1TO0A

X-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
Knots found
sequence length
157
structure length
148
Chain Sequence
MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKMKIIKDKEGDRILSKISPDAHVIALAIEGKMKTSEELADTIDKLATYGKSKVTFVIGGSLGLSDTVMKRADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0247 protein yyda
publication title X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 41
structure length 148
sequence length 157
chains with identical sequence B, C, D, E, F, G, H
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1to0A00
4YVHA 4J3CA 3ONPA 3KW2A 4JALA 4YQKA 2V3JA 4RG1A 4MCBA 3AIAA 3GYQA 4PZKA 1GZ0A 3KY7A 3N4KA 4YQSA 4YPXA 4KGNA 4YQDA 4YQ4A 3DCMX 4YQCA 3O7BA 4H3ZA 4E8BA 3L8UA 3AI9X 4H3YA 5CO4A 1O6DA 4YQ0A 4YQOA 1VHYA 3N4JA 2CX8A 1UAMA 4YPYA 3KTYA 3NK7A 2QMMA 1V6ZA 4YQQA 4JAKA 1ZJRA 3BBEA 4X3LA 1VH0A 3OIJA 4YVGA 4X3MA 4YPZA 3E5YA 4YQIA 4CNDA 1TO0A 2HA8A 4YQRA 3IEFA 4YQGA 3AXZA 2O3AA 3OINA 4YQLA 4CNEA 4YQ8A 4YQ7A 3ILKA 4YVKA 4YVIA 4YQ1A 1NS5A 3QUVA 4YQ6A 5FAIA 4YQJA 1X7PA 4MCCA 4YQ9A 4YQAA 2EGWA 4L69A 4YVJA 2I6DA 4YQ3A 1UALA 4YPWA 1VHKA 4FAKA 1MXIA 4YQ2A 4XBOA 1OY5A 5D9FA 1J85A 1UAJA 4YQTA 1K3RA 2QWVA 2EGVA 5GMBA 3BBHA 3OIIA 1IPAA 3IC6A 4YQ5A 2Z0YA 1NXZA 5GMCA 5GM8A 1Z85A 2V3KA 3BBDA 1V2XA 4IG6A 1P9PA 4CNGA 4YQPA 4YQNA 4KDZA 1UAKA 4YQBA 4CNFA 3NK6A 2YY8A 3KNUA 4MCDA 1X7OA
chains in the Genus database with same CATH superfamily
4YVHA 4J3CA 3ONPA 3KW2A 4JALA 4JWJA 4YQKA 2V3JA 4RG1A 4MCBA 3AIAA 3GYQA 4PZKA 1GZ0A 3KY7A 3N4KA 4YQSA 4YPXA 4KGNA 4YQDA 4YQ4A 3DCMX 4YQCA 3O7BA 4H3ZA 4E8BA 3L8UA 3AI9X 4H3YA 5CO4A 1O6DA 4YQ0A 4YQOA 1VHYA 3N4JA 2CX8A 1UAMA 4YPYA 3KTYA 3NK7A 2QMMA 1V6ZA 4YQQA 4JAKA 1ZJRA 3BBEA 4X3LA 1VH0A 4FMWA 3OIJA 4YVGA 4X3MA 4YPZA 3E5YA 4YQIA 4CNDA 1TO0A 2HA8A 4YQRA 3IEFA 4YQGA 3AXZA 2O3AA 3OINA 4YQLA 4CNEA 4YQ8A 4YQ7A 3ILKA 4JWHA 4YVKA 4YVIA 4YQ1A 1NS5A 3QUVA 4YQ6A 5FAIA 4YQJA 1X7PA 4JWGA 4MCCA 4YQ9A 4YQAA 2EGWA 4L69A 4YVJA 2I6DA 4YQ3A 1UALA 4YPWA 1VHKA 4FAKA 1MXIA 4YQ2A 4XBOA 1OY5A 5D9FA 1J85A 1UAJA 4YQTA 1K3RA 2QWVA 2EGVA 5GMBA 3BBHA 3OIIA 1IPAA 3IC6A 4YQ5A 2Z0YA 1NXZA 5GMCA 5GM8A 4JWFA 1Z85A 2V3KA 3BBDA 1V2XA 4IG6A 1P9PA 4CNGA 4YQPA 4YQNA 4KDZA 1UAKA 4YQBA 4CNFA 3NK6A 2YY8A 3KNUA 4MCDA 1X7OA
chains in the Genus database with same CATH topology
