1YJW F;  1KQS F;  1VQ7 F;  5FLX M;  1VQ4 F;  3AIA A;  1W42 A;  4YQQ A;  1Q86 H;  3BBH A;  1RLG A;  3KNU A;  3OBW A;  1VQM F;  1IPA A;  1VQ6 F;  3LFO A;  3IEF A;  3ONP A;  2LBW A;  2QMM A;  1YJ9 F;  4J3C A;  3DCM X;  1E7K A;  3OII A;  4YQL A;  3NK7 A;  3V7Q A;  1XBI A;  2OTJ F;  1DT9 A;  4IG6 A;  4YQJ A;  4YQP A;  3CME F;  3J80 M;  4H3Y A;  4YVG A;  4MCC A;  5DCV A;  4YQC A;  5GMC A;  5GAP K;  3PAF A;  1VQL F;  1QVG F;  4YQ0 A;  1VQK F;  3G4S F;  3KY7 A;  4JAL A;  3CC4 F;  5CO4 A;  1GZ0 A;  3LWO C;  3J7A R;  3FFM A;  3ON1 A;  2OHW A;  3RA6 A;  5GIP C;  1VQP F;  1SDS A;  1X7P A;  5GAN K;  1GO1 A;  1J85 A;  3CCR F;  2FC3 A;  4YQT A;  1KC8 H;  3AI9 X;  3CXC F;  1V6Z A;  3LWR C;  3CPW F;  3L8U A;  3CCE F;  4YQ7 A;  3E20 B;  3SIV A;  4YPZ A;  1H7M A;  5EO3 A;  2HVY D;  1VHY A;  1Z85 A;  5EWR A;  3HAX D;  2I6D A;  2BO1 A;  4YVI A;  3OIJ A;  1YHQ F;  3LWP C;  3NVI B;  3IC6 A;  4E8B A;  3NMU C;  3KW2 A;  1Q81 H;  1UAM A;  1VQN F;  4YQ1 A;  3CMA F;  2OZB A;  2YY8 A;  3CC7 F;  4YQD A;  4RG1 A;  5GM8 A;  4YPW A;  4YQ6 A;  2VGN A;  1ZWZ A;  4MCB A;  5GMB A;  1TO0 A;  1VQO F;  1VQ5 F;  3O7B A;  3G71 F;  2VGM A;  1KD1 H;  3PLA C;  1V2X A;  3E1Y A;  1VQ9 F;  3SIU A;  4TZZ A;  4CNG A;  1W41 A;  3CCL F;  3KTY A;  4KDZ A;  3OW2 F;  4YQ4 A;  2JNB A;  2Z0Y A;  4L69 A;  3CCU F;  2WAL A;  2O3A A;  3AXZ A;  3I56 F;  4CND A;  1UAK A;  3N4J A;  2AIF A;  1W2B F;  3CCV F;  3NVK E;  4YQN A;  5GIN C; 
#chains in the Genus database with same CATH topology
 2ALE A;  1PF5 A;  3VMF B;  1FFX A;  1U3P A;  3MDO A;  4LCK A;  3JAS A;  2IQQ A;  3QUV A;  3HKD A;  2GVI A;  4ZHQ A;  1UI9 A;  4YPX A;  3F0D A;  1YI2 F;  1JD1 A;  2EWC A;  4BW0 B;  5FAI A;  1M90 H;  2HP0 A;  1VHK A;  5CB4 A;  1ODE A;  3HKE A;  3CG6 A;  4G4X A;  3T80 A;  3JAR A;  1VQ8 F;  1ONI A;  4ZOL A;  4JWH A;  5CA0 B;  3KHN A;  4O2A B;  5HY1 A;  4ZHV A;  4HNA B;  1IV4 A;  3WPX A;  2ZF8 A;  4YQG A;  3S0W A;  5LA6 A;  4I55 A;  1IV1 A;  2OTM