1VH0A

Crystal structure of a hypothetical protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
Knots found
sequence length
157
structure length
157
Chain Sequence
LKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0247 protein SAV0024/SA0023
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural genomics, unknown function
total genus 54
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vh0A00
4MCBA 3OIJA 4YQAA 1Z85A 4CNDA 4YQ6A 3KTYA 2QWVA 4L69A 1UAMA 3BBDA 4YQ8A 4PZKA 1VHKA 4X3LA 4YVIA 4YPYA 1MXIA 1NXZA 3AI9X 4MCCA 1IPAA 1P9PA 4YQCA 4KGNA 5GMCA 4YQGA 3L8UA 4YQJA 1J85A 1V2XA 4YQOA 5GMBA 3BBHA 3BBEA 1ZJRA 3KNUA 4YQ4A 2YY8A 3NK7A 3KY7A 4YQDA 5GM8A 4YQBA 5D9FA 4YQ0A 4CNGA 1UALA 4MCDA 4X3MA 1VHYA 3N4KA 4YVJA 3IC6A 3IEFA 3OINA 4YVKA 3AIAA 1VH0A 1V6ZA 1X7OA 4YQ3A 2HA8A 4FAKA 4YQ5A 1X7PA 4YVHA 1GZ0A 4YQKA 4YQ7A 2CX8A 2O3AA 1K3RA 4YPZA 4E8BA 2I6DA 3AXZA 4YQRA 3NK6A 4YQTA 4CNFA 4YQPA 4YPXA 1UAJA 5FAIA 4YQLA 4YQSA 4XBOA 4CNEA 3N4JA 3GYQA 3DCMX 2QMMA 2V3JA 1OY5A 3ONPA 3QUVA 4H3ZA 1NS5A 1UAKA 4YQ9A 4KDZA 4H3YA 4IG6A 2V3KA 3O7BA 3E5YA 1O6DA 4JALA 4YQ2A 2EGVA 2EGWA 4JAKA 3KW2A 5CO4A 4YQ1A 4RG1A 1TO0A 4J3CA 3ILKA 4YQQA 2Z0YA 4YQNA 4YPWA 4YVGA 4YQIA 3OIIA
chains in the Genus database with same CATH superfamily
4MCBA 3OIJA 4YQAA 1Z85A 4CNDA 4YQ6A 3KTYA 2QWVA 4L69A 1UAMA 3BBDA 4YQ8A 4PZKA 1VHKA 4X3LA 4YVIA 4YPYA 1MXIA 1NXZA 3AI9X 4MCCA 1IPAA 1P9PA 4YQCA 4KGNA 5GMCA 4YQGA 3L8UA 4YQJA 1J85A 1V2XA 4YQOA 5GMBA 3BBHA 3BBEA 1ZJRA 3KNUA 4JWFA 4YQ4A 2YY8A 3NK7A 3KY7A 4YQDA 5GM8A 4YQBA 5D9FA 4YQ0A 4CNGA 1UALA 4JWJA 4MCDA 4X3MA 1VHYA 3N4KA 4JWGA 4YVJA 3IC6A 3IEFA 3OINA 4YVKA 3AIAA 1VH0A 1V6ZA 1X7OA 4YQ3A 2HA8A 4FAKA 4YQ5A 1X7PA 4YVHA 1GZ0A 4YQKA 4YQ7A 2CX8A 2O3AA 1K3RA 4YPZA 4E8BA 2I6DA 3AXZA 4YQRA 3NK6A 4YQTA 4CNFA 4YQPA 4YPXA 1UAJA 5FAIA 4YQLA 4YQSA 4XBOA 4CNEA 3N4JA 3GYQA 3DCMX 2QMMA 2V3JA 1OY5A 3ONPA 3QUVA 4H3ZA 1NS5A 1UAKA 4YQ9A 4KDZA 4H3YA 4IG6A 2V3KA 3O7BA 3E5YA 1O6DA 4JALA 4YQ2A 2EGVA 2EGWA 4JAKA 3KW2A 5CO4A 4YQ1A 4JWHA 4RG1A 1TO0A 4J3CA 3ILKA 4YQQA 4FMWA 2Z0YA 4YQNA 4YPWA 4YVGA 4YQIA 3OIIA
chains in the Genus database with same CATH topology
