1V2XA

Trmh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
Knots found
sequence length
191
structure length
191
Chain Sequence
MRERTEARRRRIEEVLRRRQPDLTVLLENVHKPHNLSAILRTCDAVGVLEAHAVNPTGGVPTFNETSGGSHKWVYLRVHPDLHEAFRFLKERGFTVYATALREDARDFREVDYTKPTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQSLNVSVAAAVILFEAQRQRLKAGLYDRPRLDPELYQKVLADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (Gm18) methyltransferase
publication title Deep Knot Structure for Construction of Active Site and Cofactor Binding Site of tRNA Modification Enzyme
pubmed doi rcsb
source organism Thermus thermophilus
total genus 61
structure length 191
sequence length 191
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.34: tRNA (guanosine(18)-2'-O)-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
A PF12105 SpoU_methylas_C SpoU, rRNA methylase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1v2xA00
3N4JA 4YQAA 4JALA 3L8UA 4YQ2A 3AXZA 5GMBA 4CNFA 1VHKA 4YQOA 5GMCA 2QMMA 4YPWA 3KY7A 4YQTA 1P9PA 4YQJA 2O3AA 1X7OA 3KNUA 4CNGA 3BBDA 4YVGA 4YQLA 1UAMA 3AIAA 3KW2A 4YQ1A 2V3JA 4YQQA 4YQCA 4YQ5A 3O7BA 4XBOA 3BBEA 5CO4A 4YVHA 4YQ3A 2CX8A 3ILKA 4YQSA 4J3CA 4MCDA 5D9FA 1UAJA 3E5YA 3IC6A 4CNEA 4YQPA 4FAKA 4YVIA 4YQDA 3ONPA 4YQBA 4YQNA 1NS5A 3OIIA 3OINA 4YQIA 4PZKA 5FAIA 1K3RA 4YPZA 4L69A 1V2XA 4YQKA 1O6DA 1IPAA 2Z0YA 4MCBA 1VH0A 4JAKA 4RG1A 4YPXA 4YQGA 4H3ZA 1J85A 4X3MA 4YQ8A 1MXIA 4CNDA 4YQ6A 3NK7A 3GYQA 1UALA 4E8BA 4YQ0A 2V3KA 4H3YA 4YPYA 3OIJA 3DCMX 4KGNA 4MCCA 2I6DA 1NXZA 3KTYA 3NK6A 4YQ9A 4KDZA 3IEFA 1Z85A 2QWVA 1OY5A 1X7PA 3QUVA 4YVJA 2EGVA 1ZJRA 4IG6A 1GZ0A 5GM8A 4YQ7A 3AI9X 1V6ZA 3N4KA 4X3LA 4YQRA 1TO0A 4YVKA 1VHYA 1UAKA 2HA8A 4YQ4A 2EGWA 3BBHA 2YY8A
chains in the Genus database with same CATH superfamily
3N4JA 4YQAA 4JALA 3L8UA 4YQ2A 3AXZA 5GMBA 4CNFA 1VHKA 4YQOA 5GMCA 2QMMA 4YPWA 3KY7A 4YQTA 1P9PA 4YQJA 2O3AA 1X7OA 3KNUA 4CNGA 3BBDA 4YVGA 4YQLA 1UAMA 3AIAA 3KW2A 4YQ1A 4JWFA 2V3JA 4YQQA 4YQCA 4YQ5A 3O7BA 4XBOA 3BBEA 5CO4A 4YVHA 4YQ3A 2CX8A 3ILKA 4YQSA 4J3CA 4MCDA 5D9FA 1UAJA 3E5YA 3IC6A 4CNEA 4YQPA 4FAKA 4YVIA 4YQDA 3ONPA 4YQBA 4YQNA 1NS5A 3OIIA 4JWHA 4JWGA 3OINA 4YQIA 4PZKA 5FAIA 1K3RA 4YPZA 4L69A 1V2XA 4YQKA 1O6DA 1IPAA 2Z0YA 4MCBA 1VH0A 4JAKA 4RG1A 4YPXA 4YQGA 4H3ZA 1J85A 4X3MA 4YQ8A 1MXIA 4CNDA 4YQ6A 3NK7A 3GYQA 1UALA 4E8BA 4YQ0A 2V3KA 4H3YA 4JWJA 4YPYA 3OIJA 3DCMX 4KGNA 4MCCA 2I6DA 1NXZA 3KTYA 3NK6A 4YQ9A 4KDZA 3IEFA 1Z85A 2QWVA 1OY5A 1X7PA 3QUVA 4YVJA 2EGVA 1ZJRA 4IG6A 1GZ0A 5GM8A 4YQ7A 3AI9X 1V6ZA 3N4KA 4X3LA 4YQRA 1TO0A 4YVKA 1VHYA 4FMWA 1UAKA 2HA8A 4YQ4A 2EGWA 3BBHA 2YY8A
