3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
4YQOA 4KDZA 3KNUA 4CNGA 2CX8A 4X3LA 3E5YA 4MCDA 1X7OA 3IC6A 4YQ7A 2O3AA 1Z85A 4PZKA 3O7BA 4YQAA 4YVIA 3GYQA 4YQCA 4E8BA 1NXZA 1VHYA 2EGVA 3ONPA 4YQRA 4YVGA 4IG6A 3N4JA 3OIIA 3AI9X 4YQ9A 4YQ1A 4YQKA 1VH0A 4YQ4A 3KW2A 3ILKA 1UAMA 4YQQA 5CO4A 4YVHA 1P9PA 4YQJA 1VHKA 4H3ZA 5GM8A 1NS5A 4YQ8A 5GMCA 3NK7A 3DCMX 1OY5A 4YVJA 2EGWA 4H3YA 4YQBA 4YQ3A 2QWVA 4YQ0A 1ZJRA 3BBHA 1O6DA 3BBEA 1GZ0A 4JALA 3AIAA 4CNDA 4CNFA 4YVKA 3QUVA 1X7PA 4YQ6A 4YQ5A 4KGNA 2YY8A 4YQ2A 3AXZA 4MCCA 4XBOA 1UALA 2Z0YA 4YQIA 2V3JA 1V6ZA 4FAKA 1UAJA 1V2XA 1TO0A 5FAIA 1J85A 4YPWA 4JAKA 4J3CA 2V3KA 4L69A 3KY7A 4YQSA 1UAKA 3BBDA 4YQTA 4YQDA 5D9FA 2QMMA 2I6DA 4YQPA 3L8UA 4X3MA 3OINA 1IPAA 2HA8A 4MCBA 4YPZA 4YPXA 4YQLA 5GMBA 4YQNA 4CNEA 3IEFA 1K3RA 4RG1A 1MXIA 3NK6A 3OIJA 3KTYA 3N4KA 4YQGA 4YPYA
chains in the Genus database with same CATH superfamily
4YQOA 3GLFB 1G8PA 4PDGA 5EP2A 3C9PA 3U61A 4CNGA 2DZOB 2LVNC 4AKHA 2CHGA 3LMMA 1Z5CA 4FWHA 4S12A 4CGYB 3A42A 2R6FA 4RF0A 4PCZA 1C1KA 4YQ7A 2X49A 1IQPA 2A5YB 4G4RA 3R8FA 1HNXM 4PZKA 3GP1A 5ITXE 1PJIA 4LFAM 1IM2A 3GLHE 3SBJA 1V92A 2FE8A 3CGWA 3UZUA 5KPRA 2F5PA 2BWEA 2CEAA 4FW9A 5C18A 1NXZA 1WIVA 2DI0A 2ZAOA 4MGZE 1N34M 4LF7M 1VHYA 2DENA 5KO3A 3VLFB 1MX0A 1R5LA 2V6ZM 3D8LA 2DWZB 4YQ9A 1OAOC 5FSWA 3SAVA 3NBXX 4D80A 3SHFA 4YQ1A 4AQYM 4YQ4A 4M0DA 2HHHM 1K3XA 1E9RA 1XXHA 1IBKM 2D7HA 2CHQA 4IBGA 2UXBM 3KVWA 2BWBA 1OIPA 2QP9X 2XFTA 2EKKA 4XGIA 3GLFA 5CO4A 1NY6A 2LHGA 1QDRA 3KS4A 2OOBA 4LF9M 2OPFA 1DGBA 2QSFX 4IBCA 2XFSA 3GQ4A 4LF4M 2XZFA 2ZAMA 2R45A 4HL4A 1EIJA 3EIHA 3NK7A 3BBZA 1IY2A 2F5NA 1OY5A 3SASA 1TGUA 2G5GX 2HAKA 1EFUB 3H4JA 3QYEA 2RRUA 5ITUA 5DFLA 5FLXS 4YQ3A 3KOWE 3I51A 1ZJRA 3BBHA 1O6DA 1Q3CA 2QPAA 4BB9A 3U6PA 4NRWA 4IBJA 3AIAA 4LCBA 4CJ6A 4HLQA 3R9XB 3FRHA 1Z59A 4YVKA 4X66M 1JR3A 4YQ6A 4I8OA 3FTCA 1NNJA 1ZMWA 2DVWB 4LJ8A 4NXNM 4NL4H 1JR3E 4WURA 4YQ2A 1T3TA 3DFZA 1WJ7A 1D2NA 2ERCA 3DA1A 4P16A 1R2ZA 1D0LA 3TWKA 3GO8A 3GLIB 4DV6M 2CUZA 3TE6A 1PGYA 4D82A 2JP7A 3SMSA 2EJSA 3HHZA 1E9SA 4KO8A 4LJ6A 2R0IA 1GL7A 2DAKA 3EIEA 3GLGB 2JY8A 3JAMS 1UAJA 1JQJC 1XNQM 1IXZA 5IREB 3B7ZA 2JY7A 2UXDM 3T15A 1J85A 3IG5A 4R3DA 1UM8A 2Z7JA 3GPUA 1WGLA 3THGA 2Q2EB 1G59A 4JI5M 1V34A 4L69A 1ZV1A 3AOGA 3JR4A 2M5ZA 3L29A 4X64M 3CTWB 4LJAA 4R7GA 3E4RA 4LJ9A 2HKJA 3FTEA 3KP1E 3TQSA 3FE3A 4GKKM 4JI1M 3VKGA 3KOZE 2DAIA 1J5EM 4AKGA 1VDDA 1IN4A 3FUWA 4I81A 2M60A 4GIPA 4JWFA 3T38A 3L8UA 4YQPA 1OAIA 2R46A 3OINA 1KYIA 5DYGA 1OFIA 2KNVA 2LNHC 4MGHA 1NO1A 5DNYA 4F2LA 5ITTA 3GLIA 4CIZA 2RKOA 3KDSE 4KODA 3KS8A 4K0KM 1WXQA 2QENA 2V1UA 3U6SA 3FUVA 4CNEA 1Q39A 4XK8F 3GLGA 1MXIA 3NK6A 1N75A 4HEOA 4P17A 4GEWA 3KTYA 2QNJA 2R4EA 4YQGA 1SXJB 2UU9M 2HL7A 1NJGA 5FTJA 4JAKA 2J5YA 5EP4A 3GLGE 4JWGA 3KNUA 3AFHA 2O25A 4M0WA 4QOSA 3ZQJA 3VK8A 4X3LA 3KFUG 4MCDA 3J7BA 2O3AA 2X4AA 4FD2A 2L4FA 4AI6A 4LGYA 1R2YA 4R71A 3O7BA 1VDLA 4NOOB 2APLA 5EP3A 4GITA 3HZJA 3D8BA 3LQRA 3A46A 4DV7M 4E8BA 1QUSA 1NNUC 1CUKA 4DR2M 2JUJA 4Z6YA 2L6OA 3U6CA 2DXIA 4G6ZA 4LF5M 3AJIB 3A45A 3FD9A 3FTDA 3N4JA 2DNAA 4FMWA 4KHPM 2MROB 4PD2A 4PDIA 3K9OA 3VK7A 2F5SA 3HJSA 3U6LA 3I04M 1HQCA 2CHVA 3HHXA 3KSXA 3AOEC 1E94E 2F4VM 4JYAM 2Z3XA 3IG8A 4A3VB 3KW2A 5A2QS 1SXJA 2Y0QA 3NWLA 3ILKA 2KZSA 3I01M 4YVHA 1I94M 1DGHA 2B3TA 4LF8M 1IN8A 1J7KA 2BNKA 3KSJA 2KDLA 1P9PA 1SXJE 2YR0A 3KW6A 4YQJA 4QHSA 4I4LA 5ITQA 5JI2E 1IBMM 1VHKA 4DR3M 4JWJA 5GM8A 3TWLA 3UMMA 4GC9A 1NS5A 4OVZB 3UGJA 4YHHM 2JA2A 3GRRA 3LQQA 4QOZC 4YVJA 3IHPA 4F1IA 2R18A 4DV5M 3U6OA 4DV4M 4IBBA 4AG6A 3MJ5A 4UN2B 4NSRA 3K1JA 4JALA 1F4IA 5C1BA 1AUAA 3KOXE 3GQ5A 2KEBA 3J80S 1XMQM 1NV8A 4IBEA 1K82A 4CNFA 3VFDA 4LRTA 4YQ5A 4LZJA 1KFVA 2RGHA 3C3EA 2QBYB 3C3DA 1ZMUA 2BJVA 1XXHE 2AHMA 2G8LA 2WSFF 4M9SA 4B08A 4G4OA 4GHLA 5IT9S 3AXZA 2ZM6M 1HT1E 4MCCA 1OKSA 3DZDA 4XBOA 3FRIA 3GLFE 4BBAA 4YQIA 3M6AA 3V76A 1L1TA 2DWLA 2Y0TA 2QQ8A 4DR7M 4FAKA 4ANRA 3U6MA 2CFOA 2VF7A 3IECA 3E21A 1LV7A 3WHLA 4J3CA 3HU1A 2VQFM 2DAEA 2QZ4A 2OQ4A 4MGYE 5LMNM 2CV2A 4JI8M 3Q8GA 3QWLA 3HGIA 3BBDA 5EXXA 4B7GA 1TF0B 1IXSB 4DV2M 1IBLM 2WZJA 1C7YA 2QMMA 4M9XA 3E9SA 3L26A 1G41A 1KSFX 5IZ7D 1D0KA 2GNOA 3SARA 3LCVB 3UK6A 5FTLA 1L8QA 3L28A 4LGMA 3ZH9B 2JXNA 4ITQA 2QBYA 3J81S 4X3MA 2F5OA 1IPAA 2HA8A 3TL4X 