1VH0A

Crystal structure of a hypothetical protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
Knots found
sequence length
157
structure length
157
Chain Sequence
LKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0247 protein SAV0024/SA0023
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 54
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2003-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vh0A00
4YQBA 1GZ0A 4RG1A 4YQ2A 4YQ9A 3BBHA 3DCMX 4X3MA 1UAMA 4YVIA 1VHKA 1UAJA 4YPXA 4YQAA 4IG6A 4YQ6A 4YPZA 1IPAA 4KDZA 4YQDA 4FAKA 2Z0YA 4YQGA 4YVJA 1VHYA 3BBDA 2QWVA 1UAKA 3OINA 4YQ1A 4X3LA 2EGVA 4YPWA 4YQQA 3AXZA 3L8UA 4YQLA 5D9FA 2QMMA 4CNFA 1UALA 4L69A 5GM8A 3AIAA 3BBEA 1V6ZA 2V3KA 3OIIA 3GYQA 4YQTA 4YQ4A 1MXIA 1K3RA 3ONPA 4YQOA 4E8BA 4YQ7A 4H3YA 4YVHA 4JAKA 4H3ZA 4KGNA 4YQRA 1Z85A 1V2XA 3IC6A 3QUVA 1X7OA 4J3CA 4YQ5A 5CO4A 2V3JA 1NXZA 2O3AA 1P9PA 2I6DA 4XBOA 3ILKA 3N4KA 4YQPA 2HA8A 4JALA 5GMCA 4YQSA 4YPYA 3N4JA 4PZKA 4YQIA 4YQNA 2YY8A 4MCDA 3OIJA 1O6DA 5FAIA 1ZJRA 1TO0A 4YVKA 3KTYA 3IEFA 2EGWA 1VH0A 4YQCA 4YQ8A 3E5YA 4MCCA 4YQJA 3KW2A 1J85A 5GMBA 1NS5A 3KNUA 1X7PA 4YQKA 4CNGA 3KY7A 4YQ3A 4CNEA 2CX8A 3O7BA 4CNDA 4YVGA 3NK6A 3NK7A 1OY5A 4YQ0A 3AI9X 4MCBA
chains in the Genus database with same CATH superfamily
4YQBA 1GZ0A 4RG1A 4YQ2A 4YQ9A 3BBHA 3DCMX 4X3MA 1UAMA 4YVIA 1VHKA 1UAJA 4YPXA 4YQAA 4IG6A 4YQ6A 4YPZA 1IPAA 4KDZA 4YQDA 4FAKA 2Z0YA 4YQGA 4YVJA 4JWGA 1VHYA 3BBDA 2QWVA 1UAKA 3OINA 4YQ1A 4JWFA 4X3LA 2EGVA 4YPWA 4YQQA 3AXZA 3L8UA 4YQLA 5D9FA 2QMMA 4CNFA 1UALA 4L69A 5GM8A 3AIAA 3BBEA 1V6ZA 2V3KA 3OIIA 3GYQA 4YQTA 4YQ4A 1MXIA 1K3RA 3ONPA 4YQOA 4E8BA 4YQ7A 4H3YA 4YVHA 4JAKA 4H3ZA 4JWJA 4KGNA 4YQRA 1Z85A 1V2XA 3IC6A 3QUVA 1X7OA 4J3CA 4YQ5A 5CO4A 2V3JA 1NXZA 2O3AA 1P9PA 2I6DA 4XBOA 3ILKA 3N4KA 4YQPA 2HA8A 4JALA 5GMCA 4YQSA 4YPYA 3N4JA 4PZKA 4YQIA 4YQNA 2YY8A 4MCDA 3OIJA 1O6DA 5FAIA 1ZJRA 1TO0A 4YVKA 3KTYA 3IEFA 2EGWA 1VH0A 4JWHA 4YQCA 4YQ8A 3E5YA 4MCCA 4YQJA 3KW2A 1J85A 5GMBA 1NS5A 3KNUA 1X7PA 4YQKA 4CNGA 3KY7A 4FMWA 4YQ3A 4CNEA 2CX8A 3O7BA 4CNDA 4YVGA 3NK6A 3NK7A 1OY5A 4YQ0A 3AI9X 4MCBA
chains in the Genus database with same CATH topology
