1TO0A

X-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
Knots found
sequence length
157
structure length
148
Chain Sequence
MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKMKIIKDKEGDRILSKISPDAHVIALAIEGKMKTSEELADTIDKLATYGKSKVTFVIGGSLGLSDTVMKRADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0247 protein yyda
publication title X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 41
structure length 148
sequence length 157
chains with identical sequence B, C, D, E, F, G, H
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1to0A00
2QMMA 4YQNA 3IEFA 1NS5A 1IPAA 4MCBA 3AXZA 2YY8A 3QUVA 4H3YA 1K3RA 4YQ7A 3OIIA 3O7BA 2Z0YA 4KGNA 4YQRA 1UAJA 4YQJA 2EGWA 1UALA 1X7PA 4YQCA 1TO0A 1P9PA 3AIAA 4YQ1A 4E8BA 4YQKA 3BBHA 1V2XA 1UAMA 3N4JA 4YPYA 4RG1A 4JALA 3KNUA 2HA8A 4YQ5A 4YQSA 2EGVA 1UAKA 3OINA 4YPWA 3N4KA 4YQQA 4YQDA 4CNEA 4YVJA 4YQ4A 2QWVA 4X3LA 1X7OA 4CNFA 3BBDA 3ILKA 4YQIA 4MCDA 4YQ9A 4YVGA 4YQ6A 2O3AA 4H3ZA 4YPZA 4YPXA 4PZKA 4YQPA 4L69A 4MCCA 3BBEA 5CO4A 4YQAA 1NXZA 1VHYA 4YQBA 1VHKA 3NK7A 2CX8A 4YVIA 1O6DA 3KY7A 4YQOA 4YQ3A 4KDZA 3KTYA 3ONPA 3GYQA 3KW2A 3L8UA 3E5YA 4YVKA 4JAKA 4YQTA 1MXIA 4X3MA 4CNDA 2V3JA 4YQ2A 4XBOA 3AI9X 2V3KA 1OY5A 2I6DA 3OIJA 5GM8A 4YQLA 3NK6A 4J3CA 5GMCA 5FAIA 4CNGA 1Z85A 3IC6A 4YQ8A 1GZ0A 3DCMX 4IG6A 1V6ZA 4YVHA 4YQ0A 1VH0A 5GMBA 5D9FA 1ZJRA 4YQGA 1J85A 4FAKA
chains in the Genus database with same CATH superfamily
2QMMA 4YQNA 3IEFA 1NS5A 1IPAA 4MCBA 3AXZA 2YY8A 3QUVA 4H3YA 4JWGA 1K3RA 4YQ7A 3OIIA 3O7BA 2Z0YA 4KGNA 4YQRA 1UAJA 4YQJA 4JWHA 2EGWA 1UALA 1X7PA 4YQCA 1TO0A 1P9PA 3AIAA 4YQ1A 4E8BA 4JWFA 4JWJA 4YQKA 3BBHA 1V2XA 1UAMA 3N4JA 4YPYA 4RG1A 4JALA 3KNUA 2HA8A 4YQ5A 4YQSA 2EGVA 1UAKA 3OINA 4YPWA 3N4KA 4YQQA 4YQDA 4CNEA 4YVJA 4YQ4A 2QWVA 4X3LA 1X7OA 4CNFA 3BBDA 3ILKA 4YQIA 4MCDA 4YQ9A 4YVGA 4YQ6A 2O3AA 4H3ZA 4YPZA 4YPXA 4PZKA 4YQPA 4L69A 4MCCA 3BBEA 5CO4A 4YQAA 1NXZA 1VHYA 4YQBA 1VHKA 3NK7A 2CX8A 4YVIA 1O6DA 3KY7A 4YQOA 4YQ3A 4KDZA 3KTYA 3ONPA 3GYQA 3KW2A 3L8UA 3E5YA 4YVKA 4JAKA 4YQTA 1MXIA 4X3MA 4CNDA 2V3JA 4YQ2A 4XBOA 3AI9X 2V3KA 1OY5A 2I6DA 3OIJA 5GM8A 4YQLA 3NK6A 4J3CA 5GMCA 5FAIA 4CNGA 1Z85A 3IC6A 4YQ8A 1GZ0A 3DCMX 4IG6A 1V6ZA 4YVHA 4YQ0A 1VH0A 5GMBA 4FMWA 1ZJRA 5D9FA 4YQGA 1J85A 4FAKA
chains in the Genus database with same CATH topology