4MCBA 3T1YM 1QAQA 3FUUA 1R4GA 2HWJA 1QUTA 2LXEA 3HHWA 8CATA 1VEGA 2L4EA 4OW0A 2GQFA 2C96A 4YQNA 2R65A 1XMOM 3FUXA 1L2BA 4RG1A 2KRKA 5KPTA 3OIJA 4FCTA 2YNMD 3RGSA 2CE7A 2QCUA 4JXJA 4YPYA 5FTKA 1VG5A 2MJ5B 2FOIC 1IY0A 4KDZA 2CX8A 3GPYA 1GL6A 2MR9A 3UJNA 5BR8M 1X7OA 1IXSA 3B74A 2DWNA 3CF0A 1GLNA 1Z5BA 2DKLA 3CF2A 4IBDA 3OTOM 1QZMA 4YVIA 3LCUA 3GYQA 5JI3E 2JWSA 2K6BA 3QYBA 2XSZD 1IFYA 2QHOB 3B7NA 1QVRA 4QNRA 3FYCA 3ONPA 2EO2A 4RF1A 2ZANA 3U5ZB 4IG6A 3OIIA 4YVGA 4L8RC 3W68A 1HNZM 4GC5A 2K9DA 4I5SA 4QHTA 1QQWA 5BPVA 3GLIE 1VH0A 3TWMA 4L4UA 1N77A 3KP0E 1OTRA 1QYRA 1QANA 3U6DA 2Z4SA 3I4YA 3CF6E 2K47A 1MJGM 4GMQA 5E6JA 2E5LM 1UAMA 2C98A 2KW0A 3HWSA 5KQ8A 3AKZA 2P5TA 4LJ7A 1K3WA 2KHHA 2O5RA 1TDZA 4W5WA 4H3ZA 1N36M 1RU3A 1W5TA 3A98B 1X37A 4MM3B 1WR1B 4LG2A 4YQ8A 5GMCA 3HY5A 4Z8XA 1Q3BA 2L09A 2VQEM 2EGWA 4YQBA 1WHCA 4YQ0A 3U5ZA 4B3MM 1NSFA 1BVSA 5KPZA 3JR5A 2UUCM 1GZ0A 1OJLA 4LY6A 3GLHB 3RGPA 3VDUA 4LJ5A 1YSYA 4IJFA 3K9PA 1XC8A 5EJCA 1X7PA 2J7NA 3PNVA 1YUBA 1HT2E 1SG9A 3HJ8A 4RKUF 4BLCA 4OX9M 1MU5A 2I7PA 4IBKA 4WP2A 2D7EA 4AG5A 2LVOC 2KNAA 2LTUA 2Z4RA 2ZTCA 3GRYA 2YY8A 1J09A 1P3QQ 3NBIA 4G4QA 4B7FA 4IJEA 2JY6B 4M9ZA 1N78A 1UALA 1I4WA 2EA0A 4MH0E 3AOEA 2Z0YA 1NV9A 4NXMM 1TH2A 5FTNA 4YY3M 2WSEF 4WW0A 1PM5A 2V3JA 2JY5A 2R62A 1V2XA 2D7GA 1PJTA 1TO0A 1Q02A 2FS1A 4LF6M 4YPWA 1IXRC 2RGOA 3M0EA 4FWGA 2DZLA 4IIWA 4JWHA 2V3KA 3RE8A 4JN6A 3KY7A 4YQSA 3BOSA 3KXEC 4YQTA 2FH0A 3KOYE 1JB0F 3W67A 5ITXA 2C9OA 3FUTA 5D9FA 2LBCA 2XEPA 2BJWA 2MH8A 3GLHA 4KT0F 1VEKA 2CWBA 2I6DA 1EE8A 4DV1M 3ZCBB 1WGNA 3SC3A 3H4MA 4MGKE 2G3QA 4DUZM 1L2CA 4JI4M 1FJGM 3HU2A 1JR3D 2L2DA 2LVQD 2N35A 2J7OA 2C99A 3HKPA 3SYLA 3HX3A 3PVSA 1N32M 1HJPA 2VF8A 4IBIA 4PT5A 1DV0A 3BXWA 3L25A 2R4JA 4YPXA 5DYIA 3SMPA 4D81A 3U6QA 1PJQA 4IBFA 4DV3M 3SAWA 2R44A 3FKEA 5EP1A 5H37D 1HQYE 1GKIA 1PJSA 4OVZA 1DGFA 1VQ1A 1Y8GA 4DR4M 4JI2M 4DR6M 1Z6TA 3IEFA 4KLNA 2L7IA 2JZ1A 4LJ4A 4CHTB 1GJTA 1GVNA 3F92A 2KXEA 2KRUA 4AZFA 1E32A 4REZA 1L1ZA 2VDBB 4JI3M 2V1CA 2LVAA 3GPPA 1GABA 3U60B 3SFZA 3I4VA 3GRVA 5GKNA 4LFBM 1G4AE 1OQYA 2KA6B 3E5YA 3IC6A 3AL0C 3J27B 1ZMVA 1YLAA 4LZZA 1Z85A 1FNNA 2DZNB 3WHKA 4YQAA 2EKFA 4RNAA 4YQCA 2XGNA 4Y28F 1LTMA 5KQDA 1ZQ9A 1QDTA 2CV1A 1OFHA 1S3SA 2YFQA 4LFCM 2EGVA 4YQRA 1Z5AA 3GQ3A 5F3WA 1QAOA 3VDPA 3AI9X 3C58A 4NC6A 2O01F 3FTFA 2OO9A 3GRUA 4FWDA 5FTMA 4NRVA 1HNWM 1XB2B 1NVMA 4NSOB 1A5TA 2FNAA 2DAMA 4DUYM 3SYKA 3U6EA 2UUBM 1XHBA 4CISA 3VKHA 4YQKA 3B89A 4FVMA 5EXSA 2Y20A 1ZAEA 3SATA 3Q8XA 5ITRA 2NQ8C 3PXGA 1H6UA 1T6OA 2XLJA 1NJFA 4YQQA 4X65M 2Y21A 2ZBKB 3U60A 2KZUA 2XZUA 2CP8A 3K92A 1N33M 4L15A 1HR0M 2XF3A 4GHAA 1YE9A 2H1RA 4JI0M 2CV0A 1TH3A 3DCMX 1TH4A 1GJSA 4OU7A 1DGGA 1XWIA 1IN6A 3L27A 4H3YA 3HHYA 2QWVA 3SHGB 3MHVC 3DOAA 1XNRM 3TPZA 3BBEA 3PFIA 5E26A 3B7QA 2LHCA 2K0BX 4G3OA 3SAUA 4CNDA 5IWAM 1G71A 4B7HA 1NHWC 2Z8YM 3QUVA 4FCVA 4JV5M 3LW5F 4AW4A 5L8RF 4JI7M 1PRBA 2FFJA 4KGNA 2C9CA 3AV0A 5EXPA 7CATA 4G4NA 1GO5A 3LVVA 1OIZA 2MGWA 3FYDA 4GRIA 1PJJA 3LVWA 2F5QA 1VEJA 3GPXA 4B3SM 2LWXA 1SXJD 3MMPA 3E46A 1QAMA 2KNZA 2ZTDA 1IN5A 4EIWA 4QNMA 3K2LA 1ORYB 2JZ0A 1NY5A 2L7HA 4DR5M 1V6ZA 1V33A 3T6PA 3W0FA 2DHRA 2VIIA 3PNYA 3K8ZA 4Q7JA 1T43A 1W5SA 5FAIA 1TR8A 1DO2A 3W0LB 4AKIA 3HU3A 1R6BX 3J2PB 2DAGA 5ITYA 4B3RM 4FCWA 3T1HM 3U61B 2UUAM 2EUCA 1UAKA 1IN7A 1D0MA 1DGHB 4B3TM 1QZEA 2UXCM 2I7NA 4YQDA 1G3IA 4ZPXA 2X8AA 3J7AS 4GKJM 1L2DA 2XSZA 1NHGC 2CRUA 5LMUM 2C5RA 1MN3A 2LH0A 4DR1M 2WSCF 4X62M 1IY1A 4II7A 5EXTA 2HCBA 3MK6A 2OOAA 1SXJC 3HJQA 3M7GA 4LRSA 4DBGB 4JI6M 4YPZA 2DWMA 4YQLA 3QAUA 1TTEA 1R7RA 2JNHA 5GMBA 2YQZA 5EQTA 3L2AA 4L16A 1TDHA 4DV0M 2W82A 4MGIE 2H5XA 4GH9A 1DO0A 1K3RA 3ZC7B 1XXHB 4L6V6 3RFWA 4MB7A 1UFZA 3B9PA 4L78A 3N4KA 1AIPC 2LVPC 2DHYA 4TUWA 2XH9A
chains in the Genus database with same CATH topology
