3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
3DCMX 4CNGA 4YPXA 2YY8A 4YQJA 4YPZA 4FAKA 2EGWA 4YQ8A 2QMMA 4YQTA 1UALA 1UAJA 1NS5A 3L8UA 2HA8A 4KDZA 4KGNA 5CO4A 4H3YA 2QWVA 1J85A 3BBHA 4YQ7A 4YQ0A 4L69A 5GMBA 4YQDA 1V6ZA 1UAMA 4H3ZA 3BBEA 4YQ6A 1X7OA 4YQOA 1MXIA 3KW2A 1IPAA 4XBOA 4YQ4A 3IC6A 4RG1A 3AIAA 4YPWA 4CNDA 4YQ2A 4X3LA 4MCCA 1UAKA 3ILKA 3QUVA 4PZKA 1X7PA 3KNUA 5GM8A 3NK6A 4YVIA 4CNFA 4YQ3A 4YQGA 3ONPA 4YQ5A 4MCBA 4YQBA 3BBDA 4YQCA 4YQPA 2Z0YA 1ZJRA 1Z85A 3AI9X 3OIIA 2CX8A 5D9FA 3N4JA 3NK7A 4MCDA 3O7BA 4YVGA 3KY7A 2O3AA 2I6DA 3OINA 4X3MA 4YQSA 4YQIA 4YQAA 4E8BA 3AXZA 1K3RA 4JAKA 4YQ1A 1VHYA 1OY5A 4YPYA 4YQKA 2EGVA 1V2XA 1NXZA 4YVJA 3GYQA 5FAIA 3KTYA 4YQQA 4YQLA 3E5YA 1P9PA 2V3KA 4YVHA 1TO0A 5GMCA 1GZ0A 4YQNA 1VH0A 1VHKA 3N4KA 4CNEA 4YVKA 4YQ9A 4YQRA 2V3JA 3IEFA 1O6DA 4IG6A 3OIJA 4J3CA 4JALA
chains in the Genus database with same CATH superfamily
2N35A 3L27A 2D7EA 4GEWA 1VG5A 2XH9A 4IBJA 2WSCF 1NJFA 2Z4SA 3C3DA 4M0WA 4YPXA 1L2BA 3DA1A 2CUZA 3F92A 2YY8A 1LTMA 4YQJA 3U6DA 1G4AE 4FAKA 1DGGA 1G41A 2EGWA 2LHGA 4PDGA 1OJLA 2HAKA 5EP4A 3HZJA 1IN4A 1GLNA 2OO9A 1Y8GA 4I81A 1UAJA 2F5OA 4YQTA 2K0BX 4M9SA 1RU3A 1SXJE 3IECA 3T1HM 4GIPA 3ZC7B 4PD2A 4YHHM 3AOEA 4QHTA 2KNAA 2QWVA 2Z8YM 3I4VA 1J85A 1TR8A 4IJFA 3ZQJA 4YQDA 2ZTDA 3GLIB 4B3SM 4H3ZA 5GKNA 3HWSA 5H37D 2Y0QA 4JI3M 2QQ8A 1F4IA 3KW2A 5KQ8A 4KO8A 1NY6A 3FKEA 2RKOA 4B3TM 3E9SA 3TWLA 1QANA 3GQ3A 4JXJA 2UUAM 2L7IA 4AI6A 5BR8M 3GPUA 4CNDA 2F5NA 3HU2A 3L28A 2FNAA 4QNMA 4AG6A 3HHZA 4MCCA 1UAKA 3ILKA 4DV6M 4L8RC 3QUVA 1PJIA 2CE7A 3KNUA 3IHPA 3NK6A 1WJ7A 2DVWB 4WURA 4CNFA 4LZZA 4QOZC 3H4JA 2DAGA 3GPPA 4YQGA 1K3XA 1WGLA 3PNVA 4KODA 1QVRA 2XFTA 4IIWA 2QENA 3I01M 4NC6A 3W0FA 3K9OA 3T6PA 4LG2A 3AFHA 1N34M 2HKJA 4DV0M 2VQEM 1R4GA 1Q39A 4P16A 4B08A 3SFZA 1N33M 1GVNA 1IXRC 3GLHE 3SAUA 2CV0A 3I51A 1XWIA 3EIHA 4DR4M 2Z0YA 4KHPM 1ZJRA 3AI9X 4RF1A 1DGHB 1Q3BA 4JI7M 3CF0A 2LXEA 4L16A 2RGOA 3H4MA 2DHYA 3KP0E 3M7GA 4G6ZA 3NK7A 1KFVA 5IZ7D 1N32M 4FCTA 5FTMA 4FWGA 4YVGA 2KNVA 2K9DA 7CATA 4YY3M 4OU7A 4G3OA 4P17A 1QZMA 1J7KA 3B7NA 1SXJA 2M60A 5F3WA 1TH2A 2EA0A 2C98A 1G8PA 3KS4A 4YQSA 2CFOA 2VDBB 5LMUM 2KRUA 3NBXX 3TWMA 1OY5A 4AKGA 2Q2EB 1QZEA 2YR0A 3Q8GA 3KOZE 3FE3A 1NXZA 3GYQA 1D2NA 3GQ5A 2CHVA 1WIVA 2MH8A 2QBYB 1DGBA 2HCBA 3K9PA 4LF9M 3R9XB 1IY1A 2JZ1A 3JAMS 2FH0A 3I4YA 4YQQA 2CV2A 5DYIA 2BWEA 2CRUA 1JR3D 2VF7A 1VDDA 3E5YA 4YQLA 2YFQA 3GRYA 3FUTA 1OAOC 1R6BX 5GMCA 3GPYA 1GZ0A 4KT0F 4W5WA 1VH0A 2JY7A 2XGNA 4OVZB 5KQDA 5DFLA 1OAIA 2Y20A 1K82A 3GRRA 4YQRA 2JY8A 4RF0A 4LJAA 3IG8A 5FTKA 2QHOB 1WR1B 2DWLA 3GLIE 3MK6A 1O6DA 2DNAA 4NRWA 2W82A 2XF3A 3A98B 1N78A 4AKHA 2MJ5B 4JALA 5EXPA 1SG9A 3SAVA 1G71A 2DKLA 5EP2A 3GLHA 2L6OA 2WZJA 1N36M 2K6BA 5A2QS 1OTRA 1VEGA 1W5TA 3HJ8A 2L4EA 5EJCA 3SATA 4JWFA 4DR5M 3MMPA 1FJGM 2F5QA 4B3RM 3LQRA 1DO2A 4IBKA 4Z8XA 2G8LA 3KOYE 3E21A 1ZMUA 3EIEA 1IN5A 4NL4H 1XXHE 3U60A 1NS5A 1R5LA 2CEAA 2KA6B 4LRTA 2KXEA 3L8UA 1D0MA 4NSOB 2ERCA 4I8OA 4MH0E 3U5ZB 4FD2A 4KDZA 3B9PA 5CO4A 5KO3A 5C18A 1YUBA 1HT1E 1QAOA 3BBHA 2VIIA 4YQ0A 3KVWA 1WGNA 3V76A 3KDSE 3GLFB 4YQOA 2ZAMA 4II7A 3PVSA 5KPZA 5JI2E 4GRIA 4DV1M 2XSZD 3FYCA 4HEOA 1G3IA 2UUBM 3IC6A 2DXIA 3A45A 1NJGA 4FWHA 1Z5BA 1L2CA 2FFJA 1HQCA 2Y0TA 4WP2A 1HR0M 5FTJA 3KP1E 3TWKA 4YQ2A 3UJNA 5DYGA 2JNHA 2R45A 2Y21A 4LZJA 1D0KA 2BJWA 2ZBKB 4B7FA 3KSJA 3HY5A 2XZFA 5GM8A 1IXZA 1HQYE 4CISA 3GQ4A 3KW6A 4IBCA 3FYDA 1FNNA 3LW5F 1XB2B 2J7NA 3J2PB 3GLGB 3ONPA 2J7OA 1HT2E 1T43A 4MM3B 1TH3A 4I5SA 5IT9S 1L1ZA 3J80S 4X65M 5ITXA 1GL6A 2AHMA 2I7PA 1NV9A 3T38A 1TTEA 2DWZB 2C9OA 2J5YA 5FTLA 1KYIA 2JY6B 3GLIA 4JI0M 2MR9A 3B89A 4X64M 2R4JA 4YQPA 2DAIA 4FWDA 4IBIA 3U6EA 2UUCM 4JI2M 1DV0A 3AL0C 3OIIA 1J09A 4L4UA 4AQYM 1WHCA 3L29A 2CX8A 3W67A 3K1JA 4M9XA 4CHTB 4X62M 1EFUB 3N4JA 5D9FA 1E9SA 1PM5A 4DR7M 3KFUG 2YQZA 8CATA 4JWHA 4MCDA 2LVOC 4IBGA 3O7BA 2EJSA 2O3AA 4MGYE 3J27B 1E94E 2I6DA 3TPZA 4A3VB 1NHGC 1QQWA 1XXHA 2R4EA 4Q7JA 4QNRA 4DUYM 3LVVA 2V6ZM 1QAMA 3HJQA 1ZV1A 1Q3CA 3K8ZA 5E26A 4YQAA 1PJJA 4MGHA 3KXEC 3HU3A 3U61B 1IQPA 5JI3E 4JAKA 4DR3M 1N77A 1XNRM 3LCVB 1D0LA 2EKKA 4YPYA 4YQKA 3KOXE 3HHWA 1V2XA 3MJ5A 4AW4A 4B7GA 2KDLA 2OOBA 3K2LA 4DR2M 1JB0F 2YNMD 1QUSA 4KLNA 4LCBA 1YE9A 1NVMA 1OFIA 4GKKM 1R7RA 2QSFX 4L78A 