1V2XA

Trmh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
Knots found
sequence length
191
structure length
191
Chain Sequence
MRERTEARRRRIEEVLRRRQPDLTVLLENVHKPHNLSAILRTCDAVGVLEAHAVNPTGGVPTFNETSGGSHKWVYLRVHPDLHEAFRFLKERGFTVYATALREDARDFREVDYTKPTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQSLNVSVAAAVILFEAQRQRLKAGLYDRPRLDPELYQKVLADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (Gm18) methyltransferase
publication title Deep Knot Structure for Construction of Active Site and Cofactor Binding Site of tRNA Modification Enzyme
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 61
structure length 191
sequence length 191
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.34: tRNA (guanosine(18)-2'-O)-methyltransferase.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
A PF12105 SpoU_methylas_C SpoU, rRNA methylase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1v2xA00
1X7OA 3AI9X 1P9PA 5CO4A 4YVHA 2V3KA 3BBEA 2QWVA 5FAIA 3BBHA 4X3MA 1X7PA 4YQ7A 5GM8A 1NXZA 2CX8A 4MCBA 3KNUA 4J3CA 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1GZ0A 1UALA 3OIIA 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 4E8BA 1UAMA 3N4KA 5GMCA 4YQRA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 1NS5A 4RG1A 4YQNA 4KDZA 1ZJRA 4YQ5A 4CNDA 3NK7A 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 3OIJA 2Z0YA 3NK6A 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4KGNA 4YQ3A 4XBOA 3AXZA 3BBDA 3KTYA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH superfamily
1X7OA 3AI9X 1P9PA 5CO4A 4YVHA 2V3KA 3BBEA 2QWVA 5FAIA 3BBHA 4X3MA 1X7PA 4YQ7A 5GM8A 1NXZA 2CX8A 4MCBA 3KNUA 4J3CA 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1GZ0A 1UALA 3OIIA 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 4E8BA 1UAMA 3N4KA 5GMCA 4YQRA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 1NS5A 4RG1A 4YQNA 4KDZA 1ZJRA 4YQ5A 4CNDA 3NK7A 4JWJA 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 4JWGA 3OIJA 2Z0YA 3NK6A 4JWFA 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4KGNA 4YQ3A 4JWHA 4XBOA 3AXZA 3BBDA 3KTYA 4FMWA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH topology
1X7OA 3AI9X 1P9PA 5CO4A 4YVHA 2V3KA 3BBEA 2QWVA 5FAIA 3BBHA 4X3MA 1X7PA 4YQ7A 5GM8A 1NXZA 2CX8A 4MCBA 3KNUA 4J3CA 3AIAA 3GYQA 5GMBA 4YVGA 1VH0A 1OY5A 3O7BA 4YVIA 1GZ0A 1UALA 3OIIA 4YQBA 4CNEA 4YQDA 4YQGA 1VHYA 4YPXA 4YVJA 1TO0A 2V3JA 4YQAA 4H3ZA 4YQ8A 4JALA 4YQSA 4YQTA 2EGWA 4E8BA 1UAMA 3N4KA 5GMCA 4YQRA 1MXIA 4YQ2A 4YQLA 1VHKA 3KW2A 4YVKA 3ONPA 4FAKA 2I6DA 1NS5A 4RG1A 4YQNA 4KDZA 1ZJRA 4YQ5A 4CNDA 3NK7A 4JWJA 3QUVA 2HA8A 1V6ZA 2O3AA 3OINA 4YPYA 4CNFA 1V2XA 4L69A 1IPAA 5D9FA 4YQIA 2YY8A 4PZKA 4H3YA 4YPWA 3E5YA 4YQOA 4CNGA 4YQPA 4YQ1A 3DCMX 2EGVA 1UAKA 1J85A 1UAJA 4YQQA 4YQ9A 4YQ4A 3ILKA 4JWGA 3OIJA 2Z0YA 3NK6A 4JWFA 4IG6A 4YPZA 1O6DA 4JAKA 4MCDA 4YQCA 4YQJA 3N4JA 2QMMA 3L8UA 4KGNA 4YQ3A 4JWHA 4XBOA 3AXZA 3BBDA 3KTYA 4FMWA 4YQKA 4MCCA 3IC6A 3KY7A 