chains in the Genus database with same CATH topology
3N4JA 4YQAA 4JALA 3L8UA 4YQ2A 3AXZA 5GMBA 4CNFA 1VHKA 4YQOA 5GMCA 2QMMA 4YPWA 3KY7A 4YQTA 1P9PA 4YQJA 2O3AA 1X7OA 3KNUA 4CNGA 3BBDA 4YVGA 4YQLA 1UAMA 3AIAA 3KW2A 4YQ1A 4JWFA 2V3JA 4YQQA 4YQCA 4YQ5A 3O7BA 4XBOA 3BBEA 5CO4A 4YVHA 4YQ3A 2CX8A 3ILKA 4YQSA 4J3CA 4MCDA 5D9FA 1UAJA 3E5YA 3IC6A 4CNEA 4YQPA 4FAKA 4YVIA 4YQDA 3ONPA 4YQBA 4YQNA 1NS5A 3OIIA 4JWHA 4JWGA 3OINA 4YQIA 4PZKA 5FAIA 1K3RA 4YPZA 4L69A 1V2XA 4YQKA 1O6DA 1IPAA 2Z0YA 4MCBA 1VH0A 4JAKA 4RG1A 4YPXA 4YQGA 4H3ZA 1J85A 4X3MA 4YQ8A 1MXIA 4CNDA 4YQ6A 3NK7A 3GYQA 1UALA 4E8BA 4YQ0A 2V3KA 4H3YA 4JWJA 4YPYA 3OIJA 3DCMX 4KGNA 4MCCA 2I6DA 1NXZA 3KTYA 3NK6A 4YQ9A 4KDZA 3IEFA 1Z85A 2QWVA 1OY5A 1X7PA 3QUVA 4YVJA 2EGVA 1ZJRA 4IG6A 1GZ0A 5GM8A 4YQ7A 3AI9X 1V6ZA 3N4KA 4X3LA 4YQRA 1TO0A 4YVKA 1VHYA 4FMWA 1UAKA 2HA8A 4YQ4A 2EGWA 3BBHA 2YY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4J A;  4YQA A;  4JAL A;  3L8U A;  4YQ2 A;  3AXZ A;  5GMB A;  4CNF A;  1VHK A;  4YQO A;  5GMC A;  2QMM A;  4YPW A;  3KY7 A;  4YQT A;  1P9P A;  4YQJ A;  2O3A A;  1X7O A;  3KNU A;  4CNG A;  3BBD A;  4YVG A;  4YQL A;  1UAM A;  3AIA A;  3KW2 A;  4YQ1 A;  2V3J A;  4YQQ A;  4YQC A;  4YQ5 A;  3O7B A;  4XBO A;  3BBE A;  5CO4 A;  4YVH A;  4YQ3 A;  2CX8 A;  3ILK A;  4YQS A;  4J3C A;  4MCD A;  5D9F A;  1UAJ A;  3E5Y A;  3IC6 A;  4CNE A;  4YQP A;  4FAK A;  4YVI A;  4YQD A;  3ONP A;  4YQB A;  4YQN A;  1NS5 A;  3OII A;  3OIN A;  4YQI A;  4PZK A;  5FAI A;  1K3R A;  4YPZ A;  4L69 A;  1V2X A;  4YQK A;  1O6D A;  1IPA A;  2Z0Y A;  4MCB A;  1VH0 A;  4JAK A;  4RG1 A;  4YPX A;  4YQG A;  4H3Z A;  1J85 A;  4X3M A;  4YQ8 A;  1MXI A;  4CND A;  4YQ6 A;  3NK7 A;  3GYQ A;  1UAL A;  4E8B A;  4YQ0 A;  2V3K A;  4H3Y A;  4YPY A;  3OIJ A;  3DCM X;  4KGN A;  4MCC A;  2I6D A;  1NXZ A;  3KTY A;  3NK6 A;  4YQ9 A;  4KDZ A;  3IEF A;  1Z85 A;  2QWV A;  1OY5 A;  1X7P A;  3QUV A;  4YVJ A;  2EGV A;  1ZJR A;  4IG6 A;  1GZ0 A;  5GM8 A;  4YQ7 A;  3AI9 X;  1V6Z A;  3N4K A;  4X3L A;  4YQR A;  1TO0 A;  4YVK A;  1VHY A;  1UAK A;  2HA8 A;  4YQ4 A;  2EGW A;  3BBH A;  2YY8 A; 
#chains in the Genus database with same CATH topology
