5CO4A

Structural insights into the 2-oh methylation of c/u34 on trna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
Knots found
sequence length
152
structure length
152
Chain Sequence
GPHMLHLVLYQPEIPQNAGNVARTAAALGWPLHLIRPLGFLLSSPKLKRAGLDYWPHVDLRLHDSFAAFLEALPRGARVFAFSARGEASLYEARFREGDYLLFGPESRGLPEEVLARFPTLKIPMPGPVRSLNLAVAVGVAAYEAYRQLTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tRNA (cytidine(34)-2'-O)-methyltransferase
publication title Structural insights into the 2-OH methylation of C34 or U34 on tRNA
rcsb
source organism Thermus thermophilus hb27
molecule tags Transferase
total genus 44
structure length 152
sequence length 152
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 5co4A00
4JALA 3ILKA 2HA8A 3OINA 1NS5A 4XBOA 1V6ZA 2YY8A 5GM8A 4CNGA 4YQ9A 4MCDA 2O3AA 1X7PA 4KDZA 4CNDA 1UAMA 4YQNA 4CNFA 4PZKA 3NK7A 4YQDA 1MXIA 4YVHA 4YPWA 4YQQA 4YQOA 4YQ8A 4J3CA 3BBEA 3ONPA 4YQRA 1IPAA 3N4KA 5D9FA 4YQCA 5FAIA 1X7OA 3E5YA 3KTYA 3KW2A 4YPXA 4YQ5A 2EGVA 2Z0YA 3IC6A 1VH0A 1NXZA 1O6DA 3NK6A 4YQ3A 4YQSA 1K3RA 3N4JA 4CNEA 1J85A 4YQKA 1Z85A 4YQTA 4YPYA 5GMBA 3O7BA 3AIAA 2QWVA 3DCMX 4H3ZA 4MCCA 4YQ0A 4YQJA 4YVKA 3KNUA 4KGNA 1ZJRA 3QUVA 4X3MA 3IEFA 3BBHA 1GZ0A 4MCBA 4YQPA 4YQ1A 4YQ7A 4YQ2A 2QMMA 4YVGA 2CX8A 4YQ6A 4RG1A 1P9PA 4YQLA 1TO0A 1VHKA 3L8UA 3GYQA 5CO4A 1V2XA 4YVJA 4E8BA 2EGWA 3AXZA 2V3JA 1UAJA 4H3YA 4YQIA 4IG6A 1OY5A 5GMCA 3AI9X 4FAKA 4YQBA 4YVIA 4YQGA 3OIJA 3KY7A 4YQ4A 4L69A 4JAKA 1VHYA 2I6DA 4X3LA 1UALA 1UAKA 3BBDA 3OIIA 2V3KA 4YPZA 4YQAA
chains in the Genus database with same CATH superfamily
4JALA 3ILKA 2HA8A 3OINA 1NS5A 4XBOA 1V6ZA 2YY8A 5GM8A 4JWJA 4CNGA 4YQ9A 4MCDA 2O3AA 1X7PA 4KDZA 4CNDA 1UAMA 4YQNA 4CNFA 4PZKA 3NK7A 4YQDA 1MXIA 4YVHA 4YPWA 4YQQA 4YQOA 4YQ8A 4J3CA 3BBEA 3ONPA 4YQRA 4JWHA 1IPAA 3N4KA 5D9FA 4YQCA 5FAIA 1X7OA 3E5YA 3KTYA 3KW2A 4YPXA 4YQ5A 2EGVA 2Z0YA 3IC6A 1VH0A 1NXZA 1O6DA 3NK6A 4YQ3A 4YQSA 1K3RA 3N4JA 4CNEA 1J85A 4YQKA 1Z85A 4YQTA 4YPYA 5GMBA 3O7BA 4FMWA 3AIAA 2QWVA 3DCMX 4H3ZA 4MCCA 4YQ0A 4YQJA 4YVKA 3KNUA 4KGNA 1ZJRA 3QUVA 4X3MA 3IEFA 3BBHA 1GZ0A 4MCBA 4YQPA 4YQ1A 4YQ7A 4YQ2A 2QMMA 4YVGA 2CX8A 4YQ6A 4RG1A 1P9PA 4YQLA 1TO0A 1VHKA 3L8UA 4JWFA 3GYQA 5CO4A 1V2XA 4YVJA 4E8BA 2EGWA 3AXZA 2V3JA 1UAJA 4H3YA 4YQIA 4IG6A 1OY5A 5GMCA 3AI9X 4FAKA 4YQBA 4YVIA 4YQGA 3OIJA 3KY7A 4YQ4A 4L69A 4JAKA 1VHYA 2I6DA 4X3LA 4JWGA 1UALA 1UAKA 3BBDA 3OIIA 2V3KA 4YPZA 4YQAA
