3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
1O6DA 2CX8A 4YQTA 4JAKA 3BBDA 1UAJA 4X3LA 4YQGA 4YVJA 1X7OA 4YQ3A 3N4JA 3KY7A 3IEFA 3ILKA 1V2XA 2O3AA 2QMMA 4YQSA 3GYQA 2QWVA 1MXIA 5FAIA 4CNEA 3DCMX 2YY8A 4PZKA 3BBEA 4YQ0A 3KW2A 3NK6A 4YPWA 4MCDA 1VH0A 4YQNA 3AXZA 1VHYA 4KDZA 1UAKA 4YQOA 2EGVA 5CO4A 2EGWA 4YQJA 3IC6A 4X3MA 3L8UA 4YQ8A 1OY5A 3ONPA 4YQCA 1K3RA 1UALA 4YQ6A 4YQPA 4YPXA 4XBOA 4YQBA 3O7BA 4YQDA 3AI9X 4CNGA 3KTYA 2Z0YA 4YPYA 1NS5A 4JALA 5GMBA 4YQ7A 1NXZA 4YQAA 1Z85A 3OIJA 1VHKA 3OINA 1X7PA 4YQ1A 4YVHA 4H3YA 1GZ0A 4YVIA 3BBHA 4YQ9A 2V3KA 2I6DA 3KNUA 4YQIA 2V3JA 4IG6A 4RG1A 4YVGA 4YQLA 1ZJRA 1J85A 4YQ4A 4YQ2A 4KGNA 4MCCA 4YQRA 4MCBA 4YVKA 3OIIA 4L69A 4H3ZA 5GM8A 3E5YA 2HA8A 4YPZA 5GMCA 4CNFA 1V6ZA 1TO0A 4FAKA 1IPAA 3N4KA 4CNDA 4YQ5A 4YQKA 3NK7A 3AIAA 1UAMA 4J3CA 4E8BA 3QUVA 1P9PA 4YQQA 5D9FA
chains in the Genus database with same CATH superfamily
3T1YM 1Z5CA 4YQTA 4DBGB 4LFCM 4MGYE 2K0BX 2EKFA 3U60A 3SARA 3KOXE 3BBDA 4EIWA 2F5QA 1UAJA 1OTRA 1TGUA 3WHKA 2CV0A 3RGSA 2R46A 2APLA 4YVJA 4UN2B 3K8ZA 2W82A 3AOGA 2QSFX 4Z8XA 1WGNA 2WSFF 3AL0C 3SBJA 2I7PA 5EXPA 4FWGA 4GITA 4DR4M 3ZC7B 3B7QA 3SAUA 2ZTDA 3ILKA 3GLHA 3GLFB 1E9RA 2CP8A 4IBGA 1IY2A 4IBJA 1IN6A 3UJNA 1YLAA 5ITXA 2DWZB 4CNEA 1DGGA 1JR3D 2JA2A 4GMQA 2UUCM 2C98A 2KRUA 3BBEA 2K47A 4Q7JA 3KW2A 3KP1E 5IWAM 1T6OA 2MR9A 1ORYB 3AXZA 4KDZA 3CTWB 5IZ7D 3NBIA 4JXJA 1QUTA 4LGMA 3HHZA 2KXEA 4KO8A 1UAKA 3LCUA 2FFJA 3B9PA 1PJSA 4DV4M 4IJFA 1XNQM 3GO8A 3FUTA 3ZQJA 2LXEA 3IC6A 2DVWB 2YFQA 4X3MA 5EXSA 1SXJB 2Y0TA 3ONPA 3UZUA 3SAWA 2XFTA 1HNWM 1K3RA 4YQ6A 3L27A 5BR8M 4XBOA 3J27B 2QNJA 3TWLA 1IN8A 1FNNA 2DNAA 3GLGB 4F1IA 4CNGA 2QPAA 2C5RA 1MU5A 2Z0YA 1NY6A 2L6OA 3JR5A 4LY6A 1G71A 1E94E 5FTLA 1MN3A 1PM5A 2CRUA 1QAOA 3A46A 1G3IA 4KHPM 3U6PA 1R6BX 4HL4A 1QANA 2XSZD 3BOSA 3GRVA 4QOSA 4BBAA 2YNMD 3SASA 4X64M 1Z85A 4JI6M 2UUBM 2V6ZM 3B74A 4BLCA 4YQ1A 2QCUA 4YVHA 1IY0A 2VF7A 3NBXX 3AJIB 5DYGA 3PXGA 1OIPA 5ITRA 2FE8A 1QAMA 2QHOB 4WURA 1GABA 4PD2A 2ZAMA 2L2DA 2J7OA 2V1UA 4QHSA 3KNUA 3HGIA 3TPZA 2V3JA 2DHRA 3CF6E 4GHAA 4RG1A 4YVGA 4YQLA 3GPUA 3QYBA 4LF4M 4AZFA 4MCCA 2RGOA 3W0LB 1QDRA 5ITYA 2RRUA 5KPRA 1IBLM 4LFBM 3H4JA 2I7NA 1S3SA 2VF8A 4GRIA 5ITTA 2VQFM 4L69A 3E46A 3FE3A 3FTFA 2R65A 3LW5F 3I01M 4AKGA 2J5YA 1DGHA 3KDSE 3W67A 3L28A 5KPZA 4AKHA 2C96A 4JI8M 3B89A 1XXHE 5KPTA 2KZSA 2HCBA 4JI1M 2DKLA 4JN6A 2D7EA 3I4YA 1UM8A 5GMCA 4LF9M 1HT1E 4B7HA 5FTJA 4FAKA 2VIIA 2KZUA 3I4VA 3M6AA 4JI0M 3SMPA 4YQKA 2HWJA 3C9PA 4RF1A 4LFAM 4GHLA 3NK7A 3FTCA 5E26A 2ZM6M 3Q8XA 1UAMA 2LVPC 3QWLA 1ZMWA 1WIVA 4G4NA 2Z3XA 3AFHA 1NV8A 2DZLA 2KEBA 4FCWA 2KNZA 3U60B 1GJTA 4GIPA 2DZOB 2KNAA 4B3RM 4CGYB 4L4UA 1P9PA 4QHTA 3F92A 1N77A 2M60A 2UXDM 2KW0A 2BJVA 2CUZA 4FVMA 4S12A 3U6SA 2F5NA 2QBYA 4NL4H 4CHTB 2R62A 2JZ0A 3VLFB 2F5PA 2FS1A 2K9DA 3AKZA 2JY5A 2UXCM 2KHHA 1HJPA 3SHFA 3H4MA 3GQ5A 2QENA 3IHPA 3K9PA 