4YQOA 3GLFB 1G8PA 4PDGA 5EP2A 3U61A 4CNGA 2DZOB 4AKHA 2CHGA 3LMMA 1Z5CA 4FWHA 4S12A 4CGYB 3A42A 4RF0A 4PCZA 4YQ7A 1C1KA 2X49A 1IQPA 2A5YB 4G4RA 3R8FA 1HNXM 4PZKA 3GP1A 5ITXE 1PJIA 4LFAM 1IM2A 3SBJA 2FE8A 3UZUA 2F5PA 5KPRA 2CEAA 4FW9A 5C18A 1NXZA 2ZAOA 4MGZE 1N34M 4LF7M 1VHYA 5KO3A 3VLFB 1MX0A 3D8LA 2V6ZM 2DWZB 4YQ9A 5FSWA 3SAVA 4D80A 3SHFA 4YQ1A 4AQYM 4YQ4A 4M0DA 2HHHM 1K3XA 1E9RA 1XXHA 1IBKM 2D7HA 2CHQA 4IBGA 2UXBM 3KVWA 2QP9X 2XFTA 3GLFA 4XGIA 5CO4A 1NY6A 4LF9M 3KS4A 2OPFA 1DGBA 4IBCA 2XFSA 3GQ4A 4LF4M 2XZFA 2ZAMA 2R45A 4HL4A 3EIHA 3NK7A 1IY2A 2F5NA 1OY5A 3SASA 1TGUA 2G5GX 5ITUA 4YQ3A 5FLXS 3KOWE 3I51A 1ZJRA 3BBHA 1O6DA 1Q3CA 2QPAA 4BB9A 3U6PA 4NRWA 4IBJA 3AIAA 4LCBA 4HLQA 3R9XB 1Z59A 4YVKA 4X66M 1JR3A 4YQ6A 4I8OA 3FTCA 1NNJA 2DVWB 4LJ8A 4NXNM 4NL4H 4WURA 4YQ2A 1T3TA 3DFZA 1R2ZA 1D2NA 2ERCA 3DA1A 4P16A 3GLIB 3TWKA 3GO8A 4DV6M 2CUZA 3TE6A 4D82A 3SMSA 3HHZA 1E9SA 4KO8A 4LJ6A 1GL7A 3EIEA 3GLGB 3JAMS 1UAJA 1JQJC 1XNQM 1IXZA 5IREB 1J85A 2UXDM 3T15A 4JAKA 3IG5A 4R3DA 1UM8A 2Z7JA 3GPUA 4JI5M 3THGA 2Q2EB 1G59A 4L69A 3AOGA 3JR4A 2M5ZA 3L29A 4X64M 3CTWB 4LJAA 4R7GA 3E4RA 4LJ9A 2HKJA 3FTEA 3KP1E 3TQSA 4GKKM 4JI1M 3VKGA 3KOZE 1J5EM 4AKGA 1VDDA 1IN4A 3FUWA 4I81A 2M60A 4GIPA 4JWFA 3T38A 3L8UA 4YQPA 2R46A 3OINA 1KYIA 5DYGA 1OFIA 2LNHC 4MGHA 5DNYA 3GLIA 5ITTA 2RKOA 3KDSE 3KS8A 4K0KM 1WXQA 2QENA 2V1UA 3U6SA 3FUVA 4CNEA 1Q39A 3GLGA 1MXIA 3NK6A 1N75A 3KTYA 2R4EA 4YQGA 1SXJB 2UU9M 2HL7A 1NJGA 5FTJA 5EP4A 4JWGA 3KNUA 3AFHA 4M0WA 4QOSA 4X3LA 3VK8A 3KFUG 4MCDA 3J7BA 2O3AA 2X4AA 4FD2A 4AI6A 4LGYA 1R2YA 3O7BA 4NOOB 5EP3A 4GITA 3D8BA 3LQRA 3A46A 4DV7M 4E8BA 1NNUC 4DR2M 4Z6YA 2L6OA 3U6CA 2DXIA 4G6ZA 4LF5M 3AJIB 3A45A 3FD9A 3FTDA 3N4JA 4FMWA 4KHPM 4PD2A 4PDIA 3VK7A 2F5SA 3HJSA 3U6LA 1HQCA 2CHVA 3HHXA 3KSXA 3AOEC 1E94E 2F4VM 4JYAM 2Z3XA 3IG8A 4A3VB 3KW2A 5A2QS 1SXJA 2Y0QA 3NWLA 3ILKA 2KZSA 4YVHA 1I94M 1DGHA 4LF8M 1IN8A 1J7KA 2BNKA 3KSJA 1P9PA 1SXJE 2YR0A 3KW6A 4YQJA 4QHSA 4I4LA 5ITQA 5JI2E 1IBMM 1VHKA 4DR3M 4JWJA 5GM8A 3TWLA 3UMMA 4GC9A 1NS5A 4OVZB 3UGJA 4YHHM 2JA2A 3GRRA 3LQQA 4QOZC 4YVJA 2R18A 4DV5M 3U6OA 4DV4M 4IBBA 4AG6A 3MJ5A 4NSRA 3K1JA 4JALA 5C1BA 3GQ5A 3KOXE 2KEBA 3J80S 1XMQM 4IBEA 1K82A 4CNFA 3VFDA 4LRTA 4YQ5A 4LZJA 1KFVA 2RGHA 2QBYB 2BJVA 2AHMA 2G8LA 4GHLA 4M9SA 4G4OA 4B08A 5IT9S 3AXZA 2ZM6M 1HT1E 4MCCA 3DZDA 4XBOA 4BBAA 4YQIA 3M6AA 1L1TA 2DWLA 2Y0TA 4DR7M 4FAKA 3U6MA 2CFOA 1LV7A 3WHLA 4J3CA 3HU1A 2VQFM 2QZ4A 2OQ4A 4MGYE 5LMNM 2CV2A 4JI8M 3QWLA 3HGIA 3BBDA 5EXXA 4B7GA 1IXSB 4DV2M 1IBLM 2QMMA 4M9XA 3E9SA 3L26A 1G41A 1KSFX 5IZ7D 3SARA 3UK6A 5FTLA 1L8QA 3L28A 4LGMA 3ZH9B 4ITQA 2QBYA 3J81S 4X3MA 2F5OA 1IPAA 2HA8A 3TL4X 4MCBA 3T1YM 1QAQA 3FUUA 3HHWA 2LXEA 8CATA 4OW0A 2C96A 4YQNA 2R65A 1XMOM 3FUXA 1L2BA 4RG1A 2KRKA 5KPTA 3OIJA 4FCTA 2YNMD 3RGSA 2QCUA 2CE7A 4JXJA 4YPYA 5FTKA 2FOIC 1IY0A 4KDZA 2CX8A 3GPYA 1GL6A 3UJNA 1X7OA 5BR8M 2DWNA 3CF0A 1GLNA 1Z5BA 3CF2A 4IBDA 3OTOM 1QZMA 4YVIA 3GYQA 5JI3E 2XSZD 1QVRA 4QNRA 3FYCA 3ONPA 2EO2A 4RF1A 2ZANA 3U5ZB 4IG6A 3OIIA 4YVGA 4L8RC 1HNZM 4GC5A 4I5SA 4QHTA 1QQWA 5BPVA 1VH0A 3TWMA 4L4UA 1N77A 3KP0E 1QYRA 1QANA 3U6DA 2Z4SA 3I4YA 3CF6E 2K47A 4GMQA 5E6JA 2E5LM 1UAMA 2C98A 2KW0A 3HWSA 5KQ8A 3AKZA 2P5TA 4LJ7A 1K3WA 2O5RA 1TDZA 4W5WA 4H3ZA 1N36M 1W5TA 3A98B 1X37A 4MM3B 4LG2A 4YQ8A 5GMCA 4Z8XA 1Q3BA 2L09A 2VQEM 2EGWA 4YQBA 4YQ0A 3U5ZA 4B3MM 1NSFA 5KPZA 3JR5A 1GZ0A 2UUCM 1OJLA 4LY6A 3GLHB 3RGPA 3VDUA 4LJ5A 1YSYA 4IJFA 1XC8A 5EJCA 1X7PA 2J7NA 3PNVA 1YUBA 1HT2E 4BLCA 3HJ8A 4OX9M 1MU5A 2I7PA 4IBKA 2D7EA 4AG5A 2Z4RA 2YY8A 3GRYA 1J09A 3NBIA 4G4QA 4B7FA 4IJEA 1N78A 4M9ZA 1UALA 1I4WA 2EA0A 4MH0E 3AOEA 2Z0YA 4NXMM 1TH2A 5FTNA 4YY3M 4WW0A 2V3JA 1PM5A 2R62A 1V2XA 2D7GA 1TO0A 4LF6M 4YPWA 1IXRC 2RGOA 3M0EA 4FWGA 4IIWA 4JWHA 2V3KA 3RE8A 4JN6A 3KY7A 4YQSA 3BOSA 3KXEC 4YQTA 3KOYE 5ITXA 2C9OA 3FUTA 5D9FA 2XEPA 2BJWA 3GLHA 2I6DA 1EE8A 4DV1M 3ZCBB 3SC3A 3H4MA 4MGKE 4DUZM 1L2CA 4JI4M 1FJGM 3HU2A 1JR3D 2J7OA 2C99A 3HKPA 3SYLA 1N32M 3PVSA 4IBIA 4PT5A 3L25A 2R4JA 4YPXA 5DYIA 3SMPA 4D81A 3U6QA 4IBFA 4DV3M 3SAWA 3FKEA 5EP1A 5H37D 1HQYE 1GKIA 4OVZA 1DGFA 3IEFA 4DR4M 4JI2M 4DR6M 1Z6TA 4KLNA 2L7IA 4LJ4A 4CHTB 1GVNA 2KXEA 2KRUA 4AZFA 1E32A 4REZA 1L1ZA 4JI3M 2V1CA 3GPPA 3U60B 3SFZA 3I4VA 3GRVA 5GKNA 4LFBM 1G4AE 2KA6B 3E5YA 3IC6A 3AL0C 3J27B 1Z85A 4LZZA 1FNNA 2DZNB 3WHKA 4YQAA 4RNAA 4YQCA 2XGNA 5KQDA 1ZQ9A 2CV1A 1OFHA 1S3SA 2YFQA 4LFCM 2EGVA 4YQRA 1Z5AA 3GQ3A 5F3WA 1QAOA 3VDPA 3AI9X 3C58A 3FTFA 3GRUA 4FWDA 5FTMA 4NRVA 1HNWM 1NVMA 4NSOB 2FNAA 2UUBM 4CISA 4DUYM 3SYKA 3U6EA 4YQKA 1XHBA 3VKHA 4FVMA 5EXSA 2Y20A 1ZAEA 3SATA 3Q8XA 5ITRA 2NQ8C 3PXGA 1H6UA 2XLJA 1NJFA 4YQQA 4X65M 2Y21A 2ZBKB 3U60A 2KZUA 2XZUA 3K92A 1N33M 4L15A 1HR0M 2XF3A 