2QMMA 4YQNA 3IEFA 1NS5A 1IPAA 4MCBA 3AXZA 2YY8A 3QUVA 4H3YA 4JWGA 1K3RA 4YQ7A 3OIIA 3O7BA 2Z0YA 4KGNA 4YQRA 1UAJA 4YQJA 4JWHA 2EGWA 1UALA 1X7PA 4YQCA 1TO0A 1P9PA 3AIAA 4YQ1A 4E8BA 4JWFA 4JWJA 4YQKA 3BBHA 1V2XA 1UAMA 3N4JA 4YPYA 4RG1A 4JALA 3KNUA 2HA8A 4YQ5A 4YQSA 2EGVA 1UAKA 3OINA 4YPWA 3N4KA 4YQQA 4YQDA 4CNEA 4YVJA 4YQ4A 2QWVA 4X3LA 1X7OA 4CNFA 3BBDA 3ILKA 4YQIA 4MCDA 4YQ9A 4YVGA 4YQ6A 2O3AA 4H3ZA 4YPZA 4YPXA 4PZKA 4YQPA 4L69A 4MCCA 3BBEA 5CO4A 4YQAA 1NXZA 1VHYA 4YQBA 1VHKA 3NK7A 2CX8A 4YVIA 1O6DA 3KY7A 4YQOA 4YQ3A 4KDZA 3KTYA 3ONPA 3GYQA 3KW2A 3L8UA 3E5YA 4YVKA 4JAKA 4YQTA 1MXIA 4X3MA 4CNDA 2V3JA 4YQ2A 4XBOA 3AI9X 2V3KA 1OY5A 2I6DA 3OIJA 5GM8A 4YQLA 3NK6A 4J3CA 5GMCA 5FAIA 4CNGA 1Z85A 3IC6A 4YQ8A 1GZ0A 3DCMX 4IG6A 1V6ZA 4YVHA 4YQ0A 1VH0A 5GMBA 4FMWA 1ZJRA 5D9FA 4YQGA 1J85A 4FAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMM A;  4YQN A;  3IEF A;  1NS5 A;  1IPA A;  4MCB A;  3AXZ A;  2YY8 A;  3QUV A;  4H3Y A;  1K3R A;  4YQ7 A;  3OII A;  3O7B A;  2Z0Y A;  4KGN A;  4YQR A;  1UAJ A;  4YQJ A;  2EGW A;  1UAL A;  1X7P A;  4YQC A;  1TO0 A;  1P9P A;  3AIA A;  4YQ1 A;  4E8B A;  4YQK A;  3BBH A;  1V2X A;  1UAM A;  3N4J A;  4YPY A;  4RG1 A;  4JAL A;  3KNU A;  2HA8 A;  4YQ5 A;  4YQS A;  2EGV A;  1UAK A;  3OIN A;  4YPW A;  3N4K A;  4YQQ A;  4YQD A;  4CNE A;  4YVJ A;  4YQ4 A;  2QWV A;  4X3L A;  1X7O A;  4CNF A;  3BBD A;  3ILK A;  4YQI A;  4MCD A;  4YQ9 A;  4YVG A;  4YQ6 A;  2O3A A;  4H3Z A;  4YPZ A;  4YPX A;  4PZK A;  4YQP A;  4L69 A;  4MCC A;  3BBE A;  5CO4 A;  4YQA A;  1NXZ A;  1VHY A;  4YQB A;  1VHK A;  3NK7 A;  2CX8 A;  4YVI A;  1O6D A;  3KY7 A;  4YQO A;  4YQ3 A;  4KDZ A;  3KTY A;  3ONP A;  3GYQ A;  3KW2 A;  3L8U A;  3E5Y A;  4YVK A;  4JAK A;  4YQT A;  1MXI A;  4X3M A;  4CND A;  2V3J A;  4YQ2 A;  4XBO A;  3AI9 X;  2V3K A;  1OY5 A;  2I6D A;  3OIJ A;  5GM8 A;  4YQL A;  3NK6 A;  4J3C A;  5GMC A;  5FAI A;  4CNG A;  1Z85 A;  3IC6 A;  4YQ8 A;  1GZ0 A;  3DCM X;  4IG6 A;  1V6Z A;  4YVH A;  4YQ0 A;  1VH0 A;  5GMB A;  5D9F A;  1ZJR A;  4YQG A;  1J85 A;  4FAK A; 
#chains in the Genus database with same CATH topology