4LJ6A 3U6MA 3FKEA 2CV2A 1QQWA 4YQ3A 3N4JA 3GRYA 3L26A 4MGHA 4CIZA 1ZV1A 1OQYA 4AW4A 2LVOC 4YQSA 3KP0E 3CF0A 2QWVA 3SYLA 4PDGA 4LRSA 4R3DA 2YY8A 3U6LA 4PT5A 4QNMA 5DYIA 2F4VM 4K0KM 1XXHA 1QZMA 3U61B 1QYRA 1HQYE 1Q02A 2CHVA 1MJGM 1OFIA 2R0IA 3A98B 1K3XA 2KNVA 4NC6A 1XWIA 2G8LA 2UU9M 1VH0A 3HJ8A 4B3SM 2DAGA 2H5XA 2OOBA 3IG8A 3HHYA 4I8OA 3AV0A 3U6CA 3JAMS 5CO4A 4MM3B 1JQJC 3KXEC 1Z5AA 2FNAA 2LBCA 1AIPC 4M9ZA 1X37A 4GC5A 4YQCA 3GPXA 1UALA 3BBZA 4OX9M 1EE8A 3O7BA 2P5TA 3THGA 4B7FA 2EA0A 4LJAA 1JR3A 5FTKA 2UXBM 3K9OA 3VDUA 2C9CA 3T38A 4YPYA 3GPPA 4TUWA 2JY7A 4JALA 1YE9A 2ZANA 3PNYA 4YQ7A 1L2BA 1NHWC 1UFZA 2R4JA 2DAEA 2LWXA 3KOWE 5FTMA 2EJSA 4G3OA 3TL4X 3LVWA 3PFIA 4GEWA 1G41A 2LVQD 2DHYA 3GLFE 5F3WA 1GZ0A 1Q39A 3B7NA 3KOYE 1X7PA 1DO0A 3GRUA 3UMMA 1R4GA 3UGJA 4I5SA 2AHMA 3M7GA 5DNYA 1EIJA 4YQIA 4QNRA 1Q3BA 1KSFX 3A42A 3B7ZA 2HL7A 1QDTA 2HAKA 4FWDA 1L2DA 4X66M 5EP3A 1DGHB 3NWLA 2UUAM 1IXZA 4JI7M 3FUVA 2LVAA 4W5WA 4GKKM 3C3DA 2N35A 4YQ2A 3HKPA 3LMMA 4B3MM 2WSEF 2D7GA 4LJ7A 2L09A 1WXQA 2HHHM 4H3ZA 1N78A 2XSZA 5GM8A 3E5YA 1TH3A 1WJ7A 1Z59A 5EP2A 1L1ZA 2JNHA 1VDLA 5EXXA 4F2LA 3HHXA 2LTUA 1V33A 2Y0QA 4X62M 3VK8A 2DWLA 4G4RA 2K6BA 3GLIE 4AKIA 3VKGA 4XGIA 3DFZA 4NRVA 3GLGE 1PGYA 3PVSA 4OVZB 1IXSA 4REZA 3OTOM 1V6ZA 1TO0A 4IBBA 2R18A 3HWSA 1R7RA 3TWMA 4AQYM 1TH4A 3HZJA 3M0EA 3HHWA 4G4QA 2G5GX 3AIAA 1VEKA 3MK6A 5A2QS 2LVNC 2JY8A 5GKNA 1RU3A 1KYIA 2MJ5B 3VDPA 4E8BA 3QAUA 4L15A 4ZPXA 2QBYB 1L8QA 3J7BA 3W0FA 3HJSA 2EO2A 1PRBA 3QUVA 1BVSA 4IBCA 4LJ4A 3GPYA 1T43A 2DWMA 3FRHA 1NV9A 2M5ZA 1D0LA 3ZH9B 4MGKE 4DV2M 3J2PB 4YQQA 2MROB 2YQZA 3GLFA 3J7AS 4FWHA 4X65M 2JWSA 1O6DA 4JWGA 2CX8A 4G4OA 4LG2A 4JAKA 2CHQA 2CHGA 2Y20A 1HNZM 2JZ1A 1TR8A 2ZAOA 2MH8A 2RKOA 3K1JA 4X3LA 4YQGA 5JI2E 3E9SA 1HT2E 3GRRA 3GQ4A 4IIWA 4YHHM 3E4RA 4P16A 3T1HM 4JI4M 1CUKA 3CGWA 1R5LA 1C1KA 2QMMA 1OKSA 1V34A 1L1TA 1L2CA 3GYQA 1MX0A 4M0WA 1OFHA 3MHVC 1MXIA 3I04M 5FAIA 2LNHC 1TF0B 3MMPA 4BB9A 3D8BA 5ITUA 3SATA 1SXJD 4PZKA 2DZNB 3FD9A 2H1RA 3KSJA 3GLIA 1E32A 3NK6A 4YQ0A 5KO3A 3GLGA 2CE7A 4MCDA 4YQNA 1PJIA 1NJFA 1VHYA 5EQTA 4DR2M 4NXMM 2R45A 4KLNA 5EXTA 4DR6M 2XEPA 2CEAA 2R44A 3LCVB 3WHLA 2EGVA 5LMNM 4DUZM 4YY3M 2R4EA 3GLHB 3KS4A 2EGWA 1IN5A 3AOEC 3FUWA 4ANRA 2XFSA 4CJ6A 1K82A 3L8UA 1ZMVA 1OY5A 2EKKA 2OOAA 1G8PA 4YQPA 1V92A 3RE8A 4YQBA 1NHGC 4AG5A 3KW6A 3AI9X 2LHCA 1H6UA 2WSCF 4LJ9A 1T3TA 4DV7M 3KTYA 4Y28F 1HNXM 4MGIE 2L7IA 3SC3A 5JI3E 3KFUG 1NS5A 1NY5A 3E21A 1E9SA 1GL6A 1D2NA 3PNVA 3DA1A 5ITQA 3LQQA 4DV1M 2EUCA 2JY6B 1PJQA 1WR1B 1J7KA 4JWHA 5IT9S 4YQAA 1DGBA 3SAVA 1VEGA 4A3VB 2C99A 1C7YA 1JB0F 5EP1A 1R2ZA 4FMWA 4H3YA 3K2LA 4YVIA 1PJJA 2L7HA 2B3TA 4IBDA 1QZEA 1XNRM 3DZDA 2CWBA 1HQCA 4IJEA 5FSWA 2XH9A 4LJ5A 1N36M 4MB7A 4IG6A 1NO1A 2VQEM 2JUJA 2FOIC 4M0DA 3A45A 4JV5M 1P3QQ 2O25A 4JI5M 4YQ4A 2Z4SA 3L29A 2DWNA 2DENA 4NXNM 1GJSA 4HEOA 4FCVA 2DAKA 1A5TA 2Q2EB 4IBIA 1N33M 3TE6A 