4MCBA 3OIJA 4YQAA 1Z85A 4CNDA 4YQ6A 3KTYA 2QWVA 4L69A 1UAMA 3BBDA 4YQ8A 4PZKA 1VHKA 4X3LA 4YVIA 4YPYA 1MXIA 1NXZA 3AI9X 4MCCA 1IPAA 1P9PA 4YQCA 4KGNA 5GMCA 4YQGA 3L8UA 4YQJA 1J85A 1V2XA 4YQOA 5GMBA 3BBHA 3BBEA 1ZJRA 3KNUA 4JWFA 4YQ4A 2YY8A 3NK7A 3KY7A 4YQDA 5GM8A 4YQBA 5D9FA 4YQ0A 4CNGA 1UALA 4JWJA 4MCDA 4X3MA 1VHYA 3N4KA 4JWGA 4YVJA 3IC6A 3IEFA 3OINA 4YVKA 3AIAA 1VH0A 1V6ZA 1X7OA 4YQ3A 2HA8A 4FAKA 4YQ5A 1X7PA 4YVHA 1GZ0A 4YQKA 4YQ7A 2CX8A 2O3AA 1K3RA 4YPZA 4E8BA 2I6DA 3AXZA 4YQRA 3NK6A 4YQTA 4CNFA 4YQPA 4YPXA 1UAJA 5FAIA 4YQLA 4YQSA 4XBOA 4CNEA 3N4JA 3GYQA 3DCMX 2QMMA 2V3JA 1OY5A 3ONPA 3QUVA 4H3ZA 1NS5A 1UAKA 4YQ9A 4KDZA 4H3YA 4IG6A 2V3KA 3O7BA 3E5YA 1O6DA 4JALA 4YQ2A 2EGVA 2EGWA 4JAKA 3KW2A 5CO4A 4YQ1A 4JWHA 4RG1A 1TO0A 4J3CA 3ILKA 4YQQA 4FMWA 2Z0YA 4YQNA 4YPWA 4YVGA 4YQIA 3OIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCB A;  3OIJ A;  4YQA A;  1Z85 A;  4CND A;  4YQ6 A;  3KTY A;  2QWV A;  4L69 A;  1UAM A;  3BBD A;  4YQ8 A;  4PZK A;  1VHK A;  4X3L A;  4YVI A;  4YPY A;  1MXI A;  1NXZ A;  3AI9 X;  4MCC A;  1IPA A;  1P9P A;  4YQC A;  4KGN A;  5GMC A;  4YQG A;  3L8U A;  4YQJ A;  1J85 A;  1V2X A;  4YQO A;  5GMB A;  3BBH A;  3BBE A;  1ZJR A;  3KNU A;  4YQ4 A;  2YY8 A;  3NK7 A;  3KY7 A;  4YQD A;  5GM8 A;  4YQB A;  5D9F A;  4YQ0 A;  4CNG A;  1UAL A;  4MCD A;  4X3M A;  1VHY A;  3N4K A;  4YVJ A;  3IC6 A;  3IEF A;  3OIN A;  4YVK A;  3AIA A;  1VH0 A;  1V6Z A;  1X7O A;  4YQ3 A;  2HA8 A;  4FAK A;  4YQ5 A;  1X7P A;  4YVH A;  1GZ0 A;  4YQK A;  4YQ7 A;  2CX8 A;  2O3A A;  1K3R A;  4YPZ A;  4E8B A;  2I6D A;  3AXZ A;  4YQR A;  3NK6 A;  4YQT A;  4CNF A;  4YQP A;  4YPX A;  1UAJ A;  5FAI A;  4YQL A;  4YQS A;  4XBO A;  4CNE A;  3N4J A;  3GYQ A;  3DCM X;  2QMM A;  2V3J A;  1OY5 A;  3ONP A;  3QUV A;  4H3Z A;  1NS5 A;  1UAK A;  4YQ9 A;  4KDZ A;  4H3Y A;  4IG6 A;  2V3K A;  3O7B A;  3E5Y A;  1O6D A;  4JAL A;  4YQ2 A;  2EGV A;  2EGW A;  4JAK A;  3KW2 A;  5CO4 A;  4YQ1 A;  4RG1 A;  1TO0 A;  4J3C A;  3ILK A;  4YQQ A;  2Z0Y A;  4YQN A;  4YPW A;  4YVG A;  4YQI A;  3OII A; 
#chains in the Genus database with same CATH topology