4GHAA 1YE9A 2H1RA 4JI0M 2CV0A 1TH3A 3DCMX 1TH4A 4OU7A 1DGGA 1XWIA 1IN6A 3L27A 4H3YA 3HHYA 2QWVA 3SHGB 3MHVC 3DOAA 1XNRM 3TPZA 3BBEA 3PFIA 5E26A 3SAUA 4CNDA 5IWAM 4B7HA 1NHWC 3QUVA 4FCVA 4JV5M 4AW4A 4JI7M 2FFJA 4KGNA 2C9CA 3AV0A 5EXPA 7CATA 4G4NA 3LVVA 1PJJA 3FYDA 4GRIA 2F5QA 3LVWA 4B3SM 3GPXA 2LWXA 1SXJD 1QAMA 1IN5A 4EIWA 4QNMA 3K2LA 1ORYB 1NY5A 2L7HA 4DR5M 1V6ZA 3W0FA 2DHRA 2VIIA 3PNYA 3K8ZA 1W5SA 5FAIA 1DO2A 3W0LB 4AKIA 3HU3A 1R6BX 3J2PB 5ITYA 4B3RM 4FCWA 3T1HM 3U61B 2UUAM 2EUCA 1UAKA 1IN7A 1DGHB 4B3TM 2UXCM 2I7NA 4YQDA 1G3IA 4ZPXA 2X8AA 3J7AS 4GKJM 1L2DA 2XSZA 1NHGC 5LMUM 2C5RA 2LH0A 4DR1M 4X62M 1IY1A 4II7A 5EXTA 2HCBA 3MK6A 1SXJC 3HJQA 3M7GA 4LRSA 4JI6M 4YPZA 2DWMA 4YQLA 3QAUA 5GMBA 1R7RA 2YQZA 5EQTA 3L2AA 4L16A 1TDHA 4DV0M 2W82A 4MGIE 4GH9A 1DO0A 1K3RA 3ZC7B 1XXHB 3RFWA 4MB7A 3B9PA 4L78A 3N4KA 4KODA 4TUWA 2XH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQO A;  4KDZ A;  3KNU A;  4CNG A;  2CX8 A;  4X3L A;  3E5Y A;  4MCD A;  1X7O A;  3IC6 A;  4YQ7 A;  2O3A A;  1Z85 A;  4PZK A;  3O7B A;  4YQA A;  4YVI A;  3GYQ A;  4YQC A;  4E8B A;  1NXZ A;  1VHY A;  2EGV A;  3ONP A;  4YQR A;  4YVG A;  4IG6 A;  3N4J A;  3OII A;  3AI9 X;  4YQ9 A;  4YQ1 A;  4YQK A;  1VH0 A;  4YQ4 A;  3KW2 A;  3ILK A;  1UAM A;  4YQQ A;  5CO4 A;  4YVH A;  1P9P A;  4YQJ A;  1VHK A;  4H3Z A;  5GM8 A;  1NS5 A;  4YQ8 A;  5GMC A;  3NK7 A;  3DCM X;  1OY5 A;  4YVJ A;  2EGW A;  4H3Y A;  4YQB A;  4YQ3 A;  2QWV A;  4YQ0 A;  1ZJR A;  3BBH A;  1O6D A;  3BBE A;  1GZ0 A;  4JAL A;  3AIA A;  4CND A;  4CNF A;  4YVK A;  3QUV A;  1X7P A;  4YQ6 A;  4YQ5 A;  4KGN A;  2YY8 A;  4YQ2 A;  3AXZ A;  4MCC A;  4XBO A;  1UAL A;  2Z0Y A;  4YQI A;  2V3J A;  1V6Z A;  4FAK A;  1UAJ A;  1V2X A;  1TO0 A;  5FAI A;  1J85 A;  4YPW A;  4JAK A;  4J3C A;  2V3K A;  4L69 A;  3KY7 A;  4YQS A;  1UAK A;  3BBD A;  4YQT A;  4YQD A;  5D9F A;  2QMM A;  2I6D A;  4YQP A;  3L8U A;  4X3M A;  3OIN A;  1IPA A;  2HA8 A;  4MCB A;  4YPZ A;  4YPX A;  4YQL A;  5GMB A;  4YQN A;  4CNE A;  3IEF A;  1K3R A;  4RG1 A;  1MXI A;  3NK6 A;  3OIJ A;  3KTY A;  3N4K A;  4YQG A;  4YPY A; 
#chains in the Genus database with same CATH topology
 4YQO A;  3GLF B;  1G8P A;  4PDG A;  5EP2 A;  3C9P A;  3U61 A;  4CNG A;  2DZO B;  2LVN C;  4AKH A;  2CHG A;  3LMM A;  1Z5C A;  4FWH A;  4S12 A;  4CGY B;  3A42 A;  2R6F A;  4RF0 A;  4PCZ A;  1C1K A;  4YQ7 A;  2X49 A;  1IQP A;  2A5Y B;  4G4R A;  3R8F A;  1HNX M;  4PZK A;  3GP1 A;  5ITX E;  1PJI A;  4LFA M;  1IM2 A;  3GLH E;  3SBJ A;  1V92 A;  2FE8 A;  3CGW A;  3UZU A;  5KPR A;  2F5P A;  2BWE A;  2CEA A;  4FW9 A;  5C18 A;  1NXZ A;  1WIV A;  2DI0 A;  2ZAO A;  4MGZ E;  1N34 M;  4LF7 M;  1VHY A;  2DEN A;  5KO3 A;  3VLF B;  1MX0 A;  1R5L A;  2V6Z M;  3D8L A;  2DWZ B;  4YQ9 A;  1OAO C;  5FSW A;  3SAV A;  3NBX X;  4D80 A;  3SHF A;  4YQ1 A;  4AQY M;  4YQ4 A;  4M0D A;  2HHH M;  1K3X A;  1E9R A;  1XXH A;  1IBK M;  2D7H A;  2CHQ A;  4IBG A;  2UXB M;  3KVW A;  2BWB A;  1OIP A;  2QP9 X;  2XFT A;  2EKK A;  4XGI A;  3GLF A;  5CO4 A;  1NY6 A;  2LHG A;  1QDR A;  3KS4 A;  2OOB A;  4LF9 M;  2OPF A;  1DGB A;  2QSF X;  4IBC A;  2XFS A;  3GQ4 A;  4LF4 M;  2XZF A;  2ZAM A;  2R45 A;  4HL4 A;  1EIJ A;  3EIH A;  3NK7 A;  3BBZ A;  1IY2 A;  2F5N A;  1OY5 A;  3SAS A;  1TGU A;  2G5G X;  2HAK A;  1EFU B;  3H4J A;  3QYE A;  2RRU A;  5ITU A;  5DFL A;  5FLX S;  4YQ3 A;  3KOW E;  3I51 A;  1ZJR A;  3BBH A;  1O6D A;  1Q3C A;  2QPA A;  4BB9 A;  3U6P A;  4NRW A;  4IBJ A;  3AIA A;  4LCB A;  4CJ6 A;  4HLQ A;  3R9X B;  3FRH A;  1Z59 A;  4YVK A;  4X66 M;  1JR3 A;  4YQ6 A;  4I8O A;  3FTC A;  1NNJ A;  1ZMW A;  2DVW B;  4LJ8 A;  4NXN M;  4NL4 H;  1JR3 E;  4WUR A;  4YQ2 A;  1T3T A;  3DFZ A;  1WJ7 A;  1D2N A;  2ERC A;  3DA1 A;  4P16 A;  1R2Z A;  1D0L A;  3TWK A;  3GO8 A;  3GLI B;  4DV6 M;  2CUZ A;  3TE6 A;  1PGY A;  4D82 A;  2JP7 A;  3SMS A;  2EJS A;  3HHZ A;  1E9S A;  4KO8 A;  4LJ6 A;  2R0I A;  1GL7 A;  2DAK A;  3EIE A;  3GLG B;  2JY8 A;  3JAM S;  1UAJ A;  1JQJ C;  1XNQ M;  1IXZ A;  5IRE B;  3B7Z A;  2JY7 A;  2UXD M;  3T15 A;  1J85 A;  3IG5 A;  4R3D A;  1UM8 A;  2Z7J A;  3GPU A;  1WGL A;  3THG A;  2Q2E B;  1G59 A;  4JI5 M;  1V34 A;  4L69 A;  1ZV1 A;  3AOG A;  3JR4 A;  2M5Z A;  3L29 A;  4X64 M;  