1NNUC 4AI6A 1IXRC 2Z8YM 1SXJC 3VKHA 4MGZE 1NVMA 3KOZE 3L25A 3JR4A 3HU2A 2Z4RA 2XLJA 1IN7A 4LZZA 3I51A 4IBKA 3T6PA 2BWBA 3FUXA 3QYEA 1VEJA 4DUYM 5EJCA 5L8RF 4D82A 4YPZA 4B7GA 1WHCA 2VDBB 1PJTA 1XC8A 2HKJA 4G6ZA 4CNDA 4LF6M 4GH9A 4B08A 4YQ5A 4CISA 2X4AA 4NSOB 1TDHA 2O01F 3SYKA 3R9XB 4L16A 1D0MA 1Z5BA 2J7NA 3FUUA 1GLNA 2L4FA 1IN4A 4PDIA 3GP1A 1XB2B 3GQ3A 1I4WA 4KT0F 4DV3M 1HR0M 4HLQA 3U6DA 3U5ZA 2OQ4A 3U6QA 5D9FA 1YUBA 4NRWA 4R7GA 1SXJE 1I94M 3FTEA 3KVWA 4QOZC 2X8AA 1TDZA 3SFZA 8CATA 1NNJA 3J80S 4YVKA 5C18A 3AOEA 3HU1A 5H37D 4DV0M 3U61A 5KQDA 1GVNA 2KRKA 3FTDA 4MH0E 4RF0A 4L78A 1N32M 1F4IA 2DAIA 1X7OA 1DGFA 2KA6B 4R71A 4OW0A 3R8FA 3DOAA 4DR3M 3KY7A 4JYAM 3GLIB 3IEFA 4XK8F 1J5EM 1IQPA 4M9SA 1Q3CA 1V2XA 2O3AA 3HJQA 3L2AA 3HY5A 2XZFA 3KSXA 4GKJM 1OIZA 1N34M 3RGPA 3C3EA 3D8LA 2Y21A 5KQ8A 1NSFA 3DCMX 2MGWA 2XGNA 4IBEA 1TH2A 3SHGB 3BXWA 1IBMM 1TTEA 2YR0A 2CV1A 3Q8GA 4YPWA 3V76A 4L8RC 1OAOC 4YQOA 1EFUB 4FW9A 4P17A 4OU7A 5DFLA 4B3TM 1ZAEA 4YQJA 2GQFA 3UK6A 4FCTA 2KDLA 4DV5M 4YQ8A 2OPFA 2OO9A 3EIHA 1R2YA 1WGLA 2XF3A 2NQ8C 4NOOB 4ITQA 4MCBA 4YPXA 1XXHB 4II7A 4YQDA 1IM2A 3LVVA 2BNKA 4JI3M 2BJWA 2R6FA 2O5RA 2G3QA 2BWEA 2CFOA 3IECA 4IBFA 2FH0A 7CATA 1SXJA 4JI2M 4NSRA 3U6OA 1Y8GA 2QQ8A 5GMBA 2DAMA 2X49A 2LHGA 5C1BA 3LQRA 2V1CA 4AG6A 4DR7M 4FD2A 2LH0A 4Z6YA 4LGYA 1OJLA 1NXZA 1SG9A 1VQ1A 3T15A 3TQSA 1VG5A 4D81A 4LF7M 3TWKA 3IG5A 3ZCBB 1W5SA 1QUSA 2DXIA 3OIJA 1DV0A 1J09A 4RKUF 1VHKA 3OINA 2QZ4A 3HU3A 4WP2A 4LJ8A 1ZMUA 3C58A 1G59A 1Z6TA 3BBHA 4LF5M 4GC9A 2A5YB 1IBKM 4YQ9A 2V3KA 1LV7A 2QP9X 3FYCA 2I6DA 3K92A 5E6JA 1GKIA 4YQRA 4OVZA 1ZJRA 4D80A 1J85A 3CF2A 1XMOM 3OIIA 4KGNA 1N75A 4DR1M 3VK7A 5EP4A 4LF8M 4JWFA 2C9OA 1LTMA 1ZQ9A 3GLHE 1DO2A 4KODA 4LZJA 1JR3E 1D0KA 5FLXS 1GO5A 3EIEA 2ERCA 3HX3A 1NJGA 1IY1A 4I81A 4L6V6 3RFWA 1OAIA 2D7HA 1G4AE 4PCZA 5ITXE 4DR5M 2Z7JA 1YSYA 2XZUA 2DI0A 1VDDA 5IREB 1FJGM 1KFVA 2HA8A 3FYDA 1QAQA 3U6EA 1W5TA 1GL7A 4CNFA 1IPAA 2F5SA 3N4KA 2WZJA 3FRIA 4M9XA 4WW0A 3SMSA 3W68A 2F5OA 2RGHA 4LCBA 1QVRA 4JWJA 3U5ZB 3MJ5A 4I4LA 1XMQM 4J3CA 2ZTCA 5LMUM 2L4EA 4DV6M 2JXNA 1XHBA 4LRTA 4RNAA 2E5LM 2GNOA 3VFDA 2JP7A 2ZBKB 1K3WA 1AUAA 5BPVA 5FTNA 1IXSB 1IFYA 3KS8A 3J81S
chains in the Genus database with same CATH topology
3T1YM 1Z5CA 4YQTA 4LFCM 4MGYE 3SARA 3U60A 3KOXE 3BBDA 4EIWA 2F5QA 1UAJA 1TGUA 3WHKA 2CV0A 3RGSA 2R46A 4YVJA 3K8ZA 2W82A 3AOGA 4Z8XA 3AL0C 3SBJA 2I7PA 5EXPA 4FWGA 4GITA 4DR4M 3ZC7B 3SAUA 3ILKA 3GLHA 3GLFB 1E9RA 4IBGA 1IY2A 4IBJA 1IN6A 3UJNA 5ITXA 2DWZB 4CNEA 1DGGA 1JR3D 2JA2A 4GMQA 2UUCM 2C98A 2KRUA 3BBEA 2K47A 3KW2A 3KP1E 5IWAM 1ORYB 3AXZA 4KDZA 3CTWB 5IZ7D 3NBIA 4JXJA 4LGMA 3HHZA 1UAKA 2KXEA 4KO8A 2FFJA 3B9PA 4DV4M 1XNQM 4IJFA 3GO8A 3FUTA 2LXEA 3IC6A 2DVWB 2YFQA 4X3MA 5EXSA 1SXJB 2Y0TA 3ONPA 3UZUA 3SAWA 2XFTA 1HNWM 1K3RA 4YQ6A 3L27A 5BR8M 4XBOA 3J27B 3TWLA 1IN8A 1FNNA 3GLGB 4CNGA 2QPAA 2C5RA 1MU5A 2Z0YA 