1DGHA 4DV7M 1XMOM 4JI6M 4JI1M 1NSFA 2C99A 3VKGA 2V3KA 2O5RA 4YVHA 3SC3A 3GRUA 4LY6A 4MGIE 3ZH9B 3K92A 4G4OA 3U6LA 2C5RA 4JYAM 2EUCA 4R7GA 3UMMA 2HHHM 5KPRA 1VHKA 4CNEA 5FTNA 3AV0A 4LGYA 4LF8M 2F4VM 2BWBA 3C58A 1OFHA 2NQ8C 2G3QA 4F2LA 1Z5AA 3IG5A 2DZNB 3OIJA 4YQ3A 4DV3M 1IXSA 3D8BA 1QDRA 3FD9A 2O01F 1Z5CA 5ITRA 3R8FA 4CNGA 2R62A 3RE8A 3KSXA 1QAQA 2KZUA 3FTDA 4I4LA 2Z7JA 2LNHC 2XZUA 3PXGA 1IFYA 2BJVA 1SXJD 3CGWA 4GC9A 5EXTA 4YQ8A 1SXJB 4DR6M 1V34A 3QAUA 4AG5A 1GO5A 4MGZE 2R18A 4JWJA 2MROB 1TDHA 3FTCA 2QBYA 1UALA 3L26A 2DWNA 1NV8A 4LJ5A 4KGNA 4H3YA 1EIJA 2ZAOA 5ITXE 4L69A 5GMBA 3GP1A 4B7HA 1V6ZA 3U6SA 1PJTA 1UAMA 2QPAA 2QP9X 4YQ6A 1ORYB 2JXNA 2DAKA 4OVZA 4YQ4A 5IWAM 3LVWA 4NXNM 2D7GA 4RKUF 2EKFA 4F1IA 3GPXA 1HNZM 2O25A 3SYLA 3WHLA 3J81S 3OTOM 2CV1A 4RG1A 3AIAA 2BNKA 4ANRA 4G4NA 2APLA 1A5TA 1YLAA 3VK7A 4G4QA 4MGKE 1GL7A 4DUZM 4X3LA 1E32A 1Q02A 3TL4X 3LCUA 2DZLA 4NOOB 1N75A 4REZA 4DR1M 2H5XA 4GHLA 4LGMA 2XLJA 3T1YM 2JZ0A 4K0KM 3RGSA 2R65A 4CGYB 2JY5A 1IN7A 4G4RA 2ZANA 3FUVA 3U6QA 4D80A 4JV5M 2R6FA 1MJGM 3SMSA 3RGPA 3U5ZA 3GLHB 4LJ6A 5BPVA 4B3MM 1MX0A 4LFBM 5EXXA 2LHCA 2A5YB 2FOIC 3WHKA 5KPTA 3SYKA 3J7BA 3U6PA 1QUTA 5ITTA 4MCBA 2HL7A 1IN6A 1XNQM 2X4AA 3HX3A 4PCZA 4YQBA 1S3SA 3BBDA 2LVPC 1NNUC 1UFZA 4YQCA 2CP8A 1TH4A 1KSFX 4FCWA 1T3TA 2X49A 1Z85A 4DV4M 4JWGA 2R46A 2LVNC 4S12A 1OKSA 4IBBA 3LQQA 2WSFF 2DENA 3FUWA 3QYEA 1J5EM 1QYRA 4LF7M 3JR5A 1VDLA 2L7HA 3C3EA 5EQTA 3SHGB 4XGIA 3U6CA 2L2DA 5ITQA 2H1RA 2ZTCA 3FRIA 4JI5M 1IY2A 3C9PA 3QYBA 3SMPA 2OOAA 3HU1A 3W0LB 4XK8F 4YQIA 4Y28F 3E46A 3U6MA 2JA2A 2KW0A 3AKZA 1NO1A 5EP1A 3AXZA 2JP7A 4QOSA 4YQ1A 1VHYA 1PRBA 3SASA 4JI8M 1P3QQ 1JQJC 1TF0B 2LH0A 2LVQD 4D82A 4LFAM 4YVJA 4L15A 1G59A 5FAIA 3KTYA 3I04M 3B7QA 4UN2B 1OQYA 1WXQA 3CF6E 4QHSA 5FSWA 4LRSA 3VLFB 4DBGB 2KEBA 1NHWC 3RFWA 3W68A 1GKIA 2FE8A 1Z6TA 1C7YA 2DAEA 1ZQ9A 3BBZA 3VDUA 2ZM6M 4LJ7A 3NWLA 3FTFA 1XMQM 1TO0A 1DGFA 4IJEA 2DAMA 1AIPC 1JR3E 3FUUA 2GQFA 2QZ4A 4YVKA 5LMNM 4LF6M 1AUAA 2CWBA 3ZCBB 2UXBM 1V33A 2R44A 4FW9A 5DNYA 3M0EA 1EE8A 2Z3XA 4IBEA 1DO0A 1OIPA 3B7ZA 2XFSA 1XHBA 4M0DA 4X66M 2VQFM 4IG6A 4GKJM 1OIZA 1NNJA 1ZMVA 3NBIA 3DCMX 3KOWE 3TQSA 3U61A 4R3DA 1GJSA 3AOEC 3M6AA 4YPZA 4NRVA 4ITQA 1XXHB 2KNZA 2CHQA 2LTUA 3PNYA 2JUJA 2QMMA 4PT5A 2G5GX 1VEJA 2LBCA 4ZPXA 3UK6A 3PFIA 2HA8A 3A42A 3D8LA 2P5TA 2I7NA 2L09A 1UM8A 3KS8A 3FRHA 1L2DA 1LV7A 4FVMA 4GHAA 4YQ7A 4WW0A 2MGWA 2R0IA 4CIZA 1V92A 3BBEA 1HJPA 1X7OA 2DWMA 4GH9A 2CHGA 4BB9A 1MXIA 3JR4A 4XBOA 1IBKM 3VFDA 1IPAA 3L2AA 4HLQA 1C1KA 4L6V6 3GLFE 2OQ4A 4JI4M 4DV5M 4LJ8A 3UGJA 1Z59A 2L4FA 4YPWA 4IBFA 1W5SA 3U6OA 4OX9M 4EIWA 3E4RA 2D7HA 1L1TA 2C96A 1MN3A 1XC8A 4PZKA 1X7PA 3AOGA 4YVIA 2OPFA 1IN8A 2V1CA 2F5SA 3THGA 1CUKA 4Z6YA 3MHVC 3Q8XA 4YQ5A 1YSYA 4FMWA 1MU5A 3HHYA 1X37A 4IBDA 5FLXS 4BLCA 1IXSB 1JR3A 3GLGE 2V1UA 2DZOB 1TDZA 1QDTA 4GC5A 4RNAA 3L25A 1NY5A 4TUWA 3A46A 1E9RA 3FTEA 4JN6A 3SARA 3DFZA 4DV2M 3UZUA 1I94M 1I4WA 2QCUA 4LJ9A 3SAWA 2EO2A 3HHXA 1T6OA 2HWJA 2DHRA 3T15A 1IBLM 1SXJC 1VQ1A 4D81A 2GNOA 1PJSA 3DZDA 5C1BA 3CF2A 1TGUA 4AKIA 2LVAA 3B74A 4LJ4A 1K3WA 2JWSA 2XEPA 2FS1A 3KY7A 4FCVA 3GO8A 2F5PA 3OINA 1HNXM 4M9ZA 3VDPA 3HKPA 4X3MA 4PDIA 4CJ6A 5ITUA 3AJIB 2UU9M 3DOAA 1PJQA 1GABA 1H6UA 2B3TA 2X8AA 3BXWA 2VF8A 1ZAEA 3HGIA 3CTWB 1R2YA 1R2ZA 5EP3A 4E8BA 1K3RA 3FUXA 1IBMM 4LF5M 3LMMA 4OW0A 5L8RF 2WSEF 1HNWM 2EGVA 3GLFA 4GMQA 4HL4A 4R71A 5EXSA 1ZMWA 2KHHA 3U60B 2XSZA 4AZFA 3J7AS 2E5LM 2Z4RA 3QWLA 1BVSA 1PGYA 1P9PA 4LFCM 2K47A 2RRUA 1VEKA 2RGHA 2KRKA 3VKHA 4YQNA 3SBJA 3GRVA 4GITA 4MB7A 2C9CA 4LF4M 3N4KA 2UXCM 4NXMM 5IREB 4YQ9A 2M5ZA 2V3JA 2QNJA 3VK8A 2UXDM 5ITYA 1IM2A 3IEFA 4BBAA 2KZSA 1IY0A 1GJTA 2DI0A 3BOSA 3GLGA 2LWXA 4NSRA 5E6JA 3TE6A 4J3CA 3SHFA 1L8QA 3HJSA
chains in the Genus database with same CATH topology