4YVHA 4J3CA 3ONPA 3KW2A 4JALA 4JWJA 4YQKA 2V3JA 4RG1A 4MCBA 3AIAA 3GYQA 4PZKA 1GZ0A 3KY7A 3N4KA 4YQSA 4YPXA 4KGNA 4YQDA 4YQ4A 3DCMX 4YQCA 3O7BA 4H3ZA 4E8BA 3L8UA 3AI9X 4H3YA 5CO4A 1O6DA 4YQ0A 4YQOA 1VHYA 3N4JA 2CX8A 1UAMA 4YPYA 3KTYA 3NK7A 2QMMA 1V6ZA 4YQQA 4JAKA 1ZJRA 3BBEA 4X3LA 1VH0A 4FMWA 3OIJA 4YVGA 4X3MA 4YPZA 3E5YA 4YQIA 4CNDA 1TO0A 2HA8A 4YQRA 3IEFA 4YQGA 3AXZA 2O3AA 3OINA 4YQLA 4CNEA 4YQ8A 4YQ7A 3ILKA 4JWHA 4YVKA 4YVIA 4YQ1A 1NS5A 3QUVA 4YQ6A 5FAIA 4YQJA 1X7PA 4JWGA 4MCCA 4YQ9A 4YQAA 2EGWA 4L69A 4YVJA 2I6DA 4YQ3A 1UALA 4YPWA 1VHKA 4FAKA 1MXIA 4YQ2A 4XBOA 1OY5A 5D9FA 1J85A 1UAJA 4YQTA 1K3RA 2QWVA 2EGVA 5GMBA 3BBHA 3OIIA 1IPAA 3IC6A 4YQ5A 2Z0YA 1NXZA 5GMCA 5GM8A 4JWFA 1Z85A 2V3KA 3BBDA 1V2XA 4IG6A 1P9PA 4CNGA 4YQPA 4YQNA 4KDZA 1UAKA 4YQBA 4CNFA 3NK6A 2YY8A 3KNUA 4MCDA 1X7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVH A;  4J3C A;  3ONP A;  3KW2 A;  4JAL A;  4YQK A;  2V3J A;  4RG1 A;  4MCB A;  3AIA A;  3GYQ A;  4PZK A;  1GZ0 A;  3KY7 A;  3N4K A;  4YQS A;  4YPX A;  4KGN A;  4YQD A;  4YQ4 A;  3DCM X;  4YQC A;  3O7B A;  4H3Z A;  4E8B A;  3L8U A;  3AI9 X;  4H3Y A;  5CO4 A;  1O6D A;  4YQ0 A;  4YQO A;  1VHY A;  3N4J A;  2CX8 A;  1UAM A;  4YPY A;  3KTY A;  3NK7 A;  2QMM A;  1V6Z A;  4YQQ A;  4JAK A;  1ZJR A;  3BBE A;  4X3L A;  1VH0 A;  3OIJ A;  4YVG A;  4X3M A;  4YPZ A;  3E5Y A;  4YQI A;  4CND A;  1TO0 A;  2HA8 A;  4YQR A;  3IEF A;  4YQG A;  3AXZ A;  2O3A A;  3OIN A;  4YQL A;  4CNE A;  4YQ8 A;  4YQ7 A;  3ILK A;  4YVK A;  4YVI A;  4YQ1 A;  1NS5 A;  3QUV A;  4YQ6 A;  5FAI A;  4YQJ A;  1X7P A;  4MCC A;  4YQ9 A;  4YQA A;  2EGW A;  4L69 A;  4YVJ A;  2I6D A;  4YQ3 A;  1UAL A;  4YPW A;  1VHK A;  4FAK A;  1MXI A;  4YQ2 A;  4XBO A;  1OY5 A;  5D9F A;  1J85 A;  1UAJ A;  4YQT A;  1K3R A;  2QWV A;  2EGV A;  5GMB A;  3BBH A;  3OII A;  1IPA A;  3IC6 A;  4YQ5 A;  2Z0Y A;  1NXZ A;  5GMC A;  5GM8 A;  1Z85 A;  2V3K A;  3BBD A;  1V2X A;  4IG6 A;  1P9P A;  4CNG A;  4YQP A;  4YQN A;  4KDZ A;  1UAK A;  4YQB A;  4CNF A;  3NK6 A;  2YY8 A;  3KNU A;  4MCD A;  1X7O A; 
#chains in the Genus database with same CATH topology
