4CNDA

Crystal structure of e.coli trmj
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
Knots found
sequence length
169
structure length
169
Chain Sequence
DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 169
sequence length 169
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cndA01
4PZKA 4YQ9A 4YQ5A 4YPXA 4MCDA 3IC6A 4YQ4A 1UAJA 4KDZA 5FAIA 3E5YA 1P9PA 4YQ8A 2QMMA 2YY8A 1O6DA 4YVKA 2EGVA 3IEFA 5GMBA 4JALA 3NK7A 1X7OA 3KY7A 2I6DA 3BBEA 1GZ0A 3O7BA 3BBDA 4YQKA 3ONPA 4YQ0A 4YPYA 4YQIA 4YQLA 4YQBA 1MXIA 3KW2A 4H3YA 4YQCA 4CNDA 4YVHA 4YVIA 1X7PA 3L8UA 4CNEA 1NS5A 4XBOA 3AXZA 4YPZA 1IPAA 4YQPA 5GMCA 3ILKA 2V3KA 4YQAA 3NK6A 3N4JA 4YQJA 1UAKA 1V6ZA 4X3MA 2CX8A 3DCMX 4YPWA 1VHYA 4FAKA 4YQQA 3BBHA 3OIJA 1V2XA 4YQTA 3AI9X 4L69A 2O3AA 1Z85A 4KGNA 4YQ1A 2EGWA 1TO0A 1VHKA 4CNGA 3OIIA 5GM8A 4YQGA 4JAKA 1NXZA 4YQNA 1K3RA 3OINA 4YQDA 4MCBA 1ZJRA 4H3ZA 1UALA 4X3LA 4YQOA 4YQ2A 2V3JA 1OY5A 3QUVA 4YQ6A 4E8BA 1J85A 4YVJA 3KTYA 1VH0A 4J3CA 5D9FA 4YQSA 2QWVA 2Z0YA 4YQRA 3AIAA 4MCCA 4CNFA 4IG6A 3N4KA 2HA8A 3KNUA 1UAMA 5CO4A 4YQ7A 4YVGA 4RG1A 3GYQA 4YQ3A
chains in the Genus database with same CATH superfamily
4PZKA 4YQ9A 4YQ5A 4YPXA 4MCDA 3IC6A 4YQ4A 1UAJA 4KDZA 4JWJA 5FAIA 3E5YA 4JWFA 1P9PA 4YQ8A 2QMMA 2YY8A 1O6DA 4YVKA 2EGVA 3IEFA 5GMBA 4JALA 3NK7A 1X7OA 3KY7A 2I6DA 3BBEA 1GZ0A 3O7BA 3BBDA 4YQKA 3ONPA 4YQ0A 4YPYA 4YQIA 4YQLA 4YQBA 1MXIA 3KW2A 4H3YA 4YQCA 4CNDA 4YVHA 4YVIA 1X7PA 3L8UA 4CNEA 1NS5A 4XBOA 3AXZA 4YPZA 1IPAA 4YQPA 5GMCA 3ILKA 2V3KA 4YQAA 3NK6A 3N4JA 4YQJA 1UAKA 1V6ZA 4X3MA 2CX8A 3DCMX 4YPWA 1VHYA 4FAKA 4YQQA 3BBHA 3OIJA 1V2XA 4YQTA 3AI9X 4L69A 2O3AA 1Z85A 4KGNA 4YQ1A 2EGWA 1TO0A 1VHKA 4CNGA 3OIIA 5GM8A 4YQGA 4JAKA 1NXZA 4YQNA 1K3RA 3OINA 4YQDA 4JWHA 4MCBA 1ZJRA 4H3ZA 1UALA 4FMWA 4JWGA 4X3LA 4YQOA 4YQ2A 2V3JA 1OY5A 3QUVA 4YQ6A 4E8BA 1J85A 4YVJA 3KTYA 1VH0A 4J3CA 5D9FA 4YQSA 2QWVA 2Z0YA 4YQRA 3AIAA 4MCCA 4CNFA 4IG6A 3N4KA 2HA8A 3KNUA 1UAMA 5CO4A 4YQ7A 4YVGA 4RG1A 3GYQA 4YQ3A
chains in the Genus database with same CATH topology