3L27A 2D7EA 2XH9A 4IBJA 1NJFA 2Z4SA 4M0WA 4YPXA 1L2BA 3DA1A 2CUZA 2YY8A 4YQJA 3U6DA 1G4AE 4FAKA 1DGGA 1G41A 2EGWA 4PDGA 1OJLA 5EP4A 1IN4A 1GLNA 4I81A 1UAJA 2F5OA 4YQTA 4M9SA 3T1HM 1SXJE 4GIPA 3ZC7B 4PD2A 4YHHM 3AOEA 4QHTA 2QWVA 3I4VA 1J85A 4IJFA 4YQDA 3GLIB 4B3SM 4H3ZA 5GKNA 3HWSA 5H37D 2Y0QA 4JI3M 3KW2A 5KQ8A 4KO8A 1NY6A 3FKEA 2RKOA 4B3TM 3E9SA 3TWLA 1QANA 3GQ3A 4JXJA 2UUAM 2L7IA 4AI6A 5BR8M 3GPUA 4CNDA 2F5NA 3HU2A 3L28A 2FNAA 4QNMA 4AG6A 3HHZA 4MCCA 1UAKA 3ILKA 4DV6M 4L8RC 3QUVA 1PJIA 2CE7A 3KNUA 3NK6A 2DVWB 4WURA 4CNFA 4LZZA 4QOZC 3GPPA 4YQGA 1K3XA 4KODA 3PNVA 1QVRA 2XFTA 4IIWA 2QENA 3W0FA 4LG2A 3AFHA 1N34M 2HKJA 4DV0M 2VQEM 1Q39A 4P16A 4B08A 3SFZA 1N33M 1GVNA 1IXRC 3SAUA 2CV0A 3I51A 1XWIA 3EIHA 4DR4M 2Z0YA 4KHPM 1ZJRA 3AI9X 4RF1A 1DGHB 1Q3BA 4JI7M 3CF0A 2LXEA 4L16A 2RGOA 3H4MA 3M7GA 3KP0E 4G6ZA 3NK7A 1KFVA 5IZ7D 1N32M 4FCTA 5FTMA 4FWGA 4YVGA 7CATA 4YY3M 4OU7A 1QZMA 1J7KA 1SXJA 2M60A 5F3WA 1TH2A 2EA0A 2C98A 1G8PA 3KS4A 4YQSA 2CFOA 5LMUM 2KRUA 3TWMA 1OY5A 4AKGA 2Q2EB 2YR0A 3KOZE 1NXZA 3GYQA 1D2NA 3GQ5A 2CHVA 2QBYB 4LF9M 1DGBA 2HCBA 3R9XB 1IY1A 3JAMS 3I4YA 4YQQA 2CV2A 5DYIA 1JR3D 3E5YA 1VDDA 4YQLA 2YFQA 3GRYA 3FUTA 1R6BX 5GMCA 3GPYA 1GZ0A 4W5WA 1VH0A 5KQDA 2XGNA 4OVZB 1K82A 2Y20A 3GRRA 4YQRA 4RF0A 4LJAA 3IG8A 5FTKA 2DWLA 1O6DA 3MK6A 4NRWA 2W82A 2XF3A 3A98B 1N78A 4AKHA 4JALA 5EXPA 3SAVA 5EP2A 3GLHA 2L6OA 1N36M 5A2QS 1W5TA 3HJ8A 5EJCA 3SATA 4JWFA 4DR5M 1FJGM 2F5QA 4B3RM 3LQRA 1DO2A 4IBKA 4Z8XA 2G8LA 3KOYE 3EIEA 1IN5A 4NL4H 3U60A 1NS5A 2KA6B 2CEAA 3L8UA 4LRTA 2KXEA 4KDZA 4NSOB 2ERCA 4I8OA 4MH0E 3U5ZB 4FD2A 5CO4A 3B9PA 5KO3A 5C18A 1YUBA 1HT1E 1QAOA 3BBHA 2VIIA 4YQ0A 3KVWA 3KDSE 3GLFB 4YQOA 2ZAMA 4II7A 3PVSA 5KPZA 5JI2E 4GRIA 4DV1M 2XSZD 3FYCA 2UUBM 1G3IA 3IC6A 2DXIA 3A45A 1NJGA 4FWHA 1Z5BA 1L2CA 2FFJA 1HQCA 2Y0TA 1HR0M 5FTJA 3KP1E 3TWKA 4YQ2A 3UJNA 5DYGA 2R45A 2Y21A 4LZJA 2BJWA 2ZBKB 4B7FA 3KSJA 2XZFA 5GM8A 1IXZA 1HQYE 4CISA 3GQ4A 3KW6A 4IBCA 3FYDA 1FNNA 2J7NA 3J2PB 3GLGB 3ONPA 2J7OA 1HT2E 4MM3B 1TH3A 4I5SA 5IT9S 1L1ZA 3J80S 4X65M 5ITXA 1GL6A 2AHMA 2I7PA 3T38A 2DWZB 2C9OA 5FTLA 1KYIA 3GLIA 4JI0M 4X64M 2R4JA 4YQPA 4FWDA 4IBIA 3U6EA 2UUCM 4JI2M 3AL0C 3OIIA 1J09A 4L4UA 4AQYM 3L29A 2CX8A 4CHTB 3K1JA 4M9XA 4X62M 3N4JA 5D9FA 1E9SA 1PM5A 4DR7M 3KFUG 2YQZA 8CATA 4JWHA 4MCDA 4IBGA 3O7BA 2O3AA 4MGYE 3J27B 1E94E 2I6DA 3TPZA 4A3VB 1NHGC 1QQWA 1XXHA 2R4EA 4QNRA 4DUYM 3LVVA 2V6ZM 1QAMA 3HJQA 1Q3CA 3K8ZA 5E26A 4YQAA 1PJJA 4MGHA 3KXEC 3HU3A 3U61B 1IQPA 5JI3E 4JAKA 4DR3M 1N77A 1XNRM 4YPYA 4YQKA 3KOXE 3HHWA 1V2XA 3MJ5A 4AW4A 4B7GA 3K2LA 4DR2M 2YNMD 4KLNA 4LCBA 1YE9A 1NVMA 1OFIA 4GKKM 1R7RA 1XMOM 4L78A 1DGHA 4DV7M 4JI6M 4JI1M 2V3KA 1NSFA 2C99A 3VKGA 2O5RA 4YVHA 3SC3A 3GRUA 4LY6A 4MGIE 3ZH9B 3K92A 4G4OA 3U6LA 2C5RA 4JYAM 2EUCA 4R7GA 3UMMA 2HHHM 5KPRA 1VHKA 4CNEA 5FTNA 3AV0A 4LGYA 4LF8M 2F4VM 3C58A 1OFHA 2NQ8C 1Z5AA 3IG5A 2DZNB 3OIJA 4YQ3A 4DV3M 3D8BA 3FD9A 5ITRA 1Z5CA 3R8FA 4CNGA 2R62A 3RE8A 3KSXA 1QAQA 2KZUA 3FTDA 4I4LA 2Z7JA 2LNHC 2XZUA 3PXGA 2BJVA 1SXJD 4GC9A 5EXTA 4YQ8A 1SXJB 4DR6M 4AG5A 3QAUA 4JWJA 4MGZE 2R18A 2QBYA 1TDHA 3FTCA 1UALA 3L26A 2DWNA 4LJ5A 4KGNA 4H3YA 2ZAOA 5ITXE 4L69A 5GMBA 3GP1A 4B7HA 1V6ZA 3U6SA 1UAMA 2QPAA 2QP9X 4YQ6A 1ORYB 4OVZA 4YQ4A 5IWAM 3LVWA 4NXNM 2D7GA 3GPXA 1HNZM 3SYLA 3WHLA 3J81S 3OTOM 2CV1A 4RG1A 3AIAA 2BNKA 4G4NA 3VK7A 4X3LA 4G4QA 4MGKE 1GL7A 4DUZM 1E32A 3TL4X 4REZA 4NOOB 1N75A 4DR1M 4GHLA 4LGMA 2XLJA 3T1YM 4K0KM 3RGSA 2R65A 4CGYB 1IN7A 4G4RA 2ZANA 3FUVA 3U6QA 4D80A 4JV5M 3SMSA 3RGPA 3U5ZA 3GLHB 4LJ6A 5BPVA 4B3MM 1MX0A 4LFBM 5EXXA 2A5YB 2FOIC 3WHKA 5KPTA 3U6PA 3SYKA 3J7BA 4MCBA 5ITTA 2HL7A 1IN6A 1XNQM 2X4AA 4YQBA 4PCZA 1S3SA 3BBDA 1NNUC 4YQCA 1TH4A 1KSFX 4FCWA 1T3TA 2X49A 1Z85A 4DV4M 4JWGA 2R46A 4S12A 4IBBA 3LQQA 3FUWA 1J5EM 4LF7M 1QYRA 3JR5A 2L7HA 5EQTA 3SHGB 4XGIA 3U6CA 5ITQA 2H1RA 4JI5M 1IY2A 3SMPA 3HU1A 3W0LB 4YQIA 3U6MA 2JA2A 2KW0A 3AKZA 5EP1A 3AXZA 4QOSA 4YQ1A 1VHYA 3SASA 4JI8M 2LH0A 1JQJC 4YVJA 4D82A 4LFAM 4L15A 1G59A 5FAIA 3KTYA 3CF6E 1WXQA 4QHSA 5FSWA 4LRSA 3VLFB 2KEBA 1NHWC 3RFWA 1GKIA 1Z6TA 2FE8A 3VDUA 1ZQ9A 2ZM6M 4LJ7A 3NWLA 3FTFA 1XMQM 1TO0A 1DGFA 4IJEA 3FUUA 2QZ4A 4YVKA 5LMNM 4LF6M 3ZCBB 2UXBM 4FW9A 5DNYA 3M0EA 1EE8A 2Z3XA 4IBEA 1DO0A 4X66M 4IG6A 2XFSA 1XHBA 4M0DA 2VQFM 4GKJM 1NNJA 3NBIA 3DCMX 3KOWE 3TQSA 3U61A 4R3DA 3AOEC 3M6AA 4YPZA 4NRVA 4ITQA 1XXHB 2CHQA 3PNYA 2QMMA 4PT5A 2G5GX 4ZPXA 3UK6A 3PFIA 2HA8A 3A42A 3D8LA 2P5TA 2I7NA 2L09A 1UM8A 3KS8A 1L2DA 1LV7A 4FVMA 4GHAA 4YQ7A 4WW0A 3BBEA 1X7OA 2DWMA 4GH9A 2CHGA 4BB9A 1MXIA 3JR4A 4XBOA 1IBKM 3VFDA 1IPAA 3L2AA 4HLQA 1C1KA 2OQ4A 4JI4M 4DV5M 4LJ8A 3UGJA 1Z59A 4YPWA 4IBFA 1W5SA 3U6OA 4OX9M 4EIWA 3E4RA 2D7HA 1L1TA 2C96A 1XC8A 4PZKA 1X7PA 