1NY6A 2L6OA 3JR5A 4LY6A 1E94E 5FTLA 1PM5A 1QAOA 3A46A 1G3IA 4KHPM 3U6PA 1R6BX 4HL4A 1QANA 2XSZD 3BOSA 3GRVA 4QOSA 4BBAA 2YNMD 3SASA 4X64M 1Z85A 4JI6M 2UUBM 2V6ZM 4BLCA 4YQ1A 2QCUA 4YVHA 1IY0A 5DYGA 3AJIB 3PXGA 5ITRA 2FE8A 1QAMA 4WURA 4PD2A 2ZAMA 2J7OA 2V1UA 4QHSA 3KNUA 3HGIA 3TPZA 2V3JA 2DHRA 3CF6E 4GHAA 4RG1A 4YVGA 4YQLA 3GPUA 4LF4M 4AZFA 4MCCA 2RGOA 3W0LB 1IBLM 5ITYA 5KPRA 4LFBM 4YQRA 2VQFM 2I7NA 1S3SA 4GRIA 5ITTA 4L69A 3FTFA 2R65A 4AKGA 1DGHA 3KDSE 3L28A 5KPZA 4AKHA 2C96A 4JI8M 5KPTA 2KZSA 2HCBA 4JI1M 4JN6A 2D7EA 3I4YA 1UM8A 5GMCA 4LF9M 1HT1E 4B7HA 5FTJA 4FAKA 2VIIA 2KZUA 3I4VA 3M6AA 4JI0M 3SMPA 4YQKA 4RF1A 4LFAM 4GHLA 3NK7A 3FTCA 5E26A 2ZM6M 3Q8XA 1UAMA 3QWLA 4G4NA 2Z3XA 3AFHA 4FCWA 2KEBA 3U60B 4GIPA 2DZOB 4B3RM 4CGYB 4L4UA 1P9PA 4QHTA 1N77A 2M60A 2UXDM 2KW0A 2BJVA 2CUZA 4FVMA 4S12A 3U6SA 2F5NA 2QBYA 4NL4H 4CHTB 2R62A 3VLFB 2F5PA 3AKZA 2UXCM 3SHFA 3H4MA 3GQ5A 2QENA 4LJ6A 2CV2A 3U6MA 3FKEA 4YQ3A 1QQWA 3N4JA 3GRYA 3L26A 4MGHA 4AW4A 4YQSA 3KP0E 3CF0A 2QWVA 3SYLA 4PDGA 4LRSA 4R3DA 2YY8A 3U6LA 4PT5A 4QNMA 5DYIA 2F4VM 4K0KM 1XXHA 1QZMA 3U61B 1QYRA 1HQYE 2CHVA 1OFIA 3A98B 1K3XA 2UU9M 1VH0A 1XWIA 2G8LA 3HJ8A 4B3SM 3IG8A 3HHYA 4I8OA 3AV0A 3U6CA 3JAMS 5CO4A 4MM3B 1JQJC 3KXEC 1Z5AA 2FNAA 4M9ZA 1X37A 4GC5A 4YQCA 3GPXA 1UALA 4OX9M 1EE8A 3O7BA 2P5TA 3THGA 4B7FA 2EA0A 4LJAA 1JR3A 5FTKA 2UXBM 3VDUA 2C9CA 3T38A 4YPYA 3GPPA 4TUWA 4JALA 1YE9A 2ZANA 3PNYA 4YQ7A 1L2BA 1NHWC 2R4JA 2LWXA 3KOWE 5FTMA 3TL4X 3LVWA 3PFIA 1G41A 5F3WA 1X7PA 1GZ0A 1Q39A 3KOYE 1DO0A 3GRUA 3UMMA 3UGJA 4I5SA 2AHMA 3M7GA 5DNYA 4YQIA 4QNRA 1Q3BA 1KSFX 3A42A 1L2DA 2HL7A 4FWDA 4X66M 5EP3A 1DGHB 3NWLA 2UUAM 1IXZA 4JI7M 3FUVA 4W5WA 4GKKM 4YQ2A 3HKPA 3LMMA 4B3MM 2D7GA 4LJ7A 2L09A 1WXQA 2HHHM 4H3ZA 1N78A 2XSZA 5GM8A 3E5YA 1TH3A 5EP2A 1Z59A 1L1ZA 5EXXA 3VK8A 3HHXA 2Y0QA 4X62M 2DWLA 4G4RA 3VKGA 4AKIA 4XGIA 3DFZA 4NRVA 3PVSA 4OVZB 3OTOM 4REZA 1V6ZA 1TO0A 4IBBA 2R18A 3HWSA 1R7RA 3TWMA 4AQYM 1TH4A 3M0EA 3HHWA 4G4QA 2G5GX 3AIAA 5A2QS 3MK6A 5GKNA 1KYIA 3VDPA 4E8BA 3QAUA 4L15A 4ZPXA 2QBYB 1L8QA 3J7BA 3W0FA 3HJSA 2EO2A 3QUVA 4IBCA 4LJ4A 3GPYA 2DWMA 2M5ZA 4DV2M 3ZH9B 4MGKE 3J2PB 4YQQA 3GLFA 2YQZA 3J7AS 4FWHA 4X65M 1O6DA 4JWGA 2CX8A 4G4OA 4LG2A 4JAKA 2CHQA 2CHGA 2Y20A 1HNZM 2ZAOA 2RKOA 3K1JA 4X3LA 4YQGA 5JI2E 3E9SA 1HT2E 3GRRA 3GQ4A 4IIWA 4YHHM 3E4RA 4P16A 3T1HM 4JI4M 1C1KA 2QMMA 1L2CA 1L1TA 3GYQA 1MX0A 4M0WA 1OFHA 3MHVC 1MXIA 5FAIA 2LNHC 4BB9A 3D8BA 5ITUA 3SATA 1SXJD 4PZKA 2DZNB 3KSJA 2H1RA 3FD9A 3GLIA 1E32A 3NK6A 4YQ0A 5KO3A 3GLGA 2CE7A 4MCDA 4YQNA 1PJIA 1NJFA 1VHYA 5EQTA 4DR2M 4NXMM 2R45A 4KLNA 5EXTA 4DR6M 2XEPA 2CEAA 3WHLA 2EGVA 5LMNM 4DUZM 4YY3M 2R4EA 3GLHB 3KS4A 2EGWA 1IN5A 3AOEC 3FUWA 1K82A 2XFSA 3L8UA 1OY5A 1G8PA 4YQPA 3RE8A 4YQBA 1NHGC 4AG5A 3KW6A 3AI9X 1H6UA 4LJ9A 1T3TA 4DV7M 3KTYA 1HNXM 4MGIE 2L7IA 3SC3A 5JI3E 3KFUG 1NS5A 1NY5A 1E9SA 1GL6A 1D2NA 3PNVA 3DA1A 5ITQA 