3CTW B;  4LJA A;  4R7G A;  3E4R A;  4LJ9 A;  2HKJ A;  3FTE A;  3KP1 E;  3TQS A;  3FE3 A;  4GKK M;  4JI1 M;  3VKG A;  3KOZ E;  2DAI A;  1J5E M;  4AKG A;  1VDD A;  1IN4 A;  3FUW A;  4I81 A;  2M60 A;  4GIP A;  4JWF A;  3T38 A;  3L8U A;  4YQP A;  1OAI A;  2R46 A;  3OIN A;  1KYI A;  5DYG A;  1OFI A;  2KNV A;  2LNH C;  4MGH A;  1NO1 A;  5DNY A;  4F2L A;  5ITT A;  3GLI A;  4CIZ A;  2RKO A;  3KDS E;  4KOD A;  3KS8 A;  4K0K M;  1WXQ A;  2QEN A;  2V1U A;  3U6S A;  3FUV A;  4CNE A;  1Q39 A;  4XK8 F;  3GLG A;  1MXI A;  3NK6 A;  1N75 A;  4HEO A;  4P17 A;  4GEW A;  3KTY A;  2QNJ A;  2R4E A;  4YQG A;  1SXJ B;  2UU9 M;  2HL7 A;  1NJG A;  5FTJ A;  4JAK A;  2J5Y A;  5EP4 A;  3GLG E;  4JWG A;  3KNU A;  3AFH A;  2O25 A;  4M0W A;  4QOS A;  3ZQJ A;  3VK8 A;  4X3L A;  3KFU G;  4MCD A;  3J7B A;  2O3A A;  2X4A A;  4FD2 A;  2L4F A;  4AI6 A;  4LGY A;  1R2Y A;  4R71 A;  3O7B A;  1VDL A;  4NOO B;  2APL A;  5EP3 A;  4GIT A;  3HZJ A;  3D8B A;  3LQR A;  3A46 A;  4DV7 M;  4E8B A;  1QUS A;  1NNU C;  1CUK A;  4DR2 M;  2JUJ A;  4Z6Y A;  2L6O A;  3U6C A;  2DXI A;  4G6Z A;  4LF5 M;  3AJI B;  3A45 A;  3FD9 A;  3FTD A;  3N4J A;  2DNA A;  4FMW A;  4KHP M;  2MRO B;  4PD2 A;  4PDI A;  3K9O A;  3VK7 A;  2F5S A;  3HJS A;  3U6L A;  3I04 M;  1HQC A;  2CHV A;  3HHX A;  3KSX A;  3AOE C;  1E94 E;  2F4V M;  4JYA M;  2Z3X A;  3IG8 A;  4A3V B;  3KW2 A;  5A2Q S;  1SXJ A;  2Y0Q A;  3NWL A;  3ILK A;  2KZS A;  3I01 M;  4YVH A;  1I94 M;  1DGH A;  2B3T A;  4LF8 M;  1IN8 A;  1J7K A;  2BNK A;  3KSJ A;  2KDL A;  1P9P A;  1SXJ E;  2YR0 A;  3KW6 A;  4YQJ A;  4QHS A;  4I4L A;  5ITQ A;  5JI2 E;  1IBM M;  1VHK A;  4DR3 M;  4JWJ A;  5GM8 A;  3TWL A;  3UMM A;  4GC9 A;  1NS5 A;  4OVZ B;  3UGJ A;  4YHH M;  2JA2 A;  3GRR A;  3LQQ A;  4QOZ C;  4YVJ A;  3IHP A;  4F1I A;  2R18 A;  4DV5 M;  3U6O A;  4DV4 M;  4IBB A;  4AG6 A;  3MJ5 A;  4UN2 B;  4NSR A;  3K1J A;  4JAL A;  1F4I A;  5C1B A;  1AUA A;  3KOX E;  3GQ5 A;  2KEB A;  3J80 S;  1XMQ M;  1NV8 A;  4IBE A;  1K82 A;  4CNF A;  3VFD A;  4LRT A;  4YQ5 A;  4LZJ A;  1KFV A;  2RGH A;  3C3E A;  2QBY B;  3C3D A;  1ZMU A;  2BJV A;  1XXH E;  2AHM A;  2G8L A;  2WSF F;  4M9S A;  4B08 A;  4G4O A;  4GHL A;  5IT9 S;  3AXZ A;  2ZM6 M;  1HT1 E;  4MCC A;  1OKS A;  3DZD A;  4XBO A;  3FRI A;  3GLF E;  4BBA A;  4YQI A;  3M6A A;  3V76 A;  1L1T A;  2DWL A;  2Y0T A;  2QQ8 A;  4DR7 M;  4FAK A;  4ANR A;  3U6M A;  2CFO A;  2VF7 A;  3IEC A;  3E21 A;  1LV7 A;  3WHL A;  4J3C A;  3HU1 A;  2VQF M;  2DAE A;  2QZ4 A;  2OQ4 A;  4MGY E;  5LMN M;  2CV2 A;  4JI8 M;  3Q8G A;  3QWL A;  3HGI A;  3BBD A;  5EXX A;  4B7G A;  1TF0 B;  1IXS B;  4DV2 M;  1IBL M;  2WZJ A;  1C7Y A;  2QMM A;  4M9X A;  3E9S A;  3L26 A;  1G41 A;  1KSF X;  5IZ7 D;  1D0K A;  2GNO A;  3SAR A;  3LCV B;  3UK6 A;  5FTL A;  1L8Q A;  3L28 A;  4LGM A;  3ZH9 B;  2JXN A;  4ITQ A;  2QBY A;  3J81 S;  4X3M A;  2F5O A;  1IPA A;  2HA8 A;  3TL4 X;  4MCB A;  3T1Y M;  1QAQ A;  3FUU A;  1R4G A;  2HWJ A;  1QUT A;  2LXE A;  3HHW A;  8CAT A;  1VEG A;  2L4E A;  4OW0 A;  2GQF A;  2C96 A;  4YQN A;  2R65 A;  1XMO M;  3FUX A;  1L2B A;  4RG1 A;  2KRK A;  5KPT A;  3OIJ A;  4FCT A;  2YNM D;  3RGS A;  2CE7 A;  2QCU A;  4JXJ A;  4YPY A;  5FTK A;  1VG5 A;  2MJ5 B;  2FOI C;  1IY0 A;  4KDZ A;  2CX8 A;  3GPY A;  1GL6 A;  2MR9 A;  3UJN A;  5BR8 M;  1X7O A;  1IXS A;  3B74 A;  2DWN A;  3CF0 A;  1GLN A;  1Z5B A;  2DKL A;  3CF2 A;  4IBD A;  3OTO M;  1QZM A;  4YVI A;  3LCU A;  3GYQ A;  5JI3 E;  2JWS A;  2K6B A;  3QYB A;  2XSZ D;  1IFY A;  2QHO B;  3B7N A;  1QVR A;  4QNR A;  3FYC A;  3ONP A;  2EO2 A;  4RF1 A;  2ZAN A;  3U5Z B;  4IG6 A;  3OII A;  4YVG A;  4L8R C;  3W68 A;  1HNZ M;  4GC5 A;  2K9D A;  4I5S A;  4QHT A;  1QQW A;  5BPV A;  3GLI E;  1VH0 A;  3TWM A;  4L4U A;  1N77 A;  3KP0 E;  1OTR A;  1QYR A;  1QAN A;  3U6D A;  2Z4S A;  3I4Y A;  3CF6 E;  2K47 A;  1MJG M;  4GMQ A;  5E6J A;  2E5L M;  1UAM A;  2C98 A;  2KW0 A;  3HWS A;  5KQ8 A;  3AKZ A;  2P5T A;  4LJ7 A;  1K3W A;  2KHH A;  2O5R A;  1TDZ A;  4W5W A;  4H3Z A;  1N36 M;  1RU3 A;  1W5T A;  3A98 B;  1X37 A;  4MM3 B;  1WR1 B;  4LG2 A;  4YQ8 A;  5GMC A;  3HY5 A;  4Z8X A;  1Q3B A;  2L09 A;  2VQE M;  2EGW A;  4YQB A;  1WHC A;  4YQ0 A;  3U5Z A;  4B3M M;  1NSF A;  