A;  3QTY A;  1ZJR A;  4YVH A;  4U3J A;  2UZH A;  4NQ3 A;  3VI6 A;  3GYQ A;  5IT9 M;  4LNU A;  3N4Z A;  1CN7 A;  3AGK A;  4DRX A;  4YQO A;  2UYN A;  1FFX B;  1R1M A;  3ZO8 A;  5JVD A;  5FJ4 C;  3C9U A;  4C8E A;  1PXW A;  5HP7 A;  4YQA A;  3CCQ F;  1NXZ A;  3ESJ A;  2HS4 A;  4YQ9 A;  3CC2 F;  5CB4 B;  1XV2 A;  2VAP A;  4R40 B;  5IYZ B;  3C8L A;  1S72 F;  1QD9 A;  1VQV A;  3BYQ A;  2CZW A;  3E5Y A;  3MCA B;  4O2A A;  3CPQ A;  1YJW F;  3P0Z A;  2QTP A;  5EZY A;  5FLX M;  1KQS F;  3FPI A;  3LDT A;  1Q86 H;  3BBH A;  5LA6 B;  4I55 B;  1RLG A;  5HY2 A;  3OBW A;  1SA0 A;  3P10 A;  4TV9 A;  1YJ9 F;  5CA1 A;  3DCM X;  4C82 A;  5KMG A;  3HKD B;  4BVQ A;  1YQN A;  3V4D A;  2R75 1;  4ZI7 A;  4YQP A;  4MCC A;  5DCV A;  2HP0 B;  5GMC A;  4PWT A;  4ZHY B;  5KX5 A;  3RYI A;  4M8I A;  2BTU A;  3V3T A;  2ZOD A;  2PMP A;  3N2K A;  3JAT B;  4YQT A;  3AI9 X;  2RHH A;  3L8U A;  3UT5 B;  5LOV A;  3CCE F;  3SIV A;  3HAX D;  4DRX B;  5HY0 A;  2Z1T A;  2KGW A;  1FNJ A;  3E22 B;  4YQ1 A;  3S0Y A;  2YY8 A;  5GM8 A;  2R6R 1;  2VGN A;  1UFY A;  2HRY A;  4U39 A;  1RLU A;  4ZHW A;  3O7B A;  2AIZ P;  3S0H A;  4CNG A;  2NMU A;  1V2X A;  4KDZ A;  1RQ7 A;  3AXZ A;  4ERH A;  3NVK E;  5GIN C;  1TVK B;  3O85 A;  3CYP B;  2HS0 A;  3N4Y A;  2ZAU A;  4H3Z A;  2Q1Y A;  3VIU A;  1K3R A;  2QA4 F;  4X3L A;  1Q7Y H;  4FAK A;  4O4H A;  4YQ8 A;  2CVL A;  2HA8 A;  3I3F A;  5LXT B;  3CB2 A;  3RYH B;  2CHS A;  2YXZ A;  3OBY A;  3B6N A;  5EAZ A;  3RE3 A;  3RYI B;  5G4U C;  2YYE A;  4G4Y A;  2Q1X A;  4X1Y A;  2GLZ A;  3WXM B;  1YIT F;  3KE1 A;  1NJI H;  5EZY B;  3WJQ A;  2H8C A;  1VHA A;  4RQO A;  3K2X A;  3C9S A;  1X25 A;  2KTV A;  1QAH A;  3CCM F;  1JJ2 F;  2V3J A;  4C4W C;  4JAK A;  5JH7 A;  5EYP A;  3J81 M;  5EB1 B;  1NQ3 A;  1O6D A;  1FSZ A;  3F0F A;  2CX8 A;  4ZI7 B;  3D01 A;  3D54 A;  1T0A A;  3ILK A;  3TD3 A;  3JCM M;  4I50 B;  3CD6 F;  1X7O A;  3LWQ C;  3F0G A;  3WJP A;  1MXI A;  1W55 A;  4JWG A;  3BBE A;  3VYT C;  1M1K H;  1P9P A;  5LXT A;  3KJK A;  4XBO A;  4BT4 A;  1YIJ F;  1XHO A;  1Q82 H;  2F9Z C;  1SZQ A;  1JY8 A;  1VQ7 F;  5B8F A;  3HKC B;  1W42 A;  2Z1E A;  4G4W A;  4TUY A;  5GON A;  1W5F A;  1TVK A;  3IEF A;  2LBW A;  3P4E A;  2QMM A;  3WPW A;  2IAF A;  5EIB D;  3JAS B;  5HXZ A;  1E7K A;  3V7Q A;  4YQL A;  1XBI A;  2UYJ A;  2OTJ F;  4IG6 A;  1TUB A;  3JAW A;  4BT6 A;  4G4V A;  3JAL B;  2DYY A;  3M1X A;  4YVG A;  2HX0 A;  2P6Y A;  4I50 A;  4E6E A;  3I7T A;  4YQC A;  3GHZ A;  1VQK F;  4EB6 A;  4O4J B;  1GZ0 A;  3ON1 A;  4ZOL B;  4G4Z A;  1JFF A;  2VXY A;  4IIJ A;  5CA0 A;  1X7P A;  3VYU C;  5GAN K;  4BVT A;  3LWR C;  3RYC B;  4TUY B;  1H7M A;  5GON B;  1VHY A;  2ZVZ A;  5EWR A;  4X20 A;  4YVI A;  3OIJ A;  2BTO A;  3LWP C;  2ZOV A;  3NVI B;  3IKE A;  3FD5 A;  3IC6 A;  5EB0 A;  5C8Y B;  4O4H B;  1TUB B;  3JAW B;  3CMA F;  1H47 A;  3LYB A;  3IEW A;  4O2B A;  3MQW A;  4RG1 A;  4YQ6 A;  1U43 A;  4MCB A;  5HY4 A;  1TO0 A;  1H48 A;  1VQO F;  3IMP A;  5EIB C;  1IV2 A;  1VQ5 F;  1KD1 H;  3ZP7 A;  1FNK A;  3E1Y A;  3N2G A;  5LP6 B;  3CCL F;  2Z0Y A;  2I6R A;  4L69 A;  3CCU F;  3HKC A;  3L7Q A;  2WAL A;  4WBN B;  2K1S A;  4B5C A;  1UAK A;  3N4J A;  2AIF A;  3K14 A;  1SA0 B;  4TV9 B;  4BT7 A;  5EYP B;  5IJ0 B;  4CNE A;  4BY9 D;  3V7E A;  2QI2 A;  1CLI A;  3JAL A;  1GO0 A;  4G88 A;  4YQ3 A;  1W5A A;  3HTN A;  5JQG B;  1W5B A;  5IJ9 A;  3OIN A;  5FNV B;  4PZK A;  4YVJ A;  3Q8H A;  5A2Q M;  3BBD A;  3MBM A;  4CNF A;  3RYF A;  3HJW C;  4YQB A;  5MN4 A;  5D9F A;  4IHJ A;  1UAJ A;  2H8E A;  3TD4 A;  2QWV A;  4MCD A;  3FBA A;  1COM A;  2V9Y A;  3IEQ A;  2B33 A;  4BVR A;  1GX1 A;  1W58 1;  2DT4 A;  2Z01 A;  5HXU A;  2EGW A;  3IR9 A;  1YJN F;  4BVS A;  5IJ0 A;  1NMU B;  2KTU A;  4NUT A;  4TV8 B;  4C8G A;  4F6R B;  1K73 H;  1K9M H;  3E22 A;  2QEX F;  1VK3 A;  2BTQ B;  4KGN A;  4B45 A;  3WGK A;  5IJ9 B;  3CCJ F;  4YVK A;  1YGY A;  5G4V C;  4XCQ A;  1JFF B;  3N2G B;  5LP6 A;  