3AOGA 4YVIA 2OPFA 1IN8A 2V1CA 2F5SA 3THGA 4Z6YA 3MHVC 3Q8XA 4YQ5A 1YSYA 4FMWA 1MU5A 3HHYA 1X37A 4IBDA 5FLXS 4BLCA 1IXSB 1JR3A 2V1UA 2DZOB 1TDZA 4RNAA 4GC5A 3L25A 1NY5A 4TUWA 3A46A 1E9RA 3FTEA 4JN6A 3SARA 3DFZA 4DV2M 3UZUA 1I94M 1I4WA 2QCUA 4LJ9A 3SAWA 2EO2A 3HHXA 3T15A 2DHRA 1IBLM 1SXJC 4D81A 3DZDA 5C1BA 3CF2A 1TGUA 4AKIA 4LJ4A 1K3WA 2XEPA 3KY7A 4FCVA 3GO8A 3OINA 1HNXM 4M9ZA 3VDPA 3HKPA 4X3MA 4PDIA 5ITUA 3AJIB 2UU9M 3DOAA 1H6UA 2X8AA 2F5PA 1R2YA 1ZAEA 3HGIA 3CTWB 1R2ZA 5EP3A 4E8BA 1K3RA 3FUXA 1IBMM 4LF5M 3LMMA 4OW0A 1HNWM 2EGVA 3GLFA 4GMQA 4HL4A 5EXSA 3U60B 2XSZA 4AZFA 3J7AS 2E5LM 2Z4RA 3QWLA 1P9PA 4LFCM 2K47A 2RGHA 2KRKA 3VKHA 4YQNA 3SBJA 3GRVA 4GITA 4MB7A 2C9CA 4LF4M 3N4KA 2UXCM 4NXMM 5IREB 4YQ9A 2M5ZA 2V3JA 3VK8A 2UXDM 5ITYA 1IM2A 3IEFA 4BBAA 2KZSA 1IY0A 3BOSA 3GLGA 2LWXA 4NSRA 5E6JA 3TE6A 4J3CA 3SHFA 1L8QA 3HJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCM X;  4CNG A;  4YPX A;  2YY8 A;  4YQJ A;  4YPZ A;  4FAK A;  2EGW A;  4YQ8 A;  2QMM A;  4YQT A;  1UAL A;  1UAJ A;  1NS5 A;  3L8U A;  2HA8 A;  4KDZ A;  4KGN A;  5CO4 A;  4H3Y A;  2QWV A;  1J85 A;  3BBH A;  4YQ7 A;  4YQ0 A;  4L69 A;  5GMB A;  4YQD A;  1V6Z A;  1UAM A;  4H3Z A;  3BBE A;  4YQ6 A;  1X7O A;  4YQO A;  1MXI A;  3KW2 A;  1IPA A;  4XBO A;  4YQ4 A;  3IC6 A;  4RG1 A;  3AIA A;  4YPW A;  4CND A;  4YQ2 A;  4X3L A;  4MCC A;  1UAK A;  3ILK A;  3QUV A;  4PZK A;  1X7P A;  3KNU A;  5GM8 A;  3NK6 A;  4YVI A;  4CNF A;  4YQ3 A;  4YQG A;  3ONP A;  4YQ5 A;  4MCB A;  4YQB A;  3BBD A;  4YQC A;  4YQP A;  2Z0Y A;  1ZJR A;  1Z85 A;  3AI9 X;  3OII A;  2CX8 A;  5D9F A;  3N4J A;  3NK7 A;  4MCD A;  3O7B A;  4YVG A;  3KY7 A;  2O3A A;  2I6D A;  3OIN A;  4X3M A;  4YQS A;  4YQI A;  4YQA A;  4E8B A;  3AXZ A;  1K3R A;  4JAK A;  4YQ1 A;  1VHY A;  1OY5 A;  4YPY A;  4YQK A;  2EGV A;  1V2X A;  1NXZ A;  4YVJ A;  3GYQ A;  5FAI A;  3KTY A;  4YQQ A;  4YQL A;  3E5Y A;  1P9P A;  2V3K A;  4YVH A;  1TO0 A;  5GMC A;  1GZ0 A;  4YQN A;  1VH0 A;  1VHK A;  3N4K A;  4CNE A;  4YVK A;  4YQ9 A;  4YQR A;  2V3J A;  3IEF A;  1O6D A;  4IG6 A;  3OIJ A;  4J3C A;  4JAL A; 
#chains in the Genus database with same CATH topology
 2N35 A;  3L27 A;  2D7E A;  4GEW A;  1VG5 A;  2XH9 A;  4IBJ A;  2WSC F;  1NJF A;  2Z4S A;  3C3D A;  4M0W A;  4YPX A;  1L2B A;  3DA1 A;  2CUZ A;  3F92 A;  2YY8 A;  1LTM A;  4YQJ A;  3U6D A;  1G4A E;  4FAK A;  1DGG A;  1G41 A;  2EGW A;  2LHG A;  4PDG A;  1OJL A;  2HAK A;  5EP4 A;  3HZJ A;  1IN4 A;  1GLN A;  2OO9 A;  1Y8G A;  4I81 A;  1UAJ A;  2F5O A;  4YQT A;  2K0B X;  4M9S A;  1RU3 A;  1SXJ E;  3IEC A;  3T1H M;  4GIP A;  3ZC7 B;  4PD2 A;  4YHH M;  3AOE A;  4QHT A;  2KNA A;  2QWV A;  2Z8Y M;  3I4V A;  1J85 A;  1TR8 A;  4IJF A;  3ZQJ A;  4YQD A;  2ZTD A;  3GLI B;  4B3S M;  4H3Z A;  5GKN A;  3HWS A;  5H37 D;  2Y0Q A;  4JI3 M;  2QQ8 A;  1F4I A;  3KW2 A;  5KQ8 A;  4KO8 A;  1NY6 A;  3FKE A;  2RKO A;  4B3T M;  3E9S A;  3TWL A;  1QAN A;  3GQ3 A;  4JXJ A;  2UUA M;  2L7I A;  4AI6 A;  5BR8 M;  3GPU A;  4CND A;  2F5N A;  3HU2 A;  3L28 A;  2FNA A;  4QNM A;  4AG6 A;  3HHZ A;  4MCC A;  1UAK A;  3ILK A;  4DV6 M;  4L8R C;  3QUV A;  1PJI A;  2CE7 A;  3KNU A;  3IHP A;  3NK6 A;  1WJ7 A;  2DVW B;  4WUR A;  4CNF A;  4LZZ A;  4QOZ C;  3H4J A;  2DAG A;  3GPP A;  4YQG A;  1K3X A;  1WGL A;  3PNV A;  4KOD A;  1QVR A;  2XFT A;  4IIW A;  2QEN A;  3I01 M;  4NC6 A;  3W0F A;  3K9O A;  3T6P A;  4LG2 A;  3AFH A;  1N34 M;  2HKJ A;  4DV0 M;  2VQE M;  1R4G A;  1Q39 A;  4P16 A;  4B08 A;  3SFZ A;  1N33 M;  1GVN A;  1IXR C;  3GLH E;  3SAU A;  2CV0 A;  3I51 A;  1XWI A;  3EIH A;  4DR4 M;  2Z0Y A;  4KHP M;  1ZJR A;  3AI9 X;  4RF1 A;  1DGH B;  1Q3B A;  4JI7 M;  3CF0 A;  2LXE A;  4L16 A;  2RGO A;  3H4M A;  2DHY A;  3KP0 E;  3M7G A;  4G6Z A;  3NK7 A;  1KFV A;  5IZ7 D;  1N32 M;  4FCT A;  5FTM A;  4FWG A;  4YVG A;  2KNV A;  2K9D A;  7CAT A;  4YY3 M;  4OU7 A;  4G3O A;  4P17 A;  1QZM A;  1J7K A;  3B7N A;  1SXJ A;  2M60 A;  5F3W A;  1TH2 A;  2EA0 A;  2C98 A;  1G8P A;  3KS4 A;  4YQS A;  2CFO A;  2VDB B;  5LMU M;  2KRU A;  3NBX X;  3TWM A;  1OY5 A;  4AKG A;  2Q2E B;  1QZE A;  2YR0 A;  3Q8G A;  3KOZ E;  3FE3 A;  1NXZ A;  3GYQ A;  1D2N A;  3GQ5 A;  2CHV A;  1WIV A;  2MH8 A;  2QBY B;  1DGB A;  2HCB A;  