 3N4J A;  4YQA A;  4JAL A;  3L8U A;  4YQ2 A;  3AXZ A;  5GMB A;  4CNF A;  1VHK A;  4YQO A;  5GMC A;  2QMM A;  4YPW A;  3KY7 A;  4YQT A;  1P9P A;  4YQJ A;  2O3A A;  1X7O A;  3KNU A;  4CNG A;  3BBD A;  4YVG A;  4YQL A;  1UAM A;  3AIA A;  3KW2 A;  4YQ1 A;  4JWF A;  2V3J A;  4YQQ A;  4YQC A;  4YQ5 A;  3O7B A;  4XBO A;  3BBE A;  5CO4 A;  4YVH A;  4YQ3 A;  2CX8 A;  3ILK A;  4YQS A;  4J3C A;  4MCD A;  5D9F A;  1UAJ A;  3E5Y A;  3IC6 A;  4CNE A;  4YQP A;  4FAK A;  4YVI A;  4YQD A;  3ONP A;  4YQB A;  4YQN A;  1NS5 A;  3OII A;  4JWH A;  4JWG A;  3OIN A;  4YQI A;  4PZK A;  5FAI A;  1K3R A;  4YPZ A;  4L69 A;  1V2X A;  4YQK A;  1O6D A;  1IPA A;  2Z0Y A;  4MCB A;  1VH0 A;  4JAK A;  4RG1 A;  4YPX A;  4YQG A;  4H3Z A;  1J85 A;  4X3M A;  4YQ8 A;  1MXI A;  4CND A;  4YQ6 A;  3NK7 A;  3GYQ A;  1UAL A;  4E8B A;  4YQ0 A;  2V3K A;  4H3Y A;  4JWJ A;  4YPY A;  3OIJ A;  3DCM X;  4KGN A;  4MCC A;  2I6D A;  1NXZ A;  3KTY A;  3NK6 A;  4YQ9 A;  4KDZ A;  3IEF A;  1Z85 A;  2QWV A;  1OY5 A;  1X7P A;  3QUV A;  4YVJ A;  2EGV A;  1ZJR A;  4IG6 A;  1GZ0 A;  5GM8 A;  4YQ7 A;  3AI9 X;  1V6Z A;  3N4K A;  4X3L A;  4YQR A;  1TO0 A;  4YVK A;  1VHY A;  4FMW A;  1UAK A;  2HA8 A;  4YQ4 A;  2EGW A;  3BBH A;  2YY8 A; 
#chains in the Genus database with same CATH homology
 3N4J A;  4YQA A;  4JAL A;  3L8U A;  4YQ2 A;  3AXZ A;  5GMB A;  4CNF A;  1VHK A;  4YQO A;  5GMC A;  2QMM A;  4YPW A;  3KY7 A;  4YQT A;  1P9P A;  4YQJ A;  2O3A A;  1X7O A;  3KNU A;  4CNG A;  3BBD A;  4YVG A;  4YQL A;  1UAM A;  3AIA A;  3KW2 A;  4YQ1 A;  4JWF A;  2V3J A;  4YQQ A;  4YQC A;  4YQ5 A;  3O7B A;  4XBO A;  3BBE A;  5CO4 A;  4YVH A;  4YQ3 A;  2CX8 A;  3ILK A;  4YQS A;  4J3C A;  4MCD A;  5D9F A;  1UAJ A;  3E5Y A;  3IC6 A;  4CNE A;  4YQP A;  4FAK A;  4YVI A;  4YQD A;  3ONP A;  4YQB A;  4YQN A;  1NS5 A;  3OII A;  4JWH A;  4JWG A;  3OIN A;  4YQI A;  4PZK A;  5FAI A;  1K3R A;  4YPZ A;  4L69 A;  1V2X A;  4YQK A;  1O6D A;  1IPA A;  2Z0Y A;  4MCB A;  1VH0 A;  4JAK A;  4RG1 A;  4YPX A;  4YQG A;  4H3Z A;  1J85 A;  4X3M A;  4YQ8 A;  1MXI A;  4CND A;  4YQ6 A;  3NK7 A;  3GYQ A;  1UAL A;  4E8B A;  4YQ0 A;  2V3K A;  4H3Y A;  4JWJ A;  4YPY A;  3OIJ A;  3DCM X;  4KGN A;  4MCC A;  2I6D A;  1NXZ A;  3KTY A;  3NK6 A;  4YQ9 A;  4KDZ A;  3IEF A;  1Z85 A;  2QWV A;  1OY5 A;  1X7P A;  3QUV A;  4YVJ A;  2EGV A;  1ZJR A;  4IG6 A;  1GZ0 A;  5GM8 A;  4YQ7 A;  3AI9 X;  1V6Z A;  3N4K A;  4X3L A;  4YQR A;  1TO0 A;  4YVK A;  1VHY A;  4FMW A;  1UAK A;  2HA8 A;  4YQ4 A;  2EGW A;  3BBH A;  2YY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...