3LQQA 4DV1M 2EUCA 1J7KA 4JWHA 5IT9S 4YQAA 1DGBA 3SAVA 4A3VB 2C99A 5EP1A 1R2ZA 4FMWA 4H3YA 3K2LA 4YVIA 1PJJA 2L7HA 4IBDA 1XNRM 3DZDA 1HQCA 4IJEA 5FSWA 2XH9A 4LJ5A 1N36M 4MB7A 4IG6A 2VQEM 2FOIC 4M0DA 3A45A 4JV5M 4JI5M 4YQ4A 2Z4SA 3L29A 2DWNA 4NXNM 4FCVA 2Q2EB 4IBIA 1N33M 3TE6A 1NNUC 4AI6A 1IXRC 3VKHA 1SXJC 4MGZE 3KOZE 1NVMA 3L25A 3JR4A 3HU2A 2Z4RA 2XLJA 1IN7A 4LZZA 3I51A 4IBKA 3FUXA 4DUYM 5EJCA 4D82A 4YPZA 4B7GA 1XC8A 2HKJA 4G6ZA 4CNDA 4LF6M 4GH9A 4B08A 4YQ5A 4CISA 2X4AA 4NSOB 1TDHA 3SYKA 3R9XB 4L16A 1Z5BA 2J7NA 3FUUA 1GLNA 1IN4A 4PDIA 3GP1A 3GQ3A 1I4WA 4DV3M 1HR0M 4HLQA 3U6DA 3U5ZA 2OQ4A 3U6QA 5D9FA 1YUBA 4NRWA 4R7GA 1SXJE 1I94M 3FTEA 3KVWA 4QOZC 2X8AA 1TDZA 3SFZA 8CATA 1NNJA 3J80S 5C18A 3AOEA 3HU1A 5H37D 4DV0M 3U61A 5KQDA 1GVNA 2KRKA 3FTDA 4MH0E 4RF0A 4L78A 1N32M 1X7OA 1DGFA 2KA6B 4OW0A 3R8FA 3DOAA 4DR3M 3KY7A 4JYAM 3GLIB 3IEFA 1J5EM 1IQPA 4M9SA 1Q3CA 1V2XA 2O3AA 3HJQA 3L2AA 2XZFA 3KSXA 4GKJM 1N34M 3RGPA 3D8LA 2Y21A 5KQ8A 1NSFA 3DCMX 2XGNA 4IBEA 1TH2A 3SHGB 1IBMM 2YR0A 2CV1A 4YPWA 4L8RC 4YQOA 4OU7A 4FW9A 4B3TM 1ZAEA 4YQJA 3UK6A 4FCTA 4DV5M 4YQ8A 2OPFA 3EIHA 1R2YA 2XF3A 2NQ8C 4NOOB 4ITQA 4MCBA 4YPXA 1XXHB 4II7A 4YQDA 1IM2A 3LVVA 2BNKA 4JI3M 2BJWA 2O5RA 2CFOA 4IBFA 7CATA 1SXJA 4JI2M 4NSRA 3U6OA 5GMBA 2X49A 5C1BA 3LQRA 2V1CA 4AG6A 4DR7M 4FD2A 2LH0A 4Z6YA 4LGYA 1OJLA 1NXZA 3T15A 3TQSA 4D81A 4LF7M 3TWKA 3IG5A 3ZCBB 1W5SA 3OIJA 2DXIA 1VHKA 1J09A 3OINA 2QZ4A 3HU3A 4LJ8A 3C58A 1G59A 1Z6TA 3BBHA 4LF5M 4GC9A 2A5YB 1IBKM 4YQ9A 2V3KA 1LV7A 2QP9X 3FYCA 2I6DA 3K92A 5E6JA 1GKIA 4OVZA 1ZJRA 4D80A 1J85A 3CF2A 1XMOM 4KGNA 1N75A 4DR1M 3VK7A 5EP4A 4LF8M 4JWFA 2C9OA 4KODA 1ZQ9A 3OIIA 1DO2A 4LZJA 5FLXS 4YVKA 3EIEA 2ERCA 4I81A 1NJGA 1IY1A 3RFWA 4PCZA 5ITXE 2D7HA 4DR5M 1G4AE 4JWJA 2Z7JA 1YSYA 2XZUA 1VDDA 5IREB 1FJGM 1KFVA 2HA8A 3FYDA 1QAQA 3U6EA 1W5TA 1GL7A 4CNFA 1IPAA 2F5SA 3N4KA 4M9XA 4WW0A 3SMSA 2F5OA 2RGHA 4LCBA 1QVRA 3U5ZB 3MJ5A 4I4LA 1XMQM 4J3CA 5LMUM 4DV6M 1XHBA 4LRTA 4RNAA 2E5LM 3VFDA 2ZBKB 1K3WA 5BPVA 5FTNA 1IXSB 3KS8A 3J81S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6D A;  2CX8 A;  4YQT A;  4JAK A;  3BBD A;  1UAJ A;  4X3L A;  4YQG A;  4YVJ A;  1X7O A;  4YQ3 A;  3N4J A;  3KY7 A;  3IEF A;  3ILK A;  1V2X A;  2O3A A;  2QMM A;  4YQS A;  3GYQ A;  2QWV A;  1MXI A;  5FAI A;  4CNE A;  3DCM X;  2YY8 A;  4PZK A;  3BBE A;  4YQ0 A;  3KW2 A;  3NK6 A;  4YPW A;  4MCD A;  1VH0 A;  4YQN A;  3AXZ A;  1VHY A;  4KDZ A;  1UAK A;  4YQO A;  2EGV A;  5CO4 A;  2EGW A;  4YQJ A;  3IC6 A;  4X3M A;  3L8U A;  4YQ8 A;  1OY5 A;  3ONP A;  4YQC A;  1K3R A;  1UAL A;  4YQ6 A;  4YQP A;  4YPX A;  4XBO A;  4YQB A;  3O7B A;  4YQD A;  3AI9 X;  4CNG A;  3KTY A;  2Z0Y A;  4YPY A;  1NS5 A;  4JAL A;  5GMB A;  4YQ7 A;  1NXZ A;  4YQA A;  1Z85 A;  3OIJ A;  1VHK A;  3OIN A;  1X7P A;  4YQ1 A;  4YVH A;  4H3Y A;  1GZ0 A;  4YVI A;  3BBH A;  4YQ9 A;  2V3K A;  2I6D A;  3KNU A;  4YQI A;  2V3J A;  4IG6 A;  4RG1 A;  4YVG A;  4YQL A;  1ZJR A;  1J85 A;  4YQ4 A;  4YQ2 A;  4KGN A;  4MCC A;  4YQR A;  4MCB A;  4YVK A;  3OII A;  4L69 A;  4H3Z A;  5GM8 A;  3E5Y A;  2HA8 A;  4YPZ A;  5GMC A;  4CNF A;  1V6Z A;  1TO0 A;  4FAK A;  1IPA A;  3N4K A;  4CND A;  4YQ5 A;  4YQK A;  3NK7 A;  3AIA A;  1UAM A;  4J3C A;  4E8B A;  3QUV A;  1P9P A;  4YQQ A;  5D9F A; 