1BVS A;  5KPZ A;  3JR5 A;  2UUC M;  1GZ0 A;  1OJL A;  4LY6 A;  3GLH B;  3RGP A;  3VDU A;  4LJ5 A;  1YSY A;  4IJF A;  3K9P A;  1XC8 A;  5EJC A;  1X7P A;  2J7N A;  3PNV A;  1YUB A;  1HT2 E;  1SG9 A;  3HJ8 A;  4RKU F;  4BLC A;  4OX9 M;  1MU5 A;  2I7P A;  4IBK A;  4WP2 A;  2D7E A;  4AG5 A;  2LVO C;  2KNA A;  2LTU A;  2Z4R A;  2ZTC A;  3GRY A;  2YY8 A;  1J09 A;  1P3Q Q;  3NBI A;  4G4Q A;  4B7F A;  4IJE A;  2JY6 B;  4M9Z A;  1N78 A;  1UAL A;  1I4W A;  2EA0 A;  4MH0 E;  3AOE A;  2Z0Y A;  1NV9 A;  4NXM M;  1TH2 A;  5FTN A;  4YY3 M;  2WSE F;  4WW0 A;  1PM5 A;  2V3J A;  2JY5 A;  2R62 A;  1V2X A;  2D7G A;  1PJT A;  1TO0 A;  1Q02 A;  2FS1 A;  4LF6 M;  4YPW A;  1IXR C;  2RGO A;  3M0E A;  4FWG A;  2DZL A;  4IIW A;  4JWH A;  2V3K A;  3RE8 A;  4JN6 A;  3KY7 A;  4YQS A;  3BOS A;  3KXE C;  4YQT A;  2FH0 A;  3KOY E;  1JB0 F;  3W67 A;  5ITX A;  2C9O A;  3FUT A;  5D9F A;  2LBC A;  2XEP A;  2BJW A;  2MH8 A;  3GLH A;  4KT0 F;  1VEK A;  2CWB A;  2I6D A;  1EE8 A;  4DV1 M;  3ZCB B;  1WGN A;  3SC3 A;  3H4M A;  4MGK E;  2G3Q A;  4DUZ M;  1L2C A;  4JI4 M;  1FJG M;  3HU2 A;  1JR3 D;  2L2D A;  2LVQ D;  2N35 A;  2J7O A;  2C99 A;  3HKP A;  3SYL A;  3HX3 A;  3PVS A;  1N32 M;  1HJP A;  2VF8 A;  4IBI A;  4PT5 A;  1DV0 A;  3BXW A;  3L25 A;  2R4J A;  4YPX A;  5DYI A;  3SMP A;  4D81 A;  3U6Q A;  1PJQ A;  4IBF A;  4DV3 M;  3SAW A;  2R44 A;  3FKE A;  5EP1 A;  5H37 D;  1HQY E;  1GKI A;  1PJS A;  4OVZ A;  1DGF A;  1VQ1 A;  1Y8G A;  4DR4 M;  4JI2 M;  4DR6 M;  1Z6T A;  3IEF A;  4KLN A;  2L7I A;  2JZ1 A;  4LJ4 A;  4CHT B;  1GJT A;  1GVN A;  3F92 A;  2KXE A;  2KRU A;  4AZF A;  1E32 A;  4REZ A;  1L1Z A;  2VDB B;  4JI3 M;  2V1C A;  2LVA A;  3GPP A;  1GAB A;  3U60 B;  3SFZ A;  3I4V A;  3GRV A;  5GKN A;  4LFB M;  1G4A E;  1OQY A;  2KA6 B;  3E5Y A;  3IC6 A;  3AL0 C;  3J27 B;  1ZMV A;  1YLA A;  4LZZ A;  1Z85 A;  1FNN A;  2DZN B;  3WHK A;  4YQA A;  2EKF A;  4RNA A;  4YQC A;  2XGN A;  4Y28 F;  1LTM A;  5KQD A;  1ZQ9 A;  1QDT A;  2CV1 A;  1OFH A;  1S3S A;  2YFQ A;  4LFC M;  2EGV A;  4YQR A;  1Z5A A;  3GQ3 A;  5F3W A;  1QAO A;  3VDP A;  3AI9 X;  3C58 A;  4NC6 A;  2O01 F;  3FTF A;  2OO9 A;  3GRU A;  4FWD A;  5FTM A;  4NRV A;  1HNW M;  1XB2 B;  1NVM A;  4NSO B;  1A5T A;  2FNA A;  2DAM A;  4DUY M;  3SYK A;  3U6E A;  2UUB M;  1XHB A;  4CIS A;  3VKH A;  4YQK A;  3B89 A;  4FVM A;  5EXS A;  2Y20 A;  1ZAE A;  3SAT A;  3Q8X A;  5ITR A;  2NQ8 C;  3PXG A;  1H6U A;  1T6O A;  2XLJ A;  1NJF A;  4YQQ A;  4X65 M;  2Y21 A;  2ZBK B;  3U60 A;  2KZU A;  2XZU A;  2CP8 A;  3K92 A;  1N33 M;  4L15 A;  1HR0 M;  2XF3 A;  4GHA A;  1YE9 A;  2H1R A;  4JI0 M;  2CV0 A;  1TH3 A;  3DCM X;  1TH4 A;  1GJS A;  4OU7 A;  1DGG A;  1XWI A;  1IN6 A;  3L27 A;  4H3Y A;  3HHY A;  2QWV A;  3SHG B;  3MHV C;  3DOA A;  1XNR M;  3TPZ A;  3BBE A;  3PFI A;  5E26 A;  3B7Q A;  2LHC A;  2K0B X;  4G3O A;  3SAU A;  4CND A;  5IWA M;  1G71 A;  4B7H A;  1NHW C;  2Z8Y M;  3QUV A;  4FCV A;  4JV5 M;  3LW5 F;  4AW4 A;  5L8R F;  4JI7 M;  1PRB A;  2FFJ A;  4KGN A;  2C9C A;  3AV0 A;  5EXP A;  7CAT A;  4G4N A;  1GO5 A;  3LVV A;  1OIZ A;  2MGW A;  3FYD A;  4GRI A;  1PJJ A;  3LVW A;  2F5Q A;  1VEJ A;  3GPX A;  4B3S M;  2LWX A;  1SXJ D;  3MMP A;  3E46 A;  1QAM A;  2KNZ A;  2ZTD A;  1IN5 A;  4EIW A;  4QNM A;  3K2L A;  1ORY B;  2JZ0 A;  1NY5 A;  2L7H A;  4DR5 M;  1V6Z A;  1V33 A;  3T6P A;  3W0F A;  2DHR A;  2VII A;  3PNY A;  3K8Z A;  4Q7J A;  1T43 A;  1W5S A;  5FAI A;  1TR8 A;  1DO2 A;  3W0L B;  4AKI A;  3HU3 A;  1R6B X;  3J2P B;  2DAG A;  5ITY A;  4B3R M;  4FCW A;  3T1H M;  3U61 B;  2UUA M;  2EUC A;  1UAK A;  1IN7 A;  1D0M A;  1DGH B;  4B3T M;  1QZE A;  2UXC M;  2I7N A;  4YQD A;  1G3I A;  4ZPX A;  2X8A A;  3J7A S;  4GKJ M;  1L2D A;  2XSZ A;  1NHG C;  2CRU A;  5LMU M;  2C5R A;  1MN3 A;  2LH0 A;  4DR1 M;  2WSC F;  4X62 M;  1IY1 A;  4II7 A;  5EXT A;  2HCB A;  3MK6 A;  2OOA A;  1SXJ C;  3HJQ A;  3M7G A;  4LRS A;  4DBG B;  4JI6 M;  4YPZ A;  2DWM A;  4YQL A;  3QAU A;  1TTE A;  1R7R A;  2JNH A;  5GMB A;  2YQZ A;  5EQT A;  3L2A A;  4L16 A;  1TDH A;  4DV0 M;  2W82 A;  4MGI E;  2H5X A;  4GH9 A;  1DO0 A;  1K3R A;  3ZC7 B;  1XXH B;  4L6V 6;  3RFW A;  4MB7 A;  1UFZ A;  3B9P A;  4L78 A;  3N4K A;  1AIP C;  2LVP C;  2DHY A;  4TUW A;  2XH9 A; 