3IEFA 1K3RA 1Z85A 4X3LA 4YQ0A 4YQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  3AI9 X;  1P9P A;  5CO4 A;  4YVH A;  2V3K A;  3BBE A;  2QWV A;  5FAI A;  3BBH A;  4X3M A;  1X7P A;  4YQ7 A;  5GM8 A;  1NXZ A;  2CX8 A;  4MCB A;  3KNU A;  4J3C A;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1GZ0 A;  1UAL A;  3OII A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  4E8B A;  1UAM A;  3N4K A;  5GMC A;  4YQR A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  1NS5 A;  4RG1 A;  4YQN A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3NK7 A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  3OIJ A;  2Z0Y A;  3NK6 A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4KGN A;  4YQ3 A;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
#chains in the Genus database with same CATH topology
 1X7O A;  3AI9 X;  1P9P A;  5CO4 A;  4YVH A;  2V3K A;  3BBE A;  2QWV A;  5FAI A;  3BBH A;  4X3M A;  1X7P A;  4YQ7 A;  5GM8 A;  1NXZ A;  2CX8 A;  4MCB A;  3KNU A;  4J3C A;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1GZ0 A;  1UAL A;  3OII A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  4E8B A;  1UAM A;  3N4K A;  5GMC A;  4YQR A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  1NS5 A;  4RG1 A;  4YQN A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3NK7 A;  4JWJ A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  4JWG A;  3OIJ A;  2Z0Y A;  3NK6 A;  4JWF A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4KGN A;  4YQ3 A;  4JWH A;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4FMW A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
#chains in the Genus database with same CATH homology
 1X7O A;  3AI9 X;  1P9P A;  5CO4 A;  4YVH A;  2V3K A;  3BBE A;  2QWV A;  5FAI A;  3BBH A;  4X3M A;  1X7P A;  4YQ7 A;  5GM8 A;  1NXZ A;  2CX8 A;  4MCB A;  3KNU A;  4J3C A;  3AIA A;  3GYQ A;  5GMB A;  4YVG A;  1VH0 A;  1OY5 A;  3O7B A;  4YVI A;  1GZ0 A;  1UAL A;  3OII A;  4YQB A;  4CNE A;  4YQD A;  4YQG A;  1VHY A;  4YPX A;  4YVJ A;  1TO0 A;  2V3J A;  4YQA A;  4H3Z A;  4YQ8 A;  4JAL A;  4YQS A;  4YQT A;  2EGW A;  4E8B A;  1UAM A;  3N4K A;  5GMC A;  4YQR A;  1MXI A;  4YQ2 A;  4YQL A;  1VHK A;  3KW2 A;  4YVK A;  3ONP A;  4FAK A;  2I6D A;  1NS5 A;  4RG1 A;  4YQN A;  4KDZ A;  1ZJR A;  4YQ5 A;  4CND A;  3NK7 A;  4JWJ A;  3QUV A;  2HA8 A;  1V6Z A;  2O3A A;  3OIN A;  4YPY A;  4CNF A;  1V2X A;  4L69 A;  1IPA A;  5D9F A;  4YQI A;  2YY8 A;  4PZK A;  4H3Y A;  4YPW A;  3E5Y A;  4YQO A;  4CNG A;  4YQP A;  4YQ1 A;  3DCM X;  2EGV A;  1UAK A;  1J85 A;  1UAJ A;  4YQQ A;  4YQ9 A;  4YQ4 A;  3ILK A;  4JWG A;  3OIJ A;  2Z0Y A;  3NK6 A;  4JWF A;  4IG6 A;  4YPZ A;  1O6D A;  4JAK A;  4MCD A;  4YQC A;  4YQJ A;  3N4J A;  2QMM A;  3L8U A;  4KGN A;  4YQ3 A;  4JWH A;  4XBO A;  3AXZ A;  3BBD A;  3KTY A;  4FMW A;  4YQK A;  4MCC A;  3IC6 A;  3KY7 A;  3IEF A;  1K3R A;  1Z85 A;  4X3L A;  4YQ0 A;  4YQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...