1RA4 A;  4BT5 A;  3M84 A;  3ZOP A;  1VQ4 F;  2UYP A;  3KNU A;  1VQM F;  4X20 B;  1IPA A;  5J2U B;  3ONP A;  1Z5V A;  4J3C A;  3OII A;  2CW4 A;  1DT9 A;  4YJ3 A;  3DDN A;  2AMT A;  4DXD A;  4YQJ A;  4EI9 A;  4H3Y A;  1IV3 A;  3VOA A;  4JWF A;  3DC2 A;  5GAP K;  3PAF A;  3K12 A;  3WGM A;  1QVG F;  1U3L A;  3G4S F;  3KY7 A;  3F6M A;  4X1Y B;  3HKE B;  3CC4 F;  3ZP4 A;  5CO4 A;  3JAR B;  3J7A R;  3FFM A;  4JWJ A;  2OHW A;  3RA6 A;  5GIP C;  3C9T A;  1J85 A;  4BT3 A;  3CCR F;  4HNA A;  4WBN A;  1V6Z A;  4YQ7 A;  1Z5W A;  2CSL A;  3E20 B;  2HVY D;  3VTI C;  4ZK7 A;  5JH7 B;  5LYJ B;  5J2U A;  1YHQ F;  2RHJ A;  4TV8 A;  4F6R A;  3NMU C;  2UYK A;  1Q81 H;  4YJ3 B;  2OZB A;  3CC7 F;  4YPW A;  3QHD A;  1W5E A;  1ZWZ A;  5GMB A;  1OAP A;  5ITZ B;  1KNK A;  2HS3 A;  5MN5 A;  4BT2 A;  3K0T A;  1OFU A;  1VQ9 F;  3SIU A;  1W41 A;  3KJJ A;  3OW2 F;  2JNB A;  2O3A A;  5AVM A;  3CCV F;  4YQN A;  3ERN A;  3RA5 A;  3MCQ A;  1T0K B;  1VH0 A;  4C81 A;  5KMG B;  3S06 A;  3VOB A;  4FMW A;  1N8R H;  1W57 A;  1JN1 A;  2EGV A;  4RHA A;  1X52 A;  3G6E F;  2L26 A;  4I4T A;  4EB6 B;  1NS5 A;  2CHT A;  4O4J A;  1K8A H;  3LWV C;  4YPY A;  3NK6 A;  3LME A;  2GZL A;  4IIJ B;  3CCS F;  1W40 A;  3OON A;  3VYS C;  2KG4 A;  2OTL F;  3N2K B;  3GTZ A;  1QVF F;  3JAM M;  5J2T A;  5GIO C;  3RYC A;  3HWU A;  1Q8R A;  3HKB B;  4X1I B;  5LYJ A;  1OY5 A;  1KNJ A;  2LCA A;  2RHO A;  4YQR A;  2CWJ A;  2HQS C;  5JCO C;  1UAL A;  5BMV B;  2HRU A;  1U40 A;  1CK2 A;  2RB9 A;  4YQI A;  5C8Y A;  4YQ2 A;  4O2B B;  3I55 F;  3VO8 A;  4O4I A;  4YJ2 A;  4YQS A;  2LBX A;  3R0P A;  5LP6 C;  4B46 A;  3N4K A;  4YQK A;  2FGY A;  4X3M A;  4YQ5 A;  3WGJ A;  2Z1F A;  3QUW A;  2V3K A;  2W8B C;  4X1K A;  1XRG A;  4B62 A;  1W3E X;  5HWE A;  3F0E A;  3AIA A;  2HP3 A;  4YQQ A;  4X1I A;  3HKB A;  3IKF A;  1VH8 A;  3VCZ A;  1VQ6 F;  3LFO A;  4U3J B;  3M4S A;  3WJR A;  3NK7 A;  5BMV A;  5JVD B;  3CME F;  3J80 M;  5JQG A;  2VAM A;  4I4T