#chains in the Genus database with same CATH topology
 3T1Y M;  1Z5C A;  4YQT A;  4DBG B;  4LFC M;  4MGY E;  2K0B X;  2EKF A;  3U60 A;  3SAR A;  3KOX E;  3BBD A;  4EIW A;  2F5Q A;  1UAJ A;  1OTR A;  1TGU A;  3WHK A;  2CV0 A;  3RGS A;  2R46 A;  2APL A;  4YVJ A;  4UN2 B;  3K8Z A;  2W82 A;  3AOG A;  2QSF X;  4Z8X A;  1WGN A;  2WSF F;  3AL0 C;  3SBJ A;  2I7P A;  5EXP A;  4FWG A;  4GIT A;  4DR4 M;  3ZC7 B;  3B7Q A;  3SAU A;  2ZTD A;  3ILK A;  3GLH A;  3GLF B;  1E9R A;  2CP8 A;  4IBG A;  1IY2 A;  4IBJ A;  1IN6 A;  3UJN A;  1YLA A;  5ITX A;  2DWZ B;  4CNE A;  1DGG A;  1JR3 D;  2JA2 A;  4GMQ A;  2UUC M;  2C98 A;  2KRU A;  3BBE A;  2K47 A;  4Q7J A;  3KW2 A;  3KP1 E;  5IWA M;  1T6O A;  2MR9 A;  1ORY B;  3AXZ A;  4KDZ A;  3CTW B;  5IZ7 D;  3NBI A;  4JXJ A;  1QUT A;  4LGM A;  3HHZ A;  2KXE A;  4KO8 A;  1UAK A;  3LCU A;  2FFJ A;  3B9P A;  1PJS A;  4DV4 M;  4IJF A;  1XNQ M;  3GO8 A;  3FUT A;  3ZQJ A;  2LXE A;  3IC6 A;  2DVW B;  2YFQ A;  4X3M A;  5EXS A;  1SXJ B;  2Y0T A;  3ONP A;  3UZU A;  3SAW A;  2XFT A;  1HNW M;  1K3R A;  4YQ6 A;  3L27 A;  5BR8 M;  4XBO A;  3J27 B;  2QNJ A;  3TWL A;  1IN8 A;  1FNN A;  2DNA A;  3GLG B;  4F1I A;  4CNG A;  2QPA A;  2C5R A;  1MU5 A;  2Z0Y A;  1NY6 A;  2L6O A;  3JR5 A;  4LY6 A;  1G71 A;  1E94 E;  5FTL A;  1MN3 A;  1PM5 A;  2CRU A;  1QAO A;  3A46 A;  1G3I A;  4KHP M;  3U6P A;  1R6B X;  4HL4 A;  1QAN A;  2XSZ D;  3BOS A;  3GRV A;  4QOS A;  4BBA A;  2YNM D;  3SAS A;  4X64 M;  1Z85 A;  4JI6 M;  2UUB M;  2V6Z M;  3B74 A;  4BLC A;  4YQ1 A;  2QCU A;  4YVH A;  1IY0 A;  2VF7 A;  3NBX X;  3AJI B;  5DYG A;  3PXG A;  1OIP A;  5ITR A;  2FE8 A;  1QAM A;  2QHO B;  4WUR A;  1GAB A;  4PD2 A;  2ZAM A;  2L2D A;  2J7O A;  2V1U A;  4QHS A;  3KNU A;  3HGI A;  3TPZ A;  2V3J A;  2DHR A;  3CF6 E;  4GHA A;  4RG1 A;  4YVG A;  4YQL A;  3GPU A;  3QYB A;  4LF4 M;  4AZF A;  4MCC A;  2RGO A;  3W0L B;  1QDR A;  5ITY A;  2RRU A;  5KPR A;  1IBL M;  4LFB M;  3H4J A;  2I7N A;  1S3S A;  2VF8 A;  4GRI A;  5ITT A;  2VQF M;  4L69 A;  3E46 A;  3FE3 A;  3FTF A;  2R65 A;  3LW5 F;  3I01 M;  4AKG A;  2J5Y A;  1DGH A;  3KDS E;  3W67 A;  3L28 A;  5KPZ A;  4AKH A;  2C96 A;  4JI8 M;  3B89 A;  1XXH E;  5KPT A;  2KZS A;  2HCB A;  4JI1 M;  2DKL A;  4JN6 A;  2D7E A;  3I4Y A;  1UM8 A;  5GMC A;  4LF9 M;  1HT1 E;  4B7H A;  5FTJ A;  4FAK A;  2VII A;  2KZU A;  3I4V A;  3M6A A;  4JI0 M;  3SMP A;  4YQK A;  2HWJ A;  3C9P A;  4RF1 A;  4LFA M;  4GHL A;  3NK7 A;  3FTC A;  5E26 A;  2ZM6 