 4YVH A;  4J3C A;  3ONP A;  3KW2 A;  4JAL A;  4JWJ A;  4YQK A;  2V3J A;  4RG1 A;  4MCB A;  3AIA A;  3GYQ A;  4PZK A;  1GZ0 A;  3KY7 A;  3N4K A;  4YQS A;  4YPX A;  4KGN A;  4YQD A;  4YQ4 A;  3DCM X;  4YQC A;  3O7B A;  4H3Z A;  4E8B A;  3L8U A;  3AI9 X;  4H3Y A;  5CO4 A;  1O6D A;  4YQ0 A;  4YQO A;  1VHY A;  3N4J A;  2CX8 A;  1UAM A;  4YPY A;  3KTY A;  3NK7 A;  2QMM A;  1V6Z A;  4YQQ A;  4JAK A;  1ZJR A;  3BBE A;  4X3L A;  1VH0 A;  4FMW A;  3OIJ A;  4YVG A;  4X3M A;  4YPZ A;  3E5Y A;  4YQI A;  4CND A;  1TO0 A;  2HA8 A;  4YQR A;  3IEF A;  4YQG A;  3AXZ A;  2O3A A;  3OIN A;  4YQL A;  4CNE A;  4YQ8 A;  4YQ7 A;  3ILK A;  4JWH A;  4YVK A;  4YVI A;  4YQ1 A;  1NS5 A;  3QUV A;  4YQ6 A;  5FAI A;  4YQJ A;  1X7P A;  4JWG A;  4MCC A;  4YQ9 A;  4YQA A;  2EGW A;  4L69 A;  4YVJ A;  2I6D A;  4YQ3 A;  1UAL A;  4YPW A;  1VHK A;  4FAK A;  1MXI A;  4YQ2 A;  4XBO A;  1OY5 A;  5D9F A;  1J85 A;  1UAJ A;  4YQT A;  1K3R A;  2QWV A;  2EGV A;  5GMB A;  3BBH A;  3OII A;  1IPA A;  3IC6 A;  4YQ5 A;  2Z0Y A;  1NXZ A;  5GMC A;  5GM8 A;  4JWF A;  1Z85 A;  2V3K A;  3BBD A;  1V2X A;  4IG6 A;  1P9P A;  4CNG A;  4YQP A;  4YQN A;  4KDZ A;  1UAK A;  4YQB A;  4CNF A;  3NK6 A;  2YY8 A;  3KNU A;  4MCD A;  1X7O A; 
#chains in the Genus database with same CATH homology
 4YVH A;  4J3C A;  3ONP A;  3KW2 A;  4JAL A;  4JWJ A;  4YQK A;  2V3J A;  4RG1 A;  4MCB A;  3AIA A;  3GYQ A;  4PZK A;  1GZ0 A;  3KY7 A;  3N4K A;  4YQS A;  4YPX A;  4KGN A;  4YQD A;  4YQ4 A;  3DCM X;  4YQC A;  3O7B A;  4H3Z A;  4E8B A;  3L8U A;  3AI9 X;  4H3Y A;  5CO4 A;  1O6D A;  4YQ0 A;  4YQO A;  1VHY A;  3N4J A;  2CX8 A;  1UAM A;  4YPY A;  3KTY A;  3NK7 A;  2QMM A;  1V6Z A;  4YQQ A;  4JAK A;  1ZJR A;  3BBE A;  4X3L A;  1VH0 A;  4FMW A;  3OIJ A;  4YVG A;  4X3M A;  4YPZ A;  3E5Y A;  4YQI A;  4CND A;  1TO0 A;  2HA8 A;  4YQR A;  3IEF A;  4YQG A;  3AXZ A;  2O3A A;  3OIN A;  4YQL A;  4CNE A;  4YQ8 A;  4YQ7 A;  3ILK A;  4JWH A;  4YVK A;  4YVI A;  4YQ1 A;  1NS5 A;  3QUV A;  4YQ6 A;  5FAI A;  4YQJ A;  1X7P A;  4JWG A;  4MCC A;  4YQ9 A;  4YQA A;  2EGW A;  4L69 A;  4YVJ A;  2I6D A;  4YQ3 A;  1UAL A;  4YPW A;  1VHK A;  4FAK A;  1MXI A;  4YQ2 A;  4XBO A;  1OY5 A;  5D9F A;  1J85 A;  1UAJ A;  4YQT A;  1K3R A;  2QWV A;  2EGV A;  5GMB A;  3BBH A;  3OII A;  1IPA A;  3IC6 A;  4YQ5 A;  2Z0Y A;  1NXZ A;  5GMC A;  5GM8 A;  4JWF A;  1Z85 A;  2V3K A;  3BBD A;  1V2X A;  4IG6 A;  1P9P A;  4CNG A;  4YQP A;  4YQN A;  4KDZ A;  1UAK A;  4YQB A;  4CNF A;  3NK6 A;  2YY8 A;  3KNU A;  4MCD A;  1X7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...