4PZKA 4YQ9A 4YQ5A 4YPXA 4MCDA 3IC6A 4YQ4A 1UAJA 4KDZA 4JWJA 5FAIA 3E5YA 4JWFA 1P9PA 4YQ8A 2QMMA 2YY8A 1O6DA 4YVKA 2EGVA 3IEFA 5GMBA 4JALA 3NK7A 1X7OA 3KY7A 2I6DA 3BBEA 1GZ0A 3O7BA 3BBDA 4YQKA 3ONPA 4YQ0A 4YPYA 4YQIA 4YQLA 4YQBA 1MXIA 3KW2A 4H3YA 4YQCA 4CNDA 4YVHA 4YVIA 1X7PA 3L8UA 4CNEA 1NS5A 4XBOA 3AXZA 4YPZA 1IPAA 4YQPA 5GMCA 3ILKA 2V3KA 4YQAA 3NK6A 3N4JA 4YQJA 1UAKA 1V6ZA 4X3MA 2CX8A 3DCMX 4YPWA 1VHYA 4FAKA 4YQQA 3BBHA 3OIJA 1V2XA 4YQTA 3AI9X 4L69A 2O3AA 1Z85A 4KGNA 4YQ1A 2EGWA 1TO0A 1VHKA 4CNGA 3OIIA 5GM8A 4YQGA 4JAKA 1NXZA 4YQNA 1K3RA 3OINA 4YQDA 4JWHA 4MCBA 1ZJRA 4H3ZA 1UALA 4FMWA 4JWGA 4X3LA 4YQOA 4YQ2A 2V3JA 1OY5A 3QUVA 4YQ6A 4E8BA 1J85A 4YVJA 3KTYA 1VH0A 4J3CA 5D9FA 4YQSA 2QWVA 2Z0YA 4YQRA 3AIAA 4MCCA 4CNFA 4IG6A 3N4KA 2HA8A 3KNUA 1UAMA 5CO4A 4YQ7A 4YVGA 4RG1A 3GYQA 4YQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZK A;  4YQ9 A;  4YQ5 A;  4YPX A;  4MCD A;  3IC6 A;  4YQ4 A;  1UAJ A;  4KDZ A;  5FAI A;  3E5Y A;  1P9P A;  4YQ8 A;  2QMM A;  2YY8 A;  1O6D A;  4YVK A;  2EGV A;  3IEF A;  5GMB A;  4JAL A;  3NK7 A;  1X7O A;  3KY7 A;  2I6D A;  3BBE A;  1GZ0 A;  3O7B A;  3BBD A;  4YQK A;  3ONP A;  4YQ0 A;  4YPY A;  4YQI A;  4YQL A;  4YQB A;  1MXI A;  3KW2 A;  4H3Y A;  4YQC A;  4CND A;  4YVH A;  4YVI A;  1X7P A;  3L8U A;  4CNE A;  1NS5 A;  4XBO A;  3AXZ A;  4YPZ A;  1IPA A;  4YQP A;  5GMC A;  3ILK A;  2V3K A;  4YQA A;  3NK6 A;  3N4J A;  4YQJ A;  1UAK A;  1V6Z A;  4X3M A;  2CX8 A;  3DCM X;  4YPW A;  1VHY A;  4FAK A;  4YQQ A;  3BBH A;  3OIJ A;  1V2X A;  4YQT A;  3AI9 X;  4L69 A;  2O3A A;  1Z85 A;  4KGN A;  4YQ1 A;  2EGW A;  1TO0 A;  1VHK A;  4CNG A;  3OII A;  5GM8 A;  4YQG A;  4JAK A;  1NXZ A;  4YQN A;  1K3R A;  3OIN A;  4YQD A;  4MCB A;  1ZJR A;  4H3Z A;  1UAL A;  4X3L A;  4YQO A;  4YQ2 A;  2V3J A;  1OY5 A;  3QUV A;  4YQ6 A;  4E8B A;  1J85 A;  4YVJ A;  3KTY A;  1VH0 A;  4J3C A;  5D9F A;  4YQS A;  2QWV A;  2Z0Y A;  4YQR A;  3AIA A;  4MCC A;  4CNF A;  4IG6 A;  3N4K A;  2HA8 A;  3KNU A;  1UAM A;  5CO4 A;  4YQ7 A;  4YVG A;  4RG1 A;  3GYQ A;  4YQ3 A; 
#chains in the Genus database with same CATH topology