M;  3Q8X A;  1UAM A;  2LVP C;  3QWL A;  1ZMW A;  1WIV A;  4G4N A;  2Z3X A;  3AFH A;  1NV8 A;  2DZL A;  2KEB A;  4FCW A;  2KNZ A;  3U60 B;  1GJT A;  4GIP A;  2DZO B;  2KNA A;  4B3R M;  4CGY B;  4L4U A;  1P9P A;  4QHT A;  3F92 A;  1N77 A;  2M60 A;  2UXD M;  2KW0 A;  2BJV A;  2CUZ A;  4FVM A;  4S12 A;  3U6S A;  2F5N A;  2QBY A;  4NL4 H;  4CHT B;  2R62 A;  2JZ0 A;  3VLF B;  2F5P A;  2FS1 A;  2K9D A;  3AKZ A;  2JY5 A;  2UXC M;  2KHH A;  1HJP A;  3SHF A;  3H4M A;  3GQ5 A;  2QEN A;  3IHP A;  3K9P A;  4LJ6 A;  3U6M A;  3FKE A;  2CV2 A;  1QQW A;  4YQ3 A;  3N4J A;  3GRY A;  3L26 A;  4MGH A;  4CIZ A;  1ZV1 A;  1OQY A;  4AW4 A;  2LVO C;  4YQS A;  3KP0 E;  3CF0 A;  2QWV A;  3SYL A;  4PDG A;  4LRS A;  4R3D A;  2YY8 A;  3U6L A;  4PT5 A;  4QNM A;  5DYI A;  2F4V M;  4K0K M;  1XXH A;  1QZM A;  3U61 B;  1QYR A;  1HQY E;  1Q02 A;  2CHV A;  1MJG M;  1OFI A;  2R0I A;  3A98 B;  1K3X A;  2KNV A;  4NC6 A;  1XWI A;  2G8L A;  2UU9 M;  1VH0 A;  3HJ8 A;  4B3S M;  2DAG A;  2H5X A;  2OOB A;  3IG8 A;  3HHY A;  4I8O A;  3AV0 A;  3U6C A;  3JAM S;  5CO4 A;  4MM3 B;  1JQJ C;  3KXE C;  1Z5A A;  2FNA A;  2LBC A;  1AIP C;  4M9Z A;  1X37 A;  4GC5 A;  4YQC A;  3GPX A;  1UAL A;  3BBZ A;  4OX9 M;  1EE8 A;  3O7B A;  2P5T A;  3THG A;  4B7F A;  2EA0 A;  4LJA A;  1JR3 A;  5FTK A;  2UXB M;  3K9O A;  3VDU A;  2C9C A;  3T38 A;  4YPY A;  3GPP A;  4TUW A;  2JY7 A;  4JAL A;  1YE9 A;  2ZAN A;  3PNY A;  4YQ7 A;  1L2B A;  1NHW C;  1UFZ A;  2R4J A;  2DAE A;  2LWX A;  3KOW E;  5FTM A;  2EJS A;  4G3O A;  3TL4 X;  3LVW A;  3PFI A;  4GEW A;  1G41 A;  2LVQ D;  2DHY A;  3GLF E;  5F3W A;  1GZ0 A;  1Q39 A;  3B7N A;  3KOY E;  1X7P A;  1DO0 A;  3GRU A;  3UMM A;  1R4G A;  3UGJ A;  4I5S A;  2AHM A;  3M7G A;  5DNY A;  1EIJ A;  4YQI A;  4QNR A;  1Q3B A;  1KSF X;  3A42 A;  3B7Z A;  2HL7 A;  1QDT A;  2HAK A;  4FWD A;  1L2D A;  4X66 M;  5EP3 A;  1DGH B;  3NWL A;  2UUA M;  1IXZ A;  4JI7 M;  3FUV A;  2LVA A;  4W5W A;  4GKK M;  3C3D A;  2N35 A;  4YQ2 A;  3HKP A;  3LMM A;  4B3M M;  2WSE F;  2D7G A;  4LJ7 A;  2L09 A;  1WXQ A;  2HHH M;  4H3Z A;  1N78 A;  2XSZ A;  5GM8 A;  3E5Y A;  1TH3 A;  1WJ7 A;  1Z59 A;  5EP2 A;  1L1Z A;  2JNH A;  1VDL A;  5EXX A;  4F2L A;  3HHX A;  2LTU A;  1V33 A;  2Y0Q A;  4X62 M;  3VK8 A;  2DWL A;  4G4R A;  2K6B A;  3GLI E;  4AKI A;  3VKG A;  4XGI A;  3DFZ A;  4NRV A;  3GLG E;  1PGY A;  3PVS A;  4OVZ B;  1IXS A;  4REZ A;  3OTO M;  1V6Z A;  1TO0 A;  4IBB A;  2R18 A;  3HWS A;  1R7R A;  3TWM A;  4AQY M;  1TH4 A;  3HZJ A;  3M0E A;  3HHW A;  4G4Q A;  2G5G X;  3AIA A;  1VEK A;  3MK6 A;  5A2Q S;  2LVN C;  2JY8 A;  5GKN A;  1RU3 A;  1KYI A;  2MJ5 B;  3VDP A;  4E8B A;  3QAU A;  4L15 A;  4ZPX A;  2QBY B;  1L8Q A;  3J7B A;  3W0F A;  3HJS A;  2EO2 A;  1PRB A;  3QUV A;  1BVS A;  4IBC A;  4LJ4 A;  3GPY A;  1T43 A;  2DWM A;  3FRH A;  1NV9 A;  2M5Z A;  1D0L A;  3ZH9 B;  4MGK E;  