 4MCB A;  3OIJ A;  4YQA A;  1Z85 A;  4CND A;  4YQ6 A;  3KTY A;  2QWV A;  4L69 A;  1UAM A;  3BBD A;  4YQ8 A;  4PZK A;  1VHK A;  4X3L A;  4YVI A;  4YPY A;  1MXI A;  1NXZ A;  3AI9 X;  4MCC A;  1IPA A;  1P9P A;  4YQC A;  4KGN A;  5GMC A;  4YQG A;  3L8U A;  4YQJ A;  1J85 A;  1V2X A;  4YQO A;  5GMB A;  3BBH A;  3BBE A;  1ZJR A;  3KNU A;  4JWF A;  4YQ4 A;  2YY8 A;  3NK7 A;  3KY7 A;  4YQD A;  5GM8 A;  4YQB A;  5D9F A;  4YQ0 A;  4CNG A;  1UAL A;  4JWJ A;  4MCD A;  4X3M A;  1VHY A;  3N4K A;  4JWG A;  4YVJ A;  3IC6 A;  3IEF A;  3OIN A;  4YVK A;  3AIA A;  1VH0 A;  1V6Z A;  1X7O A;  4YQ3 A;  2HA8 A;  4FAK A;  4YQ5 A;  1X7P A;  4YVH A;  1GZ0 A;  4YQK A;  4YQ7 A;  2CX8 A;  2O3A A;  1K3R A;  4YPZ A;  4E8B A;  2I6D A;  3AXZ A;  4YQR A;  3NK6 A;  4YQT A;  4CNF A;  4YQP A;  4YPX A;  1UAJ A;  5FAI A;  4YQL A;  4YQS A;  4XBO A;  4CNE A;  3N4J A;  3GYQ A;  3DCM X;  2QMM A;  2V3J A;  1OY5 A;  3ONP A;  3QUV A;  4H3Z A;  1NS5 A;  1UAK A;  4YQ9 A;  4KDZ A;  4H3Y A;  4IG6 A;  2V3K A;  3O7B A;  3E5Y A;  1O6D A;  4JAL A;  4YQ2 A;  2EGV A;  2EGW A;  4JAK A;  3KW2 A;  5CO4 A;  4YQ1 A;  4JWH A;  4RG1 A;  1TO0 A;  4J3C A;  3ILK A;  4YQQ A;  4FMW A;  2Z0Y A;  4YQN A;  4YPW A;  4YVG A;  4YQI A;  3OII A; 
#chains in the Genus database with same CATH homology
 4MCB A;  3OIJ A;  4YQA A;  1Z85 A;  4CND A;  4YQ6 A;  3KTY A;  2QWV A;  4L69 A;  1UAM A;  3BBD A;  4YQ8 A;  4PZK A;  1VHK A;  4X3L A;  4YVI A;  4YPY A;  1MXI A;  1NXZ A;  3AI9 X;  4MCC A;  1IPA A;  1P9P A;  4YQC A;  4KGN A;  5GMC A;  4YQG A;  3L8U A;  4YQJ A;  1J85 A;  1V2X A;  4YQO A;  5GMB A;  3BBH A;  3BBE A;  1ZJR A;  3KNU A;  4JWF A;  4YQ4 A;  2YY8 A;  3NK7 A;  3KY7 A;  4YQD A;  5GM8 A;  4YQB A;  5D9F A;  4YQ0 A;  4CNG A;  1UAL A;  4JWJ A;  4MCD A;  4X3M A;  1VHY A;  3N4K A;  4JWG A;  4YVJ A;  3IC6 A;  3IEF A;  3OIN A;  4YVK A;  3AIA A;  1VH0 A;  1V6Z A;  1X7O A;  4YQ3 A;  2HA8 A;  4FAK A;  4YQ5 A;  1X7P A;  4YVH A;  1GZ0 A;  4YQK A;  4YQ7 A;  2CX8 A;  2O3A A;  1K3R A;  4YPZ A;  4E8B A;  2I6D A;  3AXZ A;  4YQR A;  3NK6 A;  4YQT A;  4CNF A;  4YQP A;  4YPX A;  1UAJ A;  5FAI A;  4YQL A;  4YQS A;  4XBO A;  4CNE A;  3N4J A;  3GYQ A;  3DCM X;  2QMM A;  2V3J A;  1OY5 A;  3ONP A;  3QUV A;  4H3Z A;  1NS5 A;  1UAK A;  4YQ9 A;  4KDZ A;  4H3Y A;  4IG6 A;  2V3K A;  3O7B A;  3E5Y A;  1O6D A;  4JAL A;  4YQ2 A;  2EGV A;  2EGW A;  4JAK A;  3KW2 A;  5CO4 A;  4YQ1 A;  4JWH A;  4RG1 A;  1TO0 A;  4J3C A;  3ILK A;  4YQQ A;  4FMW A;  2Z0Y A;  4YQN A;  4YPW A;  4YVG A;  4YQI A;  3OII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...