 4PZK A;  4YQ9 A;  4YQ5 A;  4YPX A;  4MCD A;  3IC6 A;  4YQ4 A;  1UAJ A;  4KDZ A;  4JWJ A;  5FAI A;  3E5Y A;  4JWF A;  1P9P A;  4YQ8 A;  2QMM A;  2YY8 A;  1O6D A;  4YVK A;  2EGV A;  3IEF A;  5GMB A;  4JAL A;  3NK7 A;  1X7O A;  3KY7 A;  2I6D A;  3BBE A;  1GZ0 A;  3O7B A;  3BBD A;  4YQK A;  3ONP A;  4YQ0 A;  4YPY A;  4YQI A;  4YQL A;  4YQB A;  1MXI A;  3KW2 A;  4H3Y A;  4YQC A;  4CND A;  4YVH A;  4YVI A;  1X7P A;  3L8U A;  4CNE A;  1NS5 A;  4XBO A;  3AXZ A;  4YPZ A;  1IPA A;  4YQP A;  5GMC A;  3ILK A;  2V3K A;  4YQA A;  3NK6 A;  3N4J A;  4YQJ A;  1UAK A;  1V6Z A;  4X3M A;  2CX8 A;  3DCM X;  4YPW A;  1VHY A;  4FAK A;  4YQQ A;  3BBH A;  3OIJ A;  1V2X A;  4YQT A;  3AI9 X;  4L69 A;  2O3A A;  1Z85 A;  4KGN A;  4YQ1 A;  2EGW A;  1TO0 A;  1VHK A;  4CNG A;  3OII A;  5GM8 A;  4YQG A;  4JAK A;  1NXZ A;  4YQN A;  1K3R A;  3OIN A;  4YQD A;  4JWH A;  4MCB A;  1ZJR A;  4H3Z A;  1UAL A;  4FMW A;  4JWG A;  4X3L A;  4YQO A;  4YQ2 A;  2V3J A;  1OY5 A;  3QUV A;  4YQ6 A;  4E8B A;  1J85 A;  4YVJ A;  3KTY A;  1VH0 A;  4J3C A;  5D9F A;  4YQS A;  2QWV A;  2Z0Y A;  4YQR A;  3AIA A;  4MCC A;  4CNF A;  4IG6 A;  3N4K A;  2HA8 A;  3KNU A;  1UAM A;  5CO4 A;  4YQ7 A;  4YVG A;  4RG1 A;  3GYQ A;  4YQ3 A; 
#chains in the Genus database with same CATH homology
 4PZK A;  4YQ9 A;  4YQ5 A;  4YPX A;  4MCD A;  3IC6 A;  4YQ4 A;  1UAJ A;  4KDZ A;  4JWJ A;  5FAI A;  3E5Y A;  4JWF A;  1P9P A;  4YQ8 A;  2QMM A;  2YY8 A;  1O6D A;  4YVK A;  2EGV A;  3IEF A;  5GMB A;  4JAL A;  3NK7 A;  1X7O A;  3KY7 A;  2I6D A;  3BBE A;  1GZ0 A;  3O7B A;  3BBD A;  4YQK A;  3ONP A;  4YQ0 A;  4YPY A;  4YQI A;  4YQL A;  4YQB A;  1MXI A;  3KW2 A;  4H3Y A;  4YQC A;  4CND A;  4YVH A;  4YVI A;  1X7P A;  3L8U A;  4CNE A;  1NS5 A;  4XBO A;  3AXZ A;  4YPZ A;  1IPA A;  4YQP A;  5GMC A;  3ILK A;  2V3K A;  4YQA A;  3NK6 A;  3N4J A;  4YQJ A;  1UAK A;  1V6Z A;  4X3M A;  2CX8 A;  3DCM X;  4YPW A;  1VHY A;  4FAK A;  4YQQ A;  3BBH A;  3OIJ A;  1V2X A;  4YQT A;  3AI9 X;  4L69 A;  2O3A A;  1Z85 A;  4KGN A;  4YQ1 A;  2EGW A;  1TO0 A;  1VHK A;  4CNG A;  3OII A;  5GM8 A;  4YQG A;  4JAK A;  1NXZ A;  4YQN A;  1K3R A;  3OIN A;  4YQD A;  4JWH A;  4MCB A;  1ZJR A;  4H3Z A;  1UAL A;  4FMW A;  4JWG A;  4X3L A;  4YQO A;  4YQ2 A;  2V3J A;  1OY5 A;  3QUV A;  4YQ6 A;  4E8B A;  1J85 A;  4YVJ A;  3KTY A;  1VH0 A;  4J3C A;  5D9F A;  4YQS A;  2QWV A;  2Z0Y A;  4YQR A;  3AIA A;  4MCC A;  4CNF A;  4IG6 A;  3N4K A;  2HA8 A;  3KNU A;  1UAM A;  5CO4 A;  4YQ7 A;  4YVG A;  4RG1 A;  3GYQ A;  4YQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...