3K9P A;  4LF9 M;  3R9X B;  1IY1 A;  2JZ1 A;  3JAM S;  2FH0 A;  3I4Y A;  4YQQ A;  2CV2 A;  5DYI A;  2BWE A;  2CRU A;  1JR3 D;  2VF7 A;  1VDD A;  3E5Y A;  4YQL A;  2YFQ A;  3GRY A;  3FUT A;  1OAO C;  1R6B X;  5GMC A;  3GPY A;  1GZ0 A;  4KT0 F;  4W5W A;  1VH0 A;  2JY7 A;  2XGN A;  4OVZ B;  5KQD A;  5DFL A;  1OAI A;  2Y20 A;  1K82 A;  3GRR A;  4YQR A;  2JY8 A;  4RF0 A;  4LJA A;  3IG8 A;  5FTK A;  2QHO B;  1WR1 B;  2DWL A;  3GLI E;  3MK6 A;  1O6D A;  2DNA A;  4NRW A;  2W82 A;  2XF3 A;  3A98 B;  1N78 A;  4AKH A;  2MJ5 B;  4JAL A;  5EXP A;  1SG9 A;  3SAV A;  1G71 A;  2DKL A;  5EP2 A;  3GLH A;  2L6O A;  2WZJ A;  1N36 M;  2K6B A;  5A2Q S;  1OTR A;  1VEG A;  1W5T A;  3HJ8 A;  2L4E A;  5EJC A;  3SAT A;  4JWF A;  4DR5 M;  3MMP A;  1FJG M;  2F5Q A;  4B3R M;  3LQR A;  1DO2 A;  4IBK A;  4Z8X A;  2G8L A;  3KOY E;  3E21 A;  1ZMU A;  3EIE A;  1IN5 A;  4NL4 H;  1XXH E;  3U60 A;  1NS5 A;  1R5L A;  2CEA A;  2KA6 B;  4LRT A;  2KXE A;  3L8U A;  1D0M A;  4NSO B;  2ERC A;  4I8O A;  4MH0 E;  3U5Z B;  4FD2 A;  4KDZ A;  3B9P A;  5CO4 A;  5KO3 A;  5C18 A;  1YUB A;  1HT1 E;  1QAO A;  3BBH A;  2VII A;  4YQ0 A;  3KVW A;  1WGN A;  3V76 A;  3KDS E;  3GLF B;  4YQO A;  2ZAM A;  4II7 A;  3PVS A;  5KPZ A;  5JI2 E;  4GRI A;  4DV1 M;  2XSZ D;  3FYC A;  4HEO A;  1G3I A;  2UUB M;  3IC6 A;  2DXI A;  3A45 A;  1NJG A;  4FWH A;  1Z5B A;  1L2C A;  2FFJ A;  1HQC A;  2Y0T A;  4WP2 A;  1HR0 M;  5FTJ A;  3KP1 E;  3TWK A;  4YQ2 A;  3UJN A;  5DYG A;  2JNH A;  2R45 A;  2Y21 A;  4LZJ A;  1D0K A;  2BJW A;  2ZBK B;  4B7F A;  3KSJ A;  3HY5 A;  2XZF A;  5GM8 A;  1IXZ A;  1HQY E;  4CIS A;  3GQ4 A;  3KW6 A;  4IBC A;  3FYD A;  1FNN A;  3LW5 F;  1XB2 B;  2J7N A;  3J2P B;  3GLG B;  3ONP A;  2J7O A;  1HT2 E;  1T43 A;  4MM3 B;  1TH3 A;  4I5S A;  5IT9 S;  1L1Z A;  3J80 S;  4X65 M;  5ITX A;  1GL6 A;  2AHM A;  2I7P A;  1NV9 A;  3T38 A;  1TTE A;  2DWZ B;  2C9O A;  2J5Y A;  5FTL A;  1KYI A;  2JY6 B;  3GLI A;  4JI0 M;  2MR9 A;  3B89 A;  4X64 M;  2R4J A;  4YQP A;  2DAI A;  4FWD A;  4IBI A;  3U6E A;  2UUC M;  4JI2 M;  1DV0 A;  3AL0 C;  3OII A;  1J09 A;  4L4U A;  4AQY M;  1WHC A;  3L29 A;  2CX8 A;  3W67 A;  3K1J A;  4M9X A;  4CHT B;  4X62 M;  1EFU B;  3N4J A;  5D9F A;  1E9S A;  1PM5 A;  4DR7 M;  3KFU G;  2YQZ A;  8CAT A;  4JWH A;  4MCD A;  2LVO C;  4IBG A;  3O7B A;  2EJS A;  2O3A A;  4MGY E;  3J27 B;  1E94 E;  2I6D A;  3TPZ A;  4A3V B;  1NHG C;  1QQW A;  1XXH A;  2R4E A;  4Q7J A;  4QNR A;  4DUY M;  3LVV A;  2V6Z M;  1QAM A;  3HJQ A;  1ZV1 A;  1Q3C A;  3K8Z A;  5E26 A;  4YQA A;  1PJJ A;  4MGH A;  3KXE C;  3HU3 A;  3U61 B;  1IQP A;  5JI3 E;  4JAK A;  4DR3 M;  1N77 A;  1XNR M;  3LCV B;  1D0L A;  2EKK A;  4YPY A;  4YQK A;  3KOX E;  3HHW A;  1V2X A;  3MJ5 A;  4AW4 A;  4B7G A;  2KDL A;  2OOB A;  3K2L A;  4DR2 M;  1JB0 F;  2YNM D;  1QUS A;  4KLN A;  4LCB A;  1YE9 A;  1NVM A;  1OFI A;  4GKK M;  1R7R A;  2QSF X;  4L78 A;  1DGH A;  4DV7 M;  1XMO M;  4JI6 M;  4JI1 M;  1NSF A;  2C99 A;  3VKG A;  2V3K A;  2O5R A;  4YVH A;  3SC3 A;  3GRU A;  4LY6 A;  4MGI E;  3ZH9 B;  3K92 A;  4G4O A;  3U6L A;  2C5R A;  4JYA M;  2EUC A;  4R7G A;  3UMM A;  2HHH M;  5KPR A;  1VHK A;  4CNE A;  5FTN A;  3AV0 A;  4LGY A;  4LF8 M;  2F4V M;  2BWB A;  3C58 A;  1OFH A;  2NQ8 C;  2G3Q A;  4F2L A;  1Z5A A;  3IG5 A;  2DZN B;  3OIJ A;  4YQ3 A;  4DV3 M;  1IXS A;  3D8B A;  1QDR A;  3FD9 A;  2O01 F;  1Z5C A;  5ITR A;  3R8F A;  4CNG A;  2R62 A;  3RE8 A;  3KSX A;  1QAQ A;  2KZU A;  3FTD A;  4I4L A;  2Z7J A;  2LNH C;  2XZU A;  3PXG A;  1IFY A;  2BJV A;  1SXJ D;  3CGW A;  4GC9 A;  5EXT A;  4YQ8 A;  1SXJ B;  4DR6 M;  1V34 A;  3QAU A;  4AG5 A;  1GO5 A;  4MGZ E;  2R18 A;  4JWJ A;  2MRO B;  1TDH A;  3FTC A;  2QBY A;  1UAL A;  3L26 A;  2DWN A;  1NV8 A;  4LJ5 A;  4KGN A;  4H3Y A;  1EIJ A;  2ZAO A;  5ITX E;  4L69 A;  5GMB A;  3GP1 A;  4B7H A;  1V6Z A;  3U6S A;  1PJT A;  1UAM A;  2QPA A;  2QP9 X;  4YQ6 A;  1ORY B;  2JXN A;  2DAK A;  4OVZ A;  4YQ4 A;  5IWA M;  3LVW A;  4NXN M;  2D7G A;  4RKU F;  2EKF A;  4F1I A;  3GPX A;  1HNZ M;  2O25 A;  3SYL A;  3WHL A;  3J81 S;  3OTO M;  2CV1 A;  4RG1 A;  3AIA A;  2BNK A;  4ANR A;  4G4N A;  2APL A;  1A5T A;  1YLA A;  3VK7 A;  4G4Q A;  4MGK E;  1GL7 A;  4DUZ M;  4X3L A;  