B;  4KWE A;  5FNV A;  3TD5 A;  1QU9 A;  5ITZ A;  4EI8 A;  1VQL F;  4YQ0 A;  2H6L A;  3RYH A;  4JAL A;  5HP8 A;  3D00 A;  3RYF B;  3LWO C;  1RQ2 A;  3FD6 A;  2PHN A;  4IHJ B;  3JVH A;  1VQP F;  1SDS A;  2ZVY A;  4FFB A;  1GO1 A;  4X1K B;  3JAK B;  2FC3 A;  2G9I A;  1KC8 H;  2IG8 A;  3ELC A;  3CXC F;  3CPW F;  3EOR A;  4O4L A;  4YPZ A;  3WGL A;  5EO3 A;  3S03 A;  1J7H A;  1Z85 A;  4EI7 A;  3S02 A;  2I6D A;  2BO1 A;  2MQE A;  5CA1 B;  4E8B A;  4NWO B;  4ZHQ B;  2UYN B;  3KW2 A;  1UAM A;  2RHL A;  4O4I B;  4YJ2 B;  1VQN F;  5JCO A;  4YQD A;  2LBT A;  3C9R A;  5KX5 B;  3WGN A;  1W59 A;  5IYZ A;  3G71 F;  2VGM A;  3PLA C;  4YQ4 A;  4TZZ A;  2Z1U A;  3KTY A;  2N48 A;  3KIZ A;  5J2T B;  4FFB B;  3CYQ A;  3JAK A;  3JAT A;  1DBF A;  3I56 F;  5MN6 A;  4CND A;  2VAW A;  3UT5 A;  5LOV B;  1W2B F;  4O4L B;  3U0O A;  4C8I A;  4LNU B; 
#chains in the Genus database with same CATH homology
 3RA5 A;  2ALE A;  3O85 A;  4BY9 D;  3VMF B;  2QI2 A;  1T0K B;  3V7E A;  3N4Y A;  4H3Z A;  4CNE A;  4LCK A;  1VH0 A;  1K3R A;  3QUV A;  2QA4 F;  4YPX A;  4FMW A;  1YI2 F;  4X3L A;  1Q7Y H;  1N8R H;  4FAK A;  4YQ8 A;  4BW0 B;  1GO0 A;  2EGV A;  3G6E F;  1X52 A;  5FAI A;  4YQ3 A;  2HA8 A;  1M90 H;  1VHK A;  3OIN A;  1NS5 A;  3OBY A;  4PZK A;  3CG6 A;  4YVJ A;  5G4U C;  1K8A H;  5A2Q M;  3LWV C;  3BBD A;  3NK6 A;  4YPY A;  1VQ8 F;  2GLZ A;  4CNF A;  3CCS F;  3HJW C;  3WXM B;  1W40 A;  1YIT F;  4YQB A;  4JWH A;  5D9F A;  1NJI H;  2KG4 A;  5HY1 A;  2OTL F;  1UAJ A;  4MCD A;  2QWV A;  1QVF F;  4YQA A;  4YQG A;  3JAM M;  5GIO C;  4YVH A;  2KTV A;  4BVR A;  1ZJR A;  3CCM F;  4NQ3 A;  1JJ2 F;  1OY5 A;  3VI6 A;  5HXU A;  3GYQ A;  4C4W C;  3IR9 A;  5IT9 M;  3J81 M;  1YJN F;  2EGW A;  2V3J A;  3N4Z A;  1CN7 A;  3AGK A;  4BVS A;  1UAL A;  1NMU B;  2KTU A;  1O6D A;  2CX8 A;  1CK2 A;  4YQO A;  4NUT A;  1K73 H;  1K9M H;  4YQI A;  5FJ4 C;  4YQ2 A;  3ILK A;  1PXW A;  3JCM M;  3I55 F;  3CD6 F;  2QEX F;  3CCQ F;  