chains in the Genus database with same CATH topology
4JALA 3ILKA 2HA8A 3OINA 1NS5A 4XBOA 1V6ZA 2YY8A 5GM8A 4JWJA 4CNGA 4YQ9A 4MCDA 2O3AA 1X7PA 4KDZA 4CNDA 1UAMA 4YQNA 4CNFA 4PZKA 3NK7A 4YQDA 1MXIA 4YVHA 4YPWA 4YQQA 4YQOA 4YQ8A 4J3CA 3BBEA 3ONPA 4YQRA 4JWHA 1IPAA 3N4KA 5D9FA 4YQCA 5FAIA 1X7OA 3E5YA 3KTYA 3KW2A 4YPXA 4YQ5A 2EGVA 2Z0YA 3IC6A 1VH0A 1NXZA 1O6DA 3NK6A 4YQ3A 4YQSA 1K3RA 3N4JA 4CNEA 1J85A 4YQKA 1Z85A 4YQTA 4YPYA 5GMBA 3O7BA 4FMWA 3AIAA 2QWVA 3DCMX 4H3ZA 4MCCA 4YQ0A 4YQJA 4YVKA 3KNUA 4KGNA 1ZJRA 3QUVA 4X3MA 3IEFA 3BBHA 1GZ0A 4MCBA 4YQPA 4YQ1A 4YQ7A 4YQ2A 2QMMA 4YVGA 2CX8A 4YQ6A 4RG1A 1P9PA 4YQLA 1TO0A 1VHKA 3L8UA 4JWFA 3GYQA 5CO4A 1V2XA 4YVJA 4E8BA 2EGWA 3AXZA 2V3JA 1UAJA 4H3YA 4YQIA 4IG6A 1OY5A 5GMCA 3AI9X 4FAKA 4YQBA 4YVIA 4YQGA 3OIJA 3KY7A 4YQ4A 4L69A 4JAKA 1VHYA 2I6DA 4X3LA 4JWGA 1UALA 1UAKA 3BBDA 3OIIA 2V3KA 4YPZA 4YQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAL A;  3ILK A;  2HA8 A;  3OIN A;  1NS5 A;  4XBO A;  1V6Z A;  2YY8 A;  5GM8 A;  4CNG A;  4YQ9 A;  4MCD A;  2O3A A;  1X7P A;  4KDZ A;  4CND A;  1UAM A;  4YQN A;  4CNF A;  4PZK A;  3NK7 A;  4YQD A;  1MXI A;  4YVH A;  4YPW A;  4YQQ A;  4YQO A;  4YQ8 A;  4J3C A;  3BBE A;  3ONP A;  4YQR A;  1IPA A;  3N4K A;  5D9F A;  4YQC A;  5FAI A;  1X7O A;  3E5Y A;  3KTY A;  3KW2 A;  4YPX A;  4YQ5 A;  2EGV A;  2Z0Y A;  3IC6 A;  1VH0 A;  1NXZ A;  1O6D A;  3NK6 A;  4YQ3 A;  4YQS A;  1K3R A;  3N4J A;  4CNE A;  1J85 A;  4YQK A;  1Z85 A;  4YQT A;  4YPY A;  5GMB A;  3O7B A;  3AIA A;  2QWV A;  3DCM X;  4H3Z A;  4MCC A;  4YQ0 A;  4YQJ A;  4YVK A;  3KNU A;  4KGN A;  1ZJR A;  3QUV A;  4X3M A;  3IEF A;  3BBH A;  1GZ0 A;  4MCB A;  4YQP A;  4YQ1 A;  4YQ7 A;  4YQ2 A;  2QMM A;  4YVG A;  2CX8 A;  4YQ6 A;  4RG1 A;  1P9P A;  4YQL A;  1TO0 A;  1VHK A;  3L8U A;  3GYQ A;  5CO4 A;  1V2X A;  4YVJ A;  4E8B A;  2EGW A;  3AXZ A;  2V3J A;  1UAJ A;  4H3Y A;  4YQI A;  4IG6 A;  1OY5 A;  5GMC A;  3AI9 X;  4FAK A;  4YQB A;  4YVI A;  4YQG A;  3OIJ A;  3KY7 A;  4YQ4 A;  4L69 A;  4JAK A;  1VHY A;  2I6D A;  4X3L A;  1UAL A;  1UAK A;  3BBD A;  3OII A;  2V3K A;  4YPZ A;  4YQA A; 
#chains in the Genus database with same CATH topology