1E32 A;  1Q02 A;  3TL4 X;  3LCU A;  2DZL A;  4NOO B;  1N75 A;  4REZ A;  4DR1 M;  2H5X A;  4GHL A;  4LGM A;  2XLJ A;  3T1Y M;  2JZ0 A;  4K0K M;  3RGS A;  2R65 A;  4CGY B;  2JY5 A;  1IN7 A;  4G4R A;  2ZAN A;  3FUV A;  3U6Q A;  4D80 A;  4JV5 M;  2R6F A;  1MJG M;  3SMS A;  3RGP A;  3U5Z A;  3GLH B;  4LJ6 A;  5BPV A;  4B3M M;  1MX0 A;  4LFB M;  5EXX A;  2LHC A;  2A5Y B;  2FOI C;  3WHK A;  5KPT A;  3SYK A;  3J7B A;  3U6P A;  1QUT A;  5ITT A;  4MCB A;  2HL7 A;  1IN6 A;  1XNQ M;  2X4A A;  3HX3 A;  4PCZ A;  4YQB A;  1S3S A;  3BBD A;  2LVP C;  1NNU C;  1UFZ A;  4YQC A;  2CP8 A;  1TH4 A;  1KSF X;  4FCW A;  1T3T A;  2X49 A;  1Z85 A;  4DV4 M;  4JWG A;  2R46 A;  2LVN C;  4S12 A;  1OKS A;  4IBB A;  3LQQ A;  2WSF F;  2DEN A;  3FUW A;  3QYE A;  1J5E M;  1QYR A;  4LF7 M;  3JR5 A;  1VDL A;  2L7H A;  3C3E A;  5EQT A;  3SHG B;  4XGI A;  3U6C A;  2L2D A;  5ITQ A;  2H1R A;  2ZTC A;  3FRI A;  4JI5 M;  1IY2 A;  3C9P A;  3QYB A;  3SMP A;  2OOA A;  3HU1 A;  3W0L B;  4XK8 F;  4YQI A;  4Y28 F;  3E46 A;  3U6M A;  2JA2 A;  2KW0 A;  3AKZ A;  1NO1 A;  5EP1 A;  3AXZ A;  2JP7 A;  4QOS A;  4YQ1 A;  1VHY A;  1PRB A;  3SAS A;  4JI8 M;  1P3Q Q;  1JQJ C;  1TF0 B;  2LH0 A;  2LVQ D;  4D82 A;  4LFA M;  4YVJ A;  4L15 A;  1G59 A;  5FAI A;  3KTY A;  3I04 M;  3B7Q A;  4UN2 B;  1OQY A;  1WXQ A;  3CF6 E;  4QHS A;  5FSW A;  4LRS A;  3VLF B;  4DBG B;  2KEB A;  1NHW C;  3RFW A;  3W68 A;  1GKI A;  2FE8 A;  1Z6T A;  1C7Y A;  2DAE A;  1ZQ9 A;  3BBZ A;  3VDU A;  2ZM6 M;  4LJ7 A;  3NWL A;  3FTF A;  1XMQ M;  1TO0 A;  1DGF A;  4IJE A;  2DAM A;  1AIP C;  1JR3 E;  3FUU A;  2GQF A;  2QZ4 A;  4YVK A;  5LMN M;  4LF6 M;  1AUA A;  2CWB A;  3ZCB B;  2UXB M;  1V33 A;  2R44 A;  4FW9 A;  5DNY A;  3M0E A;  1EE8 A;  2Z3X A;  4IBE A;  1DO0 A;  1OIP A;  3B7Z A;  2XFS A;  1XHB A;  4M0D A;  4X66 M;  2VQF M;  4IG6 A;  4GKJ M;  1OIZ A;  1NNJ A;  1ZMV A;  3NBI A;  3DCM X;  3KOW E;  3TQS A;  3U61 A;  4R3D A;  1GJS A;  3AOE C;  3M6A A;  4YPZ A;  4NRV A;  4ITQ A;  1XXH B;  2KNZ A;  2CHQ A;  2LTU A;  3PNY A;  2JUJ A;  2QMM A;  4PT5 A;  2G5G X;  1VEJ A;  2LBC A;  4ZPX A;  3UK6 A;  3PFI A;  2HA8 A;  3A42 A;  3D8L A;  2P5T A;  2I7N A;  2L09 A;  1UM8 A;  3KS8 A;  3FRH A;  1L2D A;  1LV7 A;  4FVM A;  4GHA A;  4YQ7 A;  4WW0 A;  2MGW A;  2R0I A;  4CIZ A;  1V92 A;  3BBE A;  1HJP A;  1X7O A;  2DWM A;  4GH9 A;  2CHG A;  4BB9 A;  1MXI A;  3JR4 A;  4XBO A;  1IBK M;  3VFD A;  1IPA A;  3L2A A;  4HLQ A;  1C1K A;  4L6V 6;  3GLF E;  2OQ4 A;  4JI4 M;  4DV5 M;  4LJ8 A;  3UGJ A;  1Z59 A;  2L4F A;  4YPW A;  4IBF A;  1W5S A;  3U6O A;  4OX9 M;  4EIW A;  3E4R A;  2D7H A;  1L1T A;  2C96 A;  1MN3 A;  1XC8 A;  4PZK A;  1X7P A;  3AOG A;  4YVI A;  2OPF A;  1IN8 A;  2V1C A;  2F5S A;  3THG A;  1CUK A;  4Z6Y A;  3MHV C;  3Q8X A;  4YQ5 A;  1YSY A;  4FMW A;  1MU5 A;  3HHY A;  1X37 A;  4IBD A;  5FLX S;  4BLC A;  1IXS B;  1JR3 A;  3GLG E;  2V1U A;  2DZO B;  1TDZ A;  1QDT A;  4GC5 A;  4RNA A;  3L25 A;  1NY5 A;  4TUW A;  3A46 A;  1E9R A;  3FTE A;  4JN6 A;  3SAR A;  3DFZ A;  4DV2 M;  3UZU A;  1I94 M;  1I4W A;  2QCU A;  4LJ9 A;  3SAW A;  2EO2 A;  3HHX A;  1T6O A;  2HWJ A;  2DHR A;  3T15 A;  1IBL M;  1SXJ C;  1VQ1 A;  4D81 A;  2GNO A;  1PJS A;  3DZD A;  5C1B A;  3CF2 A;  1TGU A;  4AKI A;  2LVA A;  3B74 A;  4LJ4 A;  1K3W A;  2JWS A;  2XEP A;  2FS1 A;  3KY7 A;  4FCV A;  3GO8 A;  2F5P A;  3OIN A;  1HNX M;  4M9Z A;  3VDP A;  3HKP A;  4X3M A;  4PDI A;  4CJ6 A;  5ITU A;  3AJI B;  2UU9 M;  3DOA A;  1PJQ A;  1GAB A;  1H6U A;  2B3T A;  2X8A A;  3BXW A;  2VF8 A;  1ZAE A;  3HGI A;  3CTW B;  1R2Y A;  1R2Z A;  5EP3 A;  4E8B A;  1K3R A;  3FUX A;  1IBM M;  4LF5 M;  3LMM A;  4OW0 A;  5L8R F;  2WSE F;  1HNW M;  2EGV A;  3GLF A;  4GMQ A;  4HL4 A;  4R71 A;  5EXS A;  1ZMW A;  2KHH A;  3U60 B;  2XSZ A;  4AZF A;  3J7A S;  2E5L M;  2Z4R A;  3QWL A;  1BVS A;  1PGY A;  1P9P A;  4LFC M;  2K47 A;  2RRU A;  1VEK A;  2RGH A;  2KRK A;  3VKH A;  4YQN A;  3SBJ A;  3GRV A;  4GIT A;  4MB7 A;  2C9C A;  4LF4 M;  3N4K A;  2UXC M;  4NXM M;  5IRE B;  4YQ9 A;  2M5Z A;  2V3J A;  2QNJ A;  3VK8 A;  2UXD M;  5ITY A;  1IM2 A;  3IEF A;  4BBA A;  2KZS A;  1IY0 A;  1GJT A;  2DI0 A;  3BOS A;  3GLG A;  2LWX A;  4NSR A;  5E6J A;  3TE6 A;  4J3C A;  3SHF A;  1L8Q A;  3HJS A; 
