3O7BA

Crystal structure of archaeoglobus fulgidus nep1 bound to s-adenosylhomocysteine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
216
structure length
216
Chain Sequence
MGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome biogenesis Nep1 RNA methyltransferase
publication title Structural insight into the functional mechanism of Nep1/Emg1 N1-specific pseudouridine methyltransferase in ribosome biogenesis.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 75
structure length 216
sequence length 216
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3o7bA00
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 2QMMA 4YQIA 4H3ZA 3O7BA 4YQKA 4RG1A 4YQ5A 3OIIA 1UAKA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4J3CA 4YQCA 3AXZA 4YVKA 3KNUA 1OY5A 2V3KA 3KTYA 4YQ8A 4YQJA 2YY8A 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4YQ4A 4YQ0A 3BBDA 4IG6A 4KGNA 4KDZA 3DCMX 3N4KA 3GYQA 4FAKA 2O3AA 4YQBA 5GM8A 4YQLA 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 4YQ7A 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 4YVIA 5GMCA 1GZ0A 4YQAA 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 3NK6A 4XBOA 3L8UA 3N4JA 4MCDA 3AIAA 1VHKA 4CNDA 3BBHA 1MXIA 4YPXA 4YQTA 1J85A 3IC6A 3KW2A 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH superfamily
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 2QMMA 4YQIA 4H3ZA 3O7BA 4YQKA 4RG1A 4YQ5A 3OIIA 1UAKA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4J3CA 4YQCA 3AXZA 4YVKA 3KNUA 1OY5A 2V3KA 3KTYA 4YQ8A 4JWFA 4YQJA 2YY8A 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4JWJA 4YQ4A 4JWGA 4YQ0A 3BBDA 4IG6A 4KGNA 4FMWA 4KDZA 3DCMX 3N4KA 3GYQA 4FAKA 2O3AA 4YQBA 5GM8A 4YQLA 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 4YQ7A 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 4YVIA 5GMCA 1GZ0A 4YQAA 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 3NK6A 4XBOA 3L8UA 3N4JA 4JWHA 4MCDA 3AIAA 1VHKA 4CNDA 3BBHA 1MXIA 4YPXA 4YQTA 1J85A 3IC6A 3KW2A 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH topology
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 2QMMA 4YQIA 4H3ZA 3O7BA 4YQKA 4RG1A 4YQ5A 3OIIA 1UAKA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4J3CA 4YQCA 3AXZA 4YVKA 3KNUA 1OY5A 2V3KA 3KTYA 4YQ8A 4JWFA 4YQJA 2YY8A 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4JWJA 4YQ4A 4JWGA 4YQ0A 3BBDA 4IG6A 4KGNA 4FMWA 4KDZA 3DCMX 3N4KA 3GYQA 4FAKA 2O3AA 4YQBA 5GM8A 4YQLA 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 4YQ7A 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 4YVIA 5GMCA 1GZ0A 4YQAA 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 3NK6A 4XBOA 3L8UA 3N4JA 4JWHA 4MCDA 3AIAA 1VHKA 4CNDA 3BBHA 1MXIA 4YPXA 4YQTA 1J85A 3IC6A 3KW2A 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  2QMM A;  4YQI A;  4H3Z A;  3O7B A;  4YQK A;  4RG1 A;  4YQ5 A;  3OII A;  1UAK A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4J3C A;  4YQC A;  3AXZ A;  4YVK A;  3KNU A;  1OY5 A;  2V3K A;  3KTY A;  4YQ8 A;  4YQJ A;  2YY8 A;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4YQ4 A;  4YQ0 A;  3BBD A;  4IG6 A;  4KGN A;  4KDZ A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  2O3A A;  4YQB A;  5GM8 A;  4YQL A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  4YQ7 A;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  4YVI A;  5GMC A;  1GZ0 A;  4YQA A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4MCD A;  3AIA A;  1VHK A;  4CND A;  3BBH A;  1MXI A;  4YPX A;  4YQT A;  1J85 A;  3IC6 A;  3KW2 A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
#chains in the Genus database with same CATH topology
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  2QMM A;  4YQI A;  4H3Z A;  3O7B A;  4YQK A;  4RG1 A;  4YQ5 A;  3OII A;  1UAK A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4J3C A;  4YQC A;  3AXZ A;  4YVK A;  3KNU A;  1OY5 A;  2V3K A;  3KTY A;  4YQ8 A;  4JWF A;  4YQJ A;  2YY8 A;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4JWJ A;  4YQ4 A;  4JWG A;  4YQ0 A;  3BBD A;  4IG6 A;  4KGN A;  4FMW A;  4KDZ A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  2O3A A;  4YQB A;  5GM8 A;  4YQL A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  4YQ7 A;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  4YVI A;  5GMC A;  1GZ0 A;  4YQA A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4JWH A;  4MCD A;  3AIA A;  1VHK A;  4CND A;  3BBH A;  1MXI A;  4YPX A;  4YQT A;  1J85 A;  3IC6 A;  3KW2 A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
#chains in the Genus database with same CATH homology
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  2QMM A;  4YQI A;  4H3Z A;  3O7B A;  4YQK A;  4RG1 A;  4YQ5 A;  3OII A;  1UAK A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4J3C A;  4YQC A;  3AXZ A;  4YVK A;  3KNU A;  1OY5 A;  2V3K A;  3KTY A;  4YQ8 A;  4JWF A;  4YQJ A;  2YY8 A;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4JWJ A;  4YQ4 A;  4JWG A;  4YQ0 A;  3BBD A;  4IG6 A;  4KGN A;  4FMW A;  4KDZ A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  2O3A A;  4YQB A;  5GM8 A;  4YQL A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  4YQ7 A;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  4YVI A;  5GMC A;  1GZ0 A;  4YQA A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4JWH A;  4MCD A;  3AIA A;  1VHK A;  4CND A;  3BBH A;  1MXI A;  4YPX A;  4YQT A;  1J85 A;  3IC6 A;  3KW2 A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...