 4JAL A;  3ILK A;  2HA8 A;  3OIN A;  1NS5 A;  4XBO A;  1V6Z A;  2YY8 A;  5GM8 A;  4JWJ A;  4CNG A;  4YQ9 A;  4MCD A;  2O3A A;  1X7P A;  4KDZ A;  4CND A;  1UAM A;  4YQN A;  4CNF A;  4PZK A;  3NK7 A;  4YQD A;  1MXI A;  4YVH A;  4YPW A;  4YQQ A;  4YQO A;  4YQ8 A;  4J3C A;  3BBE A;  3ONP A;  4YQR A;  4JWH A;  1IPA A;  3N4K A;  5D9F A;  4YQC A;  5FAI A;  1X7O A;  3E5Y A;  3KTY A;  3KW2 A;  4YPX A;  4YQ5 A;  2EGV A;  2Z0Y A;  3IC6 A;  1VH0 A;  1NXZ A;  1O6D A;  3NK6 A;  4YQ3 A;  4YQS A;  1K3R A;  3N4J A;  4CNE A;  1J85 A;  4YQK A;  1Z85 A;  4YQT A;  4YPY A;  5GMB A;  3O7B A;  4FMW A;  3AIA A;  2QWV A;  3DCM X;  4H3Z A;  4MCC A;  4YQ0 A;  4YQJ A;  4YVK A;  3KNU A;  4KGN A;  1ZJR A;  3QUV A;  4X3M A;  3IEF A;  3BBH A;  1GZ0 A;  4MCB A;  4YQP A;  4YQ1 A;  4YQ7 A;  4YQ2 A;  2QMM A;  4YVG A;  2CX8 A;  4YQ6 A;  4RG1 A;  1P9P A;  4YQL A;  1TO0 A;  1VHK A;  3L8U A;  4JWF A;  3GYQ A;  5CO4 A;  1V2X A;  4YVJ A;  4E8B A;  2EGW A;  3AXZ A;  2V3J A;  1UAJ A;  4H3Y A;  4YQI A;  4IG6 A;  1OY5 A;  5GMC A;  3AI9 X;  4FAK A;  4YQB A;  4YVI A;  4YQG A;  3OIJ A;  3KY7 A;  4YQ4 A;  4L69 A;  4JAK A;  1VHY A;  2I6D A;  4X3L A;  4JWG A;  1UAL A;  1UAK A;  3BBD A;  3OII A;  2V3K A;  4YPZ A;  4YQA A; 
#chains in the Genus database with same CATH homology
 4JAL A;  3ILK A;  2HA8 A;  3OIN A;  1NS5 A;  4XBO A;  1V6Z A;  2YY8 A;  5GM8 A;  4JWJ A;  4CNG A;  4YQ9 A;  4MCD A;  2O3A A;  1X7P A;  4KDZ A;  4CND A;  1UAM A;  4YQN A;  4CNF A;  4PZK A;  3NK7 A;  4YQD A;  1MXI A;  4YVH A;  4YPW A;  4YQQ A;  4YQO A;  4YQ8 A;  4J3C A;  3BBE A;  3ONP A;  4YQR A;  4JWH A;  1IPA A;  3N4K A;  5D9F A;  4YQC A;  5FAI A;  1X7O A;  3E5Y A;  3KTY A;  3KW2 A;  4YPX A;  4YQ5 A;  2EGV A;  2Z0Y A;  3IC6 A;  1VH0 A;  1NXZ A;  1O6D A;  3NK6 A;  4YQ3 A;  4YQS A;  1K3R A;  3N4J A;  4CNE A;  1J85 A;  4YQK A;  1Z85 A;  4YQT A;  4YPY A;  5GMB A;  3O7B A;  4FMW A;  3AIA A;  2QWV A;  3DCM X;  4H3Z A;  4MCC A;  4YQ0 A;  4YQJ A;  4YVK A;  3KNU A;  4KGN A;  1ZJR A;  3QUV A;  4X3M A;  3IEF A;  3BBH A;  1GZ0 A;  4MCB A;  4YQP A;  4YQ1 A;  4YQ7 A;  4YQ2 A;  2QMM A;  4YVG A;  2CX8 A;  4YQ6 A;  4RG1 A;  1P9P A;  4YQL A;  1TO0 A;  1VHK A;  3L8U A;  4JWF A;  3GYQ A;  5CO4 A;  1V2X A;  4YVJ A;  4E8B A;  2EGW A;  3AXZ A;  2V3J A;  1UAJ A;  4H3Y A;  4YQI A;  4IG6 A;  1OY5 A;  5GMC A;  3AI9 X;  4FAK A;  4YQB A;  4YVI A;  4YQG A;  3OIJ A;  3KY7 A;  4YQ4 A;  4L69 A;  4JAK A;  1VHY A;  2I6D A;  4X3L A;  4JWG A;  1UAL A;  1UAK A;  3BBD A;  3OII A;  2V3K A;  4YPZ A;  4YQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...