#chains in the Genus database with same CATH homology
 3L27 A;  2D7E A;  2XH9 A;  4IBJ A;  1NJF A;  2Z4S A;  4M0W A;  4YPX A;  1L2B A;  3DA1 A;  2CUZ A;  2YY8 A;  4YQJ A;  3U6D A;  1G4A E;  4FAK A;  1DGG A;  1G41 A;  2EGW A;  4PDG A;  1OJL A;  5EP4 A;  1IN4 A;  1GLN A;  4I81 A;  1UAJ A;  2F5O A;  4YQT A;  4M9S A;  3T1H M;  1SXJ E;  4GIP A;  3ZC7 B;  4PD2 A;  4YHH M;  3AOE A;  4QHT A;  2QWV A;  3I4V A;  1J85 A;  4IJF A;  4YQD A;  3GLI B;  4B3S M;  4H3Z A;  5GKN A;  3HWS A;  5H37 D;  2Y0Q A;  4JI3 M;  3KW2 A;  5KQ8 A;  4KO8 A;  1NY6 A;  3FKE A;  2RKO A;  4B3T M;  3E9S A;  3TWL A;  1QAN A;  3GQ3 A;  4JXJ A;  2UUA M;  2L7I A;  4AI6 A;  5BR8 M;  3GPU A;  4CND A;  2F5N A;  3HU2 A;  3L28 A;  2FNA A;  4QNM A;  4AG6 A;  3HHZ A;  4MCC A;  1UAK A;  3ILK A;  4DV6 M;  4L8R C;  3QUV A;  1PJI A;  2CE7 A;  3KNU A;  3NK6 A;  2DVW B;  4WUR A;  4CNF A;  4LZZ A;  4QOZ C;  3GPP A;  4YQG A;  1K3X A;  4KOD A;  3PNV A;  1QVR A;  2XFT A;  4IIW A;  2QEN A;  3W0F A;  4LG2 A;  3AFH A;  1N34 M;  2HKJ A;  4DV0 M;  2VQE M;  1Q39 A;  4P16 A;  4B08 A;  3SFZ A;  1N33 M;  1GVN A;  1IXR C;  3SAU A;  2CV0 A;  3I51 A;  1XWI A;  3EIH A;  4DR4 M;  2Z0Y A;  4KHP M;  1ZJR A;  3AI9 X;  4RF1 A;  1DGH B;  1Q3B A;  4JI7 M;  3CF0 A;  2LXE A;  4L16 A;  2RGO A;  3H4M A;  3M7G A;  3KP0 E;  4G6Z A;  3NK7 A;  1KFV A;  5IZ7 D;  1N32 M;  4FCT A;  5FTM A;  4FWG A;  4YVG A;  7CAT A;  4YY3 M;  4OU7 A;  1QZM A;  1J7K A;  1SXJ A;  2M60 A;  5F3W A;  1TH2 A;  2EA0 A;  2C98 A;  1G8P A;  3KS4 A;  4YQS A;  2CFO A;  5LMU M;  2KRU A;  3TWM A;  1OY5 A;  4AKG A;  2Q2E B;  2YR0 A;  3KOZ E;  1NXZ A;  3GYQ A;  1D2N A;  3GQ5 A;  2CHV A;  2QBY B;  4LF9 M;  1DGB A;  2HCB A;  3R9X B;  1IY1 A;  3JAM S;  3I4Y A;  4YQQ A;  2CV2 A;  5DYI A;  1JR3 D;  3E5Y A;  1VDD A;  4YQL A;  2YFQ A;  3GRY A;  3FUT A;  1R6B X;  5GMC A;  3GPY A;  1GZ0 A;  4W5W A;  1VH0 A;  5KQD A;  2XGN A;  4OVZ B;  1K82 A;  2Y20 A;  3GRR A;  4YQR A;  4RF0 A;  4LJA A;  3IG8 A;  5FTK A;  2DWL A;  1O6D A;  3MK6 A;  4NRW A;  2W82 A;  2XF3 A;  3A98 B;  1N78 A;  4AKH A;  4JAL A;  5EXP A;  3SAV A;  5EP2 A;  3GLH A;  2L6O A;  1N36 M;  5A2Q S;  1W5T A;  3HJ8 A;  5EJC A;  3SAT A;  4JWF A;  4DR5 M;  1FJG M;  2F5Q A;  4B3R M;  3LQR A;  1DO2 A;  4IBK A;  4Z8X A;  2G8L A;  3KOY E;  3EIE A;  1IN5 A;  4NL4 H;  3U60 A;  1NS5 A;  2KA6 B;  2CEA A;  3L8U A;  4LRT A;  2KXE A;  4KDZ A;  4NSO B;  2ERC A;  4I8O A;  4MH0 E;  3U5Z B;  4FD2 A;  5CO4 A;  3B9P A;  5KO3 A;  5C18 A;  1YUB A;  1HT1 E;  1QAO A;  3BBH A;  2VII A;  4YQ0 A;  3KVW A;  3KDS E;  3GLF B;  4YQO A;  2ZAM A;  4II7 A;  3PVS A;  5KPZ A;  5JI2 E;  4GRI A;  4DV1 M;  2XSZ D;  3FYC A;  2UUB M;  1G3I A;  3IC6 A;  2DXI A;  3A45 A;  1NJG A;  4FWH A;  1Z5B A;  1L2C A;  2FFJ A;  1HQC A;  2Y0T A;  1HR0 M;  5FTJ A;  3KP1 E;  3TWK A;  4YQ2 A;  3UJN A;  5DYG A;  2R45 A;  2Y21 A;  4LZJ A;  2BJW A;  2ZBK B;  4B7F A;  3KSJ A;  2XZF A;  5GM8 A;  1IXZ A;  1HQY E;  4CIS A;  3GQ4 A;  3KW6 A;  4IBC A;  3FYD A;  1FNN A;  2J7N A;  3J2P B;  3GLG B;  3ONP A;  2J7O A;  1HT2 E;  4MM3 B;  1TH3 A;  4I5S A;  5IT9 S;  1L1Z A;  3J80 S;  4X65 M;  5ITX A;  1GL6 A;  2AHM A;  2I7P A;  3T38 A;  2DWZ B;  2C9O A;  5FTL A;  1KYI A;  3GLI A;  4JI0 M;  4X64 M;  2R4J A;  4YQP A;  4FWD A;  4IBI A;  3U6E A;  2UUC M;  4JI2 M;  3AL0 C;  3OII A;  1J09 A;  4L4U A;  4AQY M;  3L29 A;  2CX8 A;  4CHT B;  3K1J A;  4M9X A;  4X62 M;  3N4J A;  5D9F A;  1E9S A;  1PM5 A;  4DR7 M;  3KFU G;  2YQZ A;  8CAT A;  4JWH A;  4MCD A;  4IBG A;  3O7B A;  2O3A A;  4MGY E;  3J27 B;  1E94 E;  2I6D A;  3TPZ A;  4A3V B;  1NHG C;  1QQW A;  1XXH A;  2R4E A;  4QNR A;  4DUY M;  3LVV A;  2V6Z M;  1QAM A;  3HJQ A;  1Q3C A;  3K8Z A;  5E26 A;  4YQA A;  1PJJ A;  4MGH A;  3KXE C;  3HU3 A;  3U61 B;  1IQP A;  5JI3 E;  4JAK A;  4DR3 M;  1N77 A;  1XNR M;  4YPY A;  4YQK A;  3KOX E;  3HHW A;  1V2X A;  3MJ5 A;  4AW4 A;  4B7G A;  3K2L A;  4DR2 M;  2YNM D;  4KLN A;  4LCB A;  1YE9 A;  1NVM A;  1OFI A;  4GKK M;  1R7R A;  1XMO M;  4L78 A;  1DGH A;  4DV7 M;  4JI6 M;  4JI1 M;  2V3K A;  1NSF A;  2C99 A;  3VKG A;  2O5R A;  4YVH A;  3SC3 A;  3GRU A;  4LY6 A;  4MGI E;  3ZH9 B;  3K92 A;  4G4O A;  3U6L A;  2C5R A;  4JYA M;  2EUC