 2QMM A;  4YQN A;  3IEF A;  1NS5 A;  1IPA A;  4MCB A;  3AXZ A;  2YY8 A;  3QUV A;  4H3Y A;  4JWG A;  1K3R A;  4YQ7 A;  3OII A;  3O7B A;  2Z0Y A;  4KGN A;  4YQR A;  1UAJ A;  4YQJ A;  4JWH A;  2EGW A;  1UAL A;  1X7P A;  4YQC A;  1TO0 A;  1P9P A;  3AIA A;  4YQ1 A;  4E8B A;  4JWF A;  4JWJ A;  4YQK A;  3BBH A;  1V2X A;  1UAM A;  3N4J A;  4YPY A;  4RG1 A;  4JAL A;  3KNU A;  2HA8 A;  4YQ5 A;  4YQS A;  2EGV A;  1UAK A;  3OIN A;  4YPW A;  3N4K A;  4YQQ A;  4YQD A;  4CNE A;  4YVJ A;  4YQ4 A;  2QWV A;  4X3L A;  1X7O A;  4CNF A;  3BBD A;  3ILK A;  4YQI A;  4MCD A;  4YQ9 A;  4YVG A;  4YQ6 A;  2O3A A;  4H3Z A;  4YPZ A;  4YPX A;  4PZK A;  4YQP A;  4L69 A;  4MCC A;  3BBE A;  5CO4 A;  4YQA A;  1NXZ A;  1VHY A;  4YQB A;  1VHK A;  3NK7 A;  2CX8 A;  4YVI A;  1O6D A;  3KY7 A;  4YQO A;  4YQ3 A;  4KDZ A;  3KTY A;  3ONP A;  3GYQ A;  3KW2 A;  3L8U A;  3E5Y A;  4YVK A;  4JAK A;  4YQT A;  1MXI A;  4X3M A;  4CND A;  2V3J A;  4YQ2 A;  4XBO A;  3AI9 X;  2V3K A;  1OY5 A;  2I6D A;  3OIJ A;  5GM8 A;  4YQL A;  3NK6 A;  4J3C A;  5GMC A;  5FAI A;  4CNG A;  1Z85 A;  3IC6 A;  4YQ8 A;  1GZ0 A;  3DCM X;  4IG6 A;  1V6Z A;  4YVH A;  4YQ0 A;  1VH0 A;  5GMB A;  4FMW A;  1ZJR A;  5D9F A;  4YQG A;  1J85 A;  4FAK A; 
#chains in the Genus database with same CATH homology
 2QMM A;  4YQN A;  3IEF A;  1NS5 A;  1IPA A;  4MCB A;  3AXZ A;  2YY8 A;  3QUV A;  4H3Y A;  4JWG A;  1K3R A;  4YQ7 A;  3OII A;  3O7B A;  2Z0Y A;  4KGN A;  4YQR A;  1UAJ A;  4YQJ A;  4JWH A;  2EGW A;  1UAL A;  1X7P A;  4YQC A;  1TO0 A;  1P9P A;  3AIA A;  4YQ1 A;  4E8B A;  4JWF A;  4JWJ A;  4YQK A;  3BBH A;  1V2X A;  1UAM A;  3N4J A;  4YPY A;  4RG1 A;  4JAL A;  3KNU A;  2HA8 A;  4YQ5 A;  4YQS A;  2EGV A;  1UAK A;  3OIN A;  4YPW A;  3N4K A;  4YQQ A;  4YQD A;  4CNE A;  4YVJ A;  4YQ4 A;  2QWV A;  4X3L A;  1X7O A;  4CNF A;  3BBD A;  3ILK A;  4YQI A;  4MCD A;  4YQ9 A;  4YVG A;  4YQ6 A;  2O3A A;  4H3Z A;  4YPZ A;  4YPX A;  4PZK A;  4YQP A;  4L69 A;  4MCC A;  3BBE A;  5CO4 A;  4YQA A;  1NXZ A;  1VHY A;  4YQB A;  1VHK A;  3NK7 A;  2CX8 A;  4YVI A;  1O6D A;  3KY7 A;  4YQO A;  4YQ3 A;  4KDZ A;  3KTY A;  3ONP A;  3GYQ A;  3KW2 A;  3L8U A;  3E5Y A;  4YVK A;  4JAK A;  4YQT A;  1MXI A;  4X3M A;  4CND A;  2V3J A;  4YQ2 A;  4XBO A;  3AI9 X;  2V3K A;  1OY5 A;  2I6D A;  3OIJ A;  5GM8 A;  4YQL A;  3NK6 A;  4J3C A;  5GMC A;  5FAI A;  4CNG A;  1Z85 A;  3IC6 A;  4YQ8 A;  1GZ0 A;  3DCM X;  4IG6 A;  1V6Z A;  4YVH A;  4YQ0 A;  1VH0 A;  5GMB A;  4FMW A;  1ZJR A;  5D9F A;  4YQG A;  1J85 A;  4FAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...