4YQBA 1GZ0A 4RG1A 4YQ2A 4YQ9A 3BBHA 3DCMX 4X3MA 1UAMA 4YVIA 1VHKA 1UAJA 4YPXA 4YQAA 4IG6A 4YQ6A 4YPZA 1IPAA 4KDZA 4YQDA 4FAKA 2Z0YA 4YQGA 4YVJA 4JWGA 1VHYA 3BBDA 2QWVA 1UAKA 3OINA 4YQ1A 4JWFA 4X3LA 2EGVA 4YPWA 4YQQA 3AXZA 3L8UA 4YQLA 5D9FA 2QMMA 4CNFA 1UALA 4L69A 5GM8A 3AIAA 3BBEA 1V6ZA 2V3KA 3OIIA 3GYQA 4YQTA 4YQ4A 1MXIA 1K3RA 3ONPA 4YQOA 4E8BA 4YQ7A 4H3YA 4YVHA 4JAKA 4H3ZA 4JWJA 4KGNA 4YQRA 1Z85A 1V2XA 3IC6A 3QUVA 1X7OA 4J3CA 4YQ5A 5CO4A 2V3JA 1NXZA 2O3AA 1P9PA 2I6DA 4XBOA 3ILKA 3N4KA 4YQPA 2HA8A 4JALA 5GMCA 4YQSA 4YPYA 3N4JA 4PZKA 4YQIA 4YQNA 2YY8A 4MCDA 3OIJA 1O6DA 5FAIA 1ZJRA 1TO0A 4YVKA 3KTYA 3IEFA 2EGWA 1VH0A 4JWHA 4YQCA 4YQ8A 3E5YA 4MCCA 4YQJA 3KW2A 1J85A 5GMBA 1NS5A 3KNUA 1X7PA 4YQKA 4CNGA 3KY7A 4FMWA 4YQ3A 4CNEA 2CX8A 3O7BA 4CNDA 4YVGA 3NK6A 3NK7A 1OY5A 4YQ0A 3AI9X 4MCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQB A;  1GZ0 A;  4RG1 A;  4YQ2 A;  4YQ9 A;  3BBH A;  3DCM X;  4X3M A;  1UAM A;  4YVI A;  1VHK A;  1UAJ A;  4YPX A;  4YQA A;  4IG6 A;  4YQ6 A;  4YPZ A;  1IPA A;  4KDZ A;  4YQD A;  4FAK A;  2Z0Y A;  4YQG A;  4YVJ A;  1VHY A;  3BBD A;  2QWV A;  1UAK A;  3OIN A;  4YQ1 A;  4X3L A;  2EGV A;  4YPW A;  4YQQ A;  3AXZ A;  3L8U A;  4YQL A;  5D9F A;  2QMM A;  4CNF A;  1UAL A;  4L69 A;  5GM8 A;  3AIA A;  3BBE A;  1V6Z A;  2V3K A;  3OII A;  3GYQ A;  4YQT A;  4YQ4 A;  1MXI A;  1K3R A;  3ONP A;  4YQO A;  4E8B A;  4YQ7 A;  4H3Y A;  4YVH A;  4JAK A;  4H3Z A;  4KGN A;  4YQR A;  1Z85 A;  1V2X A;  3IC6 A;  3QUV A;  1X7O A;  4J3C A;  4YQ5 A;  5CO4 A;  2V3J A;  1NXZ A;  2O3A A;  1P9P A;  2I6D A;  4XBO A;  3ILK A;  3N4K A;  4YQP A;  2HA8 A;  4JAL A;  5GMC A;  4YQS A;  4YPY A;  3N4J A;  4PZK A;  4YQI A;  4YQN A;  2YY8 A;  4MCD A;  3OIJ A;  1O6D A;  5FAI A;  1ZJR A;  1TO0 A;  4YVK A;  3KTY A;  3IEF A;  2EGW A;  1VH0 A;  4YQC A;  4YQ8 A;  3E5Y A;  4MCC A;  4YQJ A;  3KW2 A;  1J85 A;  5GMB A;  1NS5 A;  3KNU A;  1X7P A;  4YQK A;  4CNG A;  3KY7 A;  4YQ3 A;  4CNE A;  2CX8 A;  3O7B A;  4CND A;  4YVG A;  3NK6 A;  3NK7 A;  1OY5 A;  4YQ0 A;  3AI9 X;  4MCB A; 
#chains in the Genus database with same CATH topology