4YQS A;  4KGN A;  1X7O A;  2LBX A;  3LWQ C;  1MXI A;  1NXZ A;  4JWG A;  3BBE A;  1M1K H;  1P9P A;  4YQ9 A;  3CCJ F;  3N4K A;  3CC2 F;  4YVK A;  4YQK A;  2FGY A;  1S72 F;  4XBO A;  4X3M A;  4YQ5 A;  5G4V C;  4XCQ A;  1YIJ F;  1RA4 A;  2CZW A;  2V3K A;  1Q82 H;  2F9Z C;  3E5Y A;  3MCA B;  5HWE A;  1W3E X;  3CPQ A;  1YJW F;  1KQS F;  1VQ7 F;  5FLX M;  1VQ4 F;  3AIA A;  1W42 A;  4YQQ A;  1Q86 H;  3BBH A;  1RLG A;  5HY2 A;  3KNU A;  3OBW A;  1VQM F;  1IPA A;  1VQ6 F;  3LFO A;  3IEF A;  3ONP A;  2LBW A;  2QMM A;  1YJ9 F;  4J3C A;  3DCM X;  1E7K A;  5HXZ A;  3OII A;  3NK7 A;  3V7Q A;  4YQL A;  1XBI A;  4BVQ A;  1DT9 A;  2OTJ F;  4IG6 A;  4YQR A;  4YQJ A;  4YQP A;  4EI9 A;  3CME F;  3J80 M;  4H3Y A;  4YVG A;  4MCC A;  5DCV A;  4JWF A;  4YQC A;  5GMC A;  5GAP K;  3PAF A;  1VQL F;  4EI8 A;  1QVG F;  1VQK F;  3G4S F;  3KY7 A;  4YQ0 A;  4JAL A;  3CC4 F;  5CO4 A;  3D00 A;  1GZ0 A;  3LWO C;  3J7A R;  3FFM A;  3ON1 A;  4JWJ A;  2OHW A;  3RA6 A;  3V3T A;  5GIP C;  1VQP F;  1SDS A;  1X7P A;  5GAN K;  1GO1 A;  4BVT A;  3CCR F;  1J85 A;  2FC3 A;  4YQT A;  1KC8 H;  3AI9 X;  3CXC F;  1V6Z A;  3LWR C;  3CPW F;  3L8U A;  3CCE F;  4YQ7 A;  3E20 B;  3SIV A;  4YPZ A;  1H7M A;  5EO3 A;  2HVY D;  1VHY A;  1Z85 A;  4EI7 A;  5EWR A;  2I6D A;  2BO1 A;  3HAX D;  4YVI A;  3OIJ A;  5HY0 A;  1YHQ F;  3LWP C;  3NVI B;  3IC6 A;  4E8B A;  3NMU C;  3KW2 A;  1Q81 H;  1UAM A;  1VQN F;  4YQ1 A;  3CMA F;  2OZB A;  2YY8 A;  3CC7 F;  4YQD A;  4RG1 A;  5GM8 A;  4YPW A;  4YQ6 A;  2VGN A;  1ZWZ A;  4MCB A;  5GMB A;  5HY4 A;  1TO0 A;  1VQO F;  1VQ5 F;  3O7B A;  3G71 F;  2VGM A;  1KD1 H;  3PLA C;  1V2X A;  3E1Y A;  1VQ9 F;  3SIU A;  4TZZ A;  4CNG A;  1W41 A;  3CCL F;  3KTY A;  4KDZ A;  3OW2 F;  4YQ4 A;  2JNB A;  2Z0Y A;  4L69 A;  3CCU F;  2WAL A;  2O3A A;  3AXZ A;  3I56 F;  4CND A;  1UAK A;  3N4J A;  2AIF A;  1W2B F;  3CCV F;  3NVK E;  4YQN A;  4JAK A;  5GIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...