A;  4R7G A;  3UMM A;  2HHH M;  5KPR A;  1VHK A;  4CNE A;  5FTN A;  3AV0 A;  4LGY A;  4LF8 M;  2F4V M;  3C58 A;  1OFH A;  2NQ8 C;  1Z5A A;  3IG5 A;  2DZN B;  3OIJ A;  4YQ3 A;  4DV3 M;  3D8B A;  3FD9 A;  5ITR A;  1Z5C A;  3R8F A;  4CNG A;  2R62 A;  3RE8 A;  3KSX A;  1QAQ A;  2KZU A;  3FTD A;  4I4L A;  2Z7J A;  2LNH C;  2XZU A;  3PXG A;  2BJV A;  1SXJ D;  4GC9 A;  5EXT A;  4YQ8 A;  1SXJ B;  4DR6 M;  4AG5 A;  3QAU A;  4JWJ A;  4MGZ E;  2R18 A;  2QBY A;  1TDH A;  3FTC A;  1UAL A;  3L26 A;  2DWN A;  4LJ5 A;  4KGN A;  4H3Y A;  2ZAO A;  5ITX E;  4L69 A;  5GMB A;  3GP1 A;  4B7H A;  1V6Z A;  3U6S A;  1UAM A;  2QPA A;  2QP9 X;  4YQ6 A;  1ORY B;  4OVZ A;  4YQ4 A;  5IWA M;  3LVW A;  4NXN M;  2D7G A;  3GPX A;  1HNZ M;  3SYL A;  3WHL A;  3J81 S;  3OTO M;  2CV1 A;  4RG1 A;  3AIA A;  2BNK A;  4G4N A;  3VK7 A;  4X3L A;  4G4Q A;  4MGK E;  1GL7 A;  4DUZ M;  1E32 A;  3TL4 X;  4REZ A;  4NOO B;  1N75 A;  4DR1 M;  4GHL A;  4LGM A;  2XLJ A;  3T1Y M;  4K0K M;  3RGS A;  2R65 A;  4CGY B;  1IN7 A;  4G4R A;  2ZAN A;  3FUV A;  3U6Q A;  4D80 A;  4JV5 M;  3SMS A;  3RGP A;  3U5Z A;  3GLH B;  4LJ6 A;  5BPV A;  4B3M M;  1MX0 A;  4LFB M;  5EXX A;  2A5Y B;  2FOI C;  3WHK A;  5KPT A;  3U6P A;  3SYK A;  3J7B A;  4MCB A;  5ITT A;  2HL7 A;  1IN6 A;  1XNQ M;  2X4A A;  4YQB A;  4PCZ A;  1S3S A;  3BBD A;  1NNU C;  4YQC A;  1TH4 A;  1KSF X;  4FCW A;  1T3T A;  2X49 A;  1Z85 A;  4DV4 M;  4JWG A;  2R46 A;  4S12 A;  4IBB A;  3LQQ A;  3FUW A;  1J5E M;  4LF7 M;  1QYR A;  3JR5 A;  2L7H A;  5EQT A;  3SHG B;  4XGI A;  3U6C A;  5ITQ A;  2H1R A;  4JI5 M;  1IY2 A;  3SMP A;  3HU1 A;  3W0L B;  4YQI A;  3U6M A;  2JA2 A;  2KW0 A;  3AKZ A;  5EP1 A;  3AXZ A;  4QOS A;  4YQ1 A;  1VHY A;  3SAS A;  4JI8 M;  2LH0 A;  1JQJ C;  4YVJ A;  4D82 A;  4LFA M;  4L15 A;  1G59 A;  5FAI A;  3KTY A;  3CF6 E;  1WXQ A;  4QHS A;  5FSW A;  4LRS A;  3VLF B;  2KEB A;  1NHW C;  3RFW A;  1GKI A;  1Z6T A;  2FE8 A;  3VDU A;  1ZQ9 A;  2ZM6 M;  4LJ7 A;  3NWL A;  3FTF A;  1XMQ M;  1TO0 A;  1DGF A;  4IJE A;  3FUU A;  2QZ4 A;  4YVK A;  5LMN M;  4LF6 M;  3ZCB B;  2UXB M;  4FW9 A;  5DNY A;  3M0E A;  1EE8 A;  2Z3X A;  4IBE A;  1DO0 A;  4X66 M;  4IG6 A;  2XFS A;  1XHB A;  4M0D A;  2VQF M;  4GKJ M;  1NNJ A;  3NBI A;  3DCM X;  3KOW E;  3TQS A;  3U61 A;  4R3D A;  3AOE C;  3M6A A;  4YPZ A;  4NRV A;  4ITQ A;  1XXH B;  2CHQ A;  3PNY A;  2QMM A;  4PT5 A;  2G5G X;  4ZPX A;  3UK6 A;  3PFI A;  2HA8 A;  3A42 A;  3D8L A;  2P5T A;  2I7N A;  2L09 A;  1UM8 A;  3KS8 A;  1L2D A;  1LV7 A;  4FVM A;  4GHA A;  4YQ7 A;  4WW0 A;  3BBE A;  1X7O A;  2DWM A;  4GH9 A;  2CHG A;  4BB9 A;  1MXI A;  3JR4 A;  4XBO A;  1IBK M;  3VFD A;  1IPA A;  3L2A A;  4HLQ A;  1C1K A;  2OQ4 A;  4JI4 M;  4DV5 M;  4LJ8 A;  3UGJ A;  1Z59 A;  4YPW A;  4IBF A;  1W5S A;  3U6O A;  4OX9 M;  4EIW A;  3E4R A;  2D7H A;  1L1T A;  2C96 A;  1XC8 A;  4PZK A;  1X7P A;  3AOG A;  4YVI A;  2OPF A;  1IN8 A;  2V1C A;  2F5S A;  3THG A;  4Z6Y A;  3MHV C;  3Q8X A;  4YQ5 A;  1YSY A;  4FMW A;  1MU5 A;  3HHY A;  1X37 A;  4IBD A;  5FLX S;  4BLC A;  1IXS B;  1JR3 A;  2V1U A;  2DZO B;  1TDZ A;  4RNA A;  4GC5 A;  3L25 A;  1NY5 A;  4TUW A;  3A46 A;  1E9R A;  3FTE A;  4JN6 A;  3SAR A;  3DFZ A;  4DV2 M;  3UZU A;  1I94 M;  1I4W A;  2QCU A;  4LJ9 A;  3SAW A;  2EO2 A;  3HHX A;  3T15 A;  2DHR A;  1IBL M;  1SXJ C;  4D81 A;  3DZD A;  5C1B A;  3CF2 A;  1TGU A;  4AKI A;  4LJ4 A;  1K3W A;  2XEP A;  3KY7 A;  4FCV A;  3GO8 A;  3OIN A;  1HNX M;  4M9Z A;  3VDP A;  3HKP A;  4X3M A;  4PDI A;  5ITU A;  3AJI B;  2UU9 M;  3DOA A;  1H6U A;  2X8A A;  2F5P A;  1R2Y A;  1ZAE A;  3HGI A;  3CTW B;  1R2Z A;  5EP3 A;  4E8B A;  1K3R A;  3FUX A;  1IBM M;  4LF5 M;  3LMM A;  4OW0 A;  1HNW M;  2EGV A;  3GLF A;  4GMQ A;  4HL4 A;  5EXS A;  3U60 B;  2XSZ A;  4AZF A;  3J7A S;  2E5L M;  2Z4R A;  3QWL A;  1P9P A;  4LFC M;  2K47 A;  2RGH A;  2KRK A;  3VKH A;  4YQN A;  3SBJ A;  3GRV A;  4GIT A;  4MB7 A;  2C9C A;  4LF4 M;  3N4K A;  2UXC M;  4NXM M;  5IRE B;  4YQ9 A;  2M5Z A;  2V3J A;  3VK8 A;  2UXD M;  5ITY A;  1IM2 A;  3IEF A;  4BBA A;  2KZS A;  1IY0 A;  3BOS A;  3GLG A;  2LWX A;  4NSR A;  5E6J A;  3TE6 A;  4J3C A;  3SHF A;  1L8Q A;  3HJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...