#chains in the Genus database with same CATH homology
 4YQO A;  3GLF B;  1G8P A;  4PDG A;  5EP2 A;  3U61 A;  4CNG A;  2DZO B;  4AKH A;  2CHG A;  3LMM A;  1Z5C A;  4FWH A;  4S12 A;  4CGY B;  3A42 A;  4RF0 A;  4PCZ A;  4YQ7 A;  1C1K A;  2X49 A;  1IQP A;  2A5Y B;  4G4R A;  3R8F A;  1HNX M;  4PZK A;  3GP1 A;  5ITX E;  1PJI A;  4LFA M;  1IM2 A;  3SBJ A;  2FE8 A;  3UZU A;  2F5P A;  5KPR A;  2CEA A;  4FW9 A;  5C18 A;  1NXZ A;  2ZAO A;  4MGZ E;  1N34 M;  4LF7 M;  1VHY A;  5KO3 A;  3VLF B;  1MX0 A;  3D8L A;  2V6Z M;  2DWZ B;  4YQ9 A;  5FSW A;  3SAV A;  4D80 A;  3SHF A;  4YQ1 A;  4AQY M;  4YQ4 A;  4M0D A;  2HHH M;  1K3X A;  1E9R A;  1XXH A;  1IBK M;  2D7H A;  2CHQ A;  4IBG A;  2UXB M;  3KVW A;  2QP9 X;  2XFT A;  3GLF A;  4XGI A;  5CO4 A;  1NY6 A;  4LF9 M;  3KS4 A;  2OPF A;  1DGB A;  4IBC A;  2XFS A;  3GQ4 A;  4LF4 M;  2XZF A;  2ZAM A;  2R45 A;  4HL4 A;  3EIH A;  3NK7 A;  1IY2 A;  2F5N A;  1OY5 A;  3SAS A;  1TGU A;  2G5G X;  5ITU A;  4YQ3 A;  5FLX S;  3KOW E;  3I51 A;  1ZJR A;  3BBH A;  1O6D A;  1Q3C A;  2QPA A;  4BB9 A;  3U6P A;  4NRW A;  4IBJ A;  3AIA A;  4LCB A;  4HLQ A;  3R9X B;  1Z59 A;  4YVK A;  4X66 M;  1JR3 A;  4YQ6 A;  4I8O A;  3FTC A;  1NNJ A;  2DVW B;  4LJ8 A;  4NXN M;  4NL4 H;  4WUR A;  4YQ2 A;  1T3T A;  3DFZ A;  1R2Z A;  1D2N A;  2ERC A;  3DA1 A;  4P16 A;  3GLI B;  3TWK A;  3GO8 A;  4DV6 M;  2CUZ A;  3TE6 A;  4D82 A;  3SMS A;  3HHZ A;  1E9S A;  4KO8 A;  4LJ6 A;  1GL7 A;  3EIE A;  3GLG B;  3JAM S;  1UAJ A;  1JQJ C;  1XNQ M;  1IXZ A;  5IRE B;  1J85 A;  2UXD M;  3T15 A;  4JAK A;  3IG5 A;  4R3D A;  1UM8 A;  2Z7J A;  3GPU A;  4JI5 M;  3THG A;  2Q2E B;  1G59 A;  4L69 A;  3AOG A;  3JR4 A;  2M5Z A;  3L29 A;  4X64 M;  3CTW B;  4LJA A;  4R7G A;  3E4R A;  4LJ9 A;  2HKJ A;  3FTE A;  3KP1 E;  3TQS A;  4GKK M;  4JI1 M;  3VKG A;  3KOZ E;  1J5E M;  4AKG A;  1VDD A;  1IN4 A;  3FUW A;  4I81 A;  2M60 A;  4GIP A;  4JWF A;  3T38 A;  3L8U A;  4YQP A;  2R46 A;  3OIN A;  1KYI A;  5DYG A;  1OFI A;  2LNH C;  4MGH A;  5DNY A;  3GLI A;  5ITT A;  2RKO A;  3KDS E;  3KS8 A;  4K0K M;  1WXQ A;  2QEN A;  2V1U A;  3U6S A;  3FUV A;  4CNE A;  1Q39 A;  3GLG A;  1MXI A;  3NK6 A;  1N75 A;  3KTY A;  2R4E A;  4YQG A;  1SXJ B;  2UU9 M;  2HL7 A;  1NJG A;  5FTJ A;  5EP4 A;  4JWG A;  3KNU A;  3AFH A;  4M0W A;  4QOS A;  4X3L A;  3VK8 A;  3KFU G;  4MCD A;  3J7B A;  2O3A A;  2X4A A;  4FD2 A;  4AI6 A;  4LGY A;  1R2Y A;  3O7B A;  4NOO B;  5EP3 A;  4GIT A;  3D8B A;  3LQR A;  3A46 A;  4DV7 M;  4E8B A;  1NNU C;  4DR2 M;  4Z6Y A;  2L6O A;  3U6C A;  2DXI A;  4G6Z A;  4LF5 M;  3AJI B;  3A45 A;  3FD9 A;  3FTD A;  3N4J A;  4FMW A;  4KHP M;  4PD2 A;  4PDI A;  3VK7 A;  2F5S A;  3HJS A;  3U6L A;  1HQC A;  2CHV A;  3HHX A;  3KSX A;  3AOE C;  1E94 E;  2F4V M;  4JYA M;  2Z3X A;  3IG8 A;  4A3V B;  3KW2 A;  5A2Q S;  1SXJ A;  2Y0Q A;  3NWL A;  3ILK A;  2KZS A;  4YVH A;  1I94 M;  1DGH A;  4LF8 M;  1IN8 A;  1J7K A;  2BNK A;  3KSJ A;  1P9P A;  1SXJ E;  2YR0 A;  3KW6 A;  4YQJ A;  4QHS A;  4I4L A;  5ITQ A;  5JI2 E;  1IBM M;  1VHK A;  4DR3 M;  4JWJ A;  5GM8 A;  3TWL A;  3UMM A;  4GC9 A;  1NS5 A;  4OVZ B;  3UGJ A;  4YHH M;  2JA2 A;  3GRR A;  3LQQ A;  4QOZ C;  4YVJ A;  2R18 A;  4DV5 M;  3U6O A;  4DV4 M;  4IBB A;  4AG6 A;  3MJ5 A;  4NSR A;  3K1J A;  4JAL A;  5C1B A;  3GQ5 A;  3KOX E;  2KEB A;  3J80 S;  1XMQ M;  4IBE A;  1K82 A;  4CNF A;  3VFD A;  4LRT A;  4YQ5 A;  4LZJ A;  1KFV A;  2RGH A;  2QBY B;  2BJV A;  2AHM A;  2G8L A;  4GHL A;  4M9S A;  4G4O A;  4B08 A;  5IT9 S;  3AXZ A;  2ZM6 M;  1HT1 E;  4MCC A;  3DZD A;  4XBO A;  4BBA A;  4YQI A;  3M6A A;  1L1T A;  2DWL A;  2Y0T A;  4DR7 M;  4FAK A;  3U6M A;  2CFO A;  1LV7 A;  3WHL A;  4J3C A;  3HU1 A;  2VQF M;  2QZ4 A;  2OQ4 A;  4MGY E;  5LMN M;  2CV2 A;  4JI8 M;  3QWL A;  3HGI A;  3BBD A;  5EXX A;  4B7G A;  1IXS B;  4DV2 M;  1IBL M;  2QMM A;  4M9X A;  3E9S A;  3L26 A;  1G41 A;  1KSF X;  5IZ7 D;  3SAR A;  3UK6 A;  5FTL A;  1L8Q A;  3L28 A;  4LGM A;  3ZH9 B;  4ITQ A;  2QBY A;  3J81 S;  4X3M A;  2F5O A;  1IPA A;  2HA8 A;  3TL4 X;  4MCB A;  3T1Y M;  1QAQ A;  3FUU A;  3HHW A;  2LXE A;  8CAT A;  4OW0 A;  2C96 A;  4YQN A;  2R65 A;  1XMO M;  3FUX A;  1L2B A;  4RG1 A;  2KRK A;  5KPT A;  3OIJ A;  4FCT A;  2YNM D;  3RGS A;  2QCU A;  2CE7 A;  4JXJ A;  4YPY A;  5FTK A;  2FOI C;  1IY0 A;  4KDZ A;  2CX8 A;  3GPY A;  1GL6 A;  3UJN A;  1X7O A;  5BR8 M;  2DWN A;  3CF0 A;  1GLN A;  1Z5B A;  3CF2 A;  4IBD A;  3OTO M;  1QZM A;  4YVI A;  3GYQ A;  5JI3 E;  2XSZ D;  1QVR A;  4QNR A;  3FYC A;  3ONP A;  2EO2 A;  4RF1 A;  2ZAN A;  3U5Z B;  4IG6 A;  3OII A;  4YVG A;  4L8R C;  1HNZ M;  4GC5 A;  4I5S A;  4QHT A;  1QQW A;  5BPV A;  1VH0 A;  3TWM A;  4L4U A;  1N77 A;  3KP0 E;  1QYR A;  1QAN A;  3U6D A;  2Z4S A;  3I4Y A;  3CF6 E;  2K47 A;  4GMQ A;  5E6J A;  2E5L M;  1UAM A;  2C98 A;  2KW0 A;  3HWS A;  5KQ8 A;  3AKZ A;  2P5T A;  4LJ7 A;  1K3W A;  2O5R A;  1TDZ A;  4W5W A;  4H3Z A;  1N36 M;  1W5T A;  3A98 B;  1X37 A;  4MM3 B;  4LG2 A;  4YQ8 A;  5GMC A;  4Z8X A;  1Q3B A;  2L09 A;  2VQE M;  2EGW A;  4YQB A;  4YQ0 A;  3U5Z A;  4B3M M;  1NSF A;  5KPZ A;  3JR5 A;  1GZ0 A;  2UUC M;  1OJL A;  4LY6 A;  3GLH B;  3RGP A;  3VDU A;  4LJ5 A;  1YSY A;  4IJF A;  1XC8 A;  5EJC A;  1X7P A;  2J7N A;  3PNV A;  1YUB A;  1HT2 E;  4BLC A;  3HJ8 A;  4OX9 M;  1MU5 A;  2I7P A;  4IBK A;  2D7E A;  4AG5 A;  2Z4R A;  2YY8 A;  3GRY A;  1J09 A;  3NBI A;  4G4Q A;  4B7F A;  4IJE A;  1N78 A;  4M9Z A;  1UAL A;  1I4W A;  2EA0 A;  4MH0 E;  3AOE A;  2Z0Y A;  4NXM M;  1TH2 A;  5FTN A;  4YY3 M;  4WW0 A;  2V3J A;  1PM5 A;  2R62 A;  1V2X A;  2D7G A;  1TO0 A;  4LF6 M;  4YPW A;  1IXR C;  2RGO A;  3M0E A;  4FWG A;  4IIW A;  4JWH A;  2V3K A;  3RE8 A;  4JN6 A;  3KY7 A;  4YQS A;  3BOS A;  3KXE C;  4YQT A;  3KOY E;  5ITX A;  2C9O A;  3FUT A;  5D9F A;  2XEP A;  2BJW A;  3GLH A;  2I6D A;  1EE8 A;  4DV1 M;  3ZCB B;  3SC3 A;  3H4M A;  4MGK E;  4DUZ M;  1L2C A;  4JI4 M;  1FJG M;  3HU2 A;  1JR3 D;  2J7O A;  2C99 A;  3HKP A;  3SYL A;  1N32 M;  3PVS A;  4IBI A;  4PT5 A;  3L25 A;  2R4J A;  4YPX A;  5DYI A;  3SMP A;  4D81 A;  3U6Q A;  4IBF A;  4DV3 M;  3SAW A;  3FKE A;  5EP1 A;  5H37 D;  1HQY E;  1GKI A;  4OVZ A;  1DGF A;  3IEF A;  4DR4 M;  4JI2 M;  4DR6 M;  1Z6T A;  4KLN A;  2L7I A;  4LJ4 A;  4CHT B;  1GVN A;  2KXE A;  2KRU A;  4AZF A;  1E32 A;  4REZ A;  1L1Z A;  4JI3 M;  2V1C A;  3GPP A;  3U60 B;  3SFZ A;  3I4V A;  3GRV A;  5GKN A;  4LFB M;  1G4A E;  2KA6 B;  3E5Y A;  3IC6 A;  3AL0 C;  3J27 B;  1Z85 A;  4LZZ A;  1FNN A;  2DZN B;  3WHK A;  4YQA A;  4RNA A;  4YQC A;  2XGN A;  5KQD A;  1ZQ9 A;  2CV1 A;  1OFH A;  1S3S A;  2YFQ A;  4LFC M;  2EGV A;  4YQR A;  1Z5A A;  3GQ3 A;  5F3W A;  1QAO A;  3VDP A;  3AI9 X;  3C58 A;  3FTF A;  3GRU A;  4FWD A;  5FTM A;  4NRV A;  1HNW M;  1NVM A;  4NSO B;  2FNA A;  2UUB M;  4CIS A;  4DUY M;  3SYK A;  3U6E A;  4YQK A;  1XHB A;  3VKH A;  4FVM A;  5EXS A;  2Y20 A;  1ZAE A;  3SAT A;  3Q8X A;  5ITR A;  2NQ8 C;  3PXG A;  1H6U A;  2XLJ A;  1NJF A;  4YQQ A;  4X65 M;  2Y21 A;  2ZBK B;  3U60 A;  2KZU A;  2XZU A;  3K92 A;  1N33 M;  4L15 A;  1HR0 M;  2XF3 A;  4GHA A;  1YE9 A;  2H1R A;  4JI0 M;  2CV0 A;  1TH3 A;  3DCM X;  1TH4 A;  4OU7 A;  1DGG A;  1XWI A;  1IN6 A;  3L27 A;  4H3Y A;  3HHY A;  2QWV A;  3SHG B;  3MHV C;  3DOA A;  1XNR M;  3TPZ A;  3BBE A;  3PFI A;  5E26 A;  3SAU A;  4CND A;  5IWA M;  4B7H A;  1NHW C;  3QUV A;  4FCV A;  4JV5 M;  4AW4 A;  4JI7 M;  2FFJ A;  4KGN A;  2C9C A;  3AV0 A;  5EXP A;  7CAT A;  4G4N A;  3LVV A;  1PJJ A;  3FYD A;  4GRI A;  2F5Q A;  3LVW A;  4B3S M;  3GPX A;  2LWX A;  1SXJ D;  1QAM A;  1IN5 A;  4EIW A;  4QNM A;  3K2L A;  1ORY B;  1NY5 A;  2L7H A;  4DR5 M;  1V6Z A;  3W0F A;  2DHR A;  2VII A;  3PNY A;  3K8Z A;  1W5S A;  5FAI A;  1DO2 A;  3W0L B;  4AKI A;  3HU3 A;  1R6B X;  3J2P B;  5ITY A;  4B3R M;  4FCW A;  3T1H M;  3U61 B;  2UUA M;  2EUC A;  1UAK A;  1IN7 A;  1DGH B;  4B3T M;  2UXC M;  2I7N A;  4YQD A;  1G3I A;  4ZPX A;  2X8A A;  3J7A S;  4GKJ M;  1L2D A;  2XSZ A;  1NHG C;  5LMU M;  2C5R A;  2LH0 A;  4DR1 M;  4X62 M;  1IY1 A;  4II7 A;  5EXT A;  2HCB A;  3MK6 A;  1SXJ C;  3HJQ A;  3M7G A;  4LRS A;  4JI6 M;  4YPZ A;  2DWM A;  4YQL A;  3QAU A;  5GMB A;  1R7R A;  2YQZ A;  5EQT A;  3L2A A;  4L16 A;  1TDH A;  4DV0 M;  2W82 A;  4MGI E;  4GH9 A;  1DO0 A;  1K3R A;  3ZC7 B;  1XXH B;  3RFW A;  4MB7 A;  3B9P A;  4L78 A;  3N4K A;  4KOD A;  4TUW A;  2XH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...