 4YQB A;  1GZ0 A;  4RG1 A;  4YQ2 A;  4YQ9 A;  3BBH A;  3DCM X;  4X3M A;  1UAM A;  4YVI A;  1VHK A;  1UAJ A;  4YPX A;  4YQA A;  4IG6 A;  4YQ6 A;  4YPZ A;  1IPA A;  4KDZ A;  4YQD A;  4FAK A;  2Z0Y A;  4YQG A;  4YVJ A;  4JWG A;  1VHY A;  3BBD A;  2QWV A;  1UAK A;  3OIN A;  4YQ1 A;  4JWF A;  4X3L A;  2EGV A;  4YPW A;  4YQQ A;  3AXZ A;  3L8U A;  4YQL A;  5D9F A;  2QMM A;  4CNF A;  1UAL A;  4L69 A;  5GM8 A;  3AIA A;  3BBE A;  1V6Z A;  2V3K A;  3OII A;  3GYQ A;  4YQT A;  4YQ4 A;  1MXI A;  1K3R A;  3ONP A;  4YQO A;  4E8B A;  4YQ7 A;  4H3Y A;  4YVH A;  4JAK A;  4H3Z A;  4JWJ A;  4KGN A;  4YQR A;  1Z85 A;  1V2X A;  3IC6 A;  3QUV A;  1X7O A;  4J3C A;  4YQ5 A;  5CO4 A;  2V3J A;  1NXZ A;  2O3A A;  1P9P A;  2I6D A;  4XBO A;  3ILK A;  3N4K A;  4YQP A;  2HA8 A;  4JAL A;  5GMC A;  4YQS A;  4YPY A;  3N4J A;  4PZK A;  4YQI A;  4YQN A;  2YY8 A;  4MCD A;  3OIJ A;  1O6D A;  5FAI A;  1ZJR A;  1TO0 A;  4YVK A;  3KTY A;  3IEF A;  2EGW A;  1VH0 A;  4JWH A;  4YQC A;  4YQ8 A;  3E5Y A;  4MCC A;  4YQJ A;  3KW2 A;  1J85 A;  5GMB A;  1NS5 A;  3KNU A;  1X7P A;  4YQK A;  4CNG A;  3KY7 A;  4FMW A;  4YQ3 A;  4CNE A;  2CX8 A;  3O7B A;  4CND A;  4YVG A;  3NK6 A;  3NK7 A;  1OY5 A;  4YQ0 A;  3AI9 X;  4MCB A; 
#chains in the Genus database with same CATH homology
 4YQB A;  1GZ0 A;  4RG1 A;  4YQ2 A;  4YQ9 A;  3BBH A;  3DCM X;  4X3M A;  1UAM A;  4YVI A;  1VHK A;  1UAJ A;  4YPX A;  4YQA A;  4IG6 A;  4YQ6 A;  4YPZ A;  1IPA A;  4KDZ A;  4YQD A;  4FAK A;  2Z0Y A;  4YQG A;  4YVJ A;  4JWG A;  1VHY A;  3BBD A;  2QWV A;  1UAK A;  3OIN A;  4YQ1 A;  4JWF A;  4X3L A;  2EGV A;  4YPW A;  4YQQ A;  3AXZ A;  3L8U A;  4YQL A;  5D9F A;  2QMM A;  4CNF A;  1UAL A;  4L69 A;  5GM8 A;  3AIA A;  3BBE A;  1V6Z A;  2V3K A;  3OII A;  3GYQ A;  4YQT A;  4YQ4 A;  1MXI A;  1K3R A;  3ONP A;  4YQO A;  4E8B A;  4YQ7 A;  4H3Y A;  4YVH A;  4JAK A;  4H3Z A;  4JWJ A;  4KGN A;  4YQR A;  1Z85 A;  1V2X A;  3IC6 A;  3QUV A;  1X7O A;  4J3C A;  4YQ5 A;  5CO4 A;  2V3J A;  1NXZ A;  2O3A A;  1P9P A;  2I6D A;  4XBO A;  3ILK A;  3N4K A;  4YQP A;  2HA8 A;  4JAL A;  5GMC A;  4YQS A;  4YPY A;  3N4J A;  4PZK A;  4YQI A;  4YQN A;  2YY8 A;  4MCD A;  3OIJ A;  1O6D A;  5FAI A;  1ZJR A;  1TO0 A;  4YVK A;  3KTY A;  3IEF A;  2EGW A;  1VH0 A;  4JWH A;  4YQC A;  4YQ8 A;  3E5Y A;  4MCC A;  4YQJ A;  3KW2 A;  1J85 A;  5GMB A;  1NS5 A;  3KNU A;  1X7P A;  4YQK A;  4CNG A;  3KY7 A;  4FMW A;  4YQ3 A;  4CNE A;  2CX8 A;  3O7B A;  4CND A;  4YVG A;  3NK6 A;  3NK7 A;  1OY5 A;  4YQ0 A;  3AI9 X;  4MCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...