4DV2 M;  3J2P B;  4YQQ A;  2MRO B;  2YQZ A;  3GLF A;  3J7A S;  4FWH A;  4X65 M;  2JWS A;  1O6D A;  4JWG A;  2CX8 A;  4G4O A;  4LG2 A;  4JAK A;  2CHQ A;  2CHG A;  2Y20 A;  1HNZ M;  2JZ1 A;  1TR8 A;  2ZAO A;  2MH8 A;  2RKO A;  3K1J A;  4X3L A;  4YQG A;  5JI2 E;  3E9S A;  1HT2 E;  3GRR A;  3GQ4 A;  4IIW A;  4YHH M;  3E4R A;  4P16 A;  3T1H M;  4JI4 M;  1CUK A;  3CGW A;  1R5L A;  1C1K A;  2QMM A;  1OKS A;  1V34 A;  1L1T A;  1L2C A;  3GYQ A;  1MX0 A;  4M0W A;  1OFH A;  3MHV C;  1MXI A;  3I04 M;  5FAI A;  2LNH C;  1TF0 B;  3MMP A;  4BB9 A;  3D8B A;  5ITU A;  3SAT A;  1SXJ D;  4PZK A;  2DZN B;  3FD9 A;  2H1R A;  3KSJ A;  3GLI A;  1E32 A;  3NK6 A;  4YQ0 A;  5KO3 A;  3GLG A;  2CE7 A;  4MCD A;  4YQN A;  1PJI A;  1NJF A;  1VHY A;  5EQT A;  4DR2 M;  4NXM M;  2R45 A;  4KLN A;  5EXT A;  4DR6 M;  2XEP A;  2CEA A;  2R44 A;  3LCV B;  3WHL A;  2EGV A;  5LMN M;  4DUZ M;  4YY3 M;  2R4E A;  3GLH B;  3KS4 A;  2EGW A;  1IN5 A;  3AOE C;  3FUW A;  4ANR A;  2XFS A;  4CJ6 A;  1K82 A;  3L8U A;  1ZMV A;  1OY5 A;  2EKK A;  2OOA A;  1G8P A;  4YQP A;  1V92 A;  3RE8 A;  4YQB A;  1NHG C;  4AG5 A;  3KW6 A;  3AI9 X;  2LHC A;  1H6U A;  2WSC F;  4LJ9 A;  1T3T A;  4DV7 M;  3KTY A;  4Y28 F;  1HNX M;  4MGI E;  2L7I A;  3SC3 A;  5JI3 E;  3KFU G;  1NS5 A;  1NY5 A;  3E21 A;  1E9S A;  1GL6 A;  1D2N A;  3PNV A;  3DA1 A;  5ITQ A;  3LQQ A;  4DV1 M;  2EUC A;  2JY6 B;  1PJQ A;  1WR1 B;  1J7K A;  4JWH A;  5IT9 S;  4YQA A;  1DGB A;  3SAV A;  1VEG A;  4A3V B;  2C99 A;  1C7Y A;  1JB0 F;  5EP1 A;  1R2Z A;  4FMW A;  4H3Y A;  3K2L A;  4YVI A;  1PJJ A;  2L7H A;  2B3T A;  4IBD A;  1QZE A;  1XNR M;  3DZD A;  2CWB A;  1HQC A;  4IJE A;  5FSW A;  2XH9 A;  4LJ5 A;  1N36 M;  4MB7 A;  4IG6 A;  1NO1 A;  2VQE M;  2JUJ A;  2FOI C;  4M0D A;  3A45 A;  4JV5 M;  1P3Q Q;  2O25 A;  4JI5 M;  4YQ4 A;  2Z4S A;  3L29 A;  2DWN A;  2DEN A;  4NXN M;  1GJS A;  4HEO A;  4FCV A;  2DAK A;  1A5T A;  2Q2E B;  4IBI A;  1N33 M;  3TE6 A;  1NNU C;  4AI6 A;  1IXR C;  2Z8Y M;  1SXJ C;  3VKH A;  4MGZ E;  1NVM A;  3KOZ E;  3L25 A;  3JR4 A;  3HU2 A;  2Z4R A;  2XLJ A;  1IN7 A;  4LZZ A;  3I51 A;  4IBK A;  3T6P A;  2BWB A;  3FUX A;  3QYE A;  1VEJ A;  4DUY M;  5EJC A;  5L8R F;  4D82 A;  4YPZ A;  4B7G A;  1WHC A;  2VDB B;  1PJT A;  1XC8 A;  2HKJ A;  4G6Z A;  4CND A;  4LF6 M;  4GH9 A;  4B08 A;  4YQ5 A;  4CIS A;  2X4A A;  4NSO B;  1TDH A;  2O01 F;  3SYK A;  3R9X B;  4L16 A;  1D0M A;  1Z5B A;  2J7N A;  3FUU A;  1GLN A;  2L4F A;  1IN4 A;  4PDI A;  3GP1 A;  1XB2 B;  3GQ3 A;  1I4W A;  4KT0 F;  4DV3 M;  1HR0 M;  4HLQ A;  3U6D A;  3U5Z A;  2OQ4 A;  3U6Q A;  5D9F A;  1YUB A;  4NRW A;  4R7G A;  1SXJ E;  1I94 M;  3FTE A;  3KVW A;  4QOZ C;  2X8A A;  1TDZ A;  3SFZ A;  8CAT A;  1NNJ A;  3J80 S;  4YVK A;  5C18 A;  3AOE A;  3HU1 A;  5H37 D;  4DV0 M;  3U61 A;  5KQD A;  1GVN A;  2KRK A;  3FTD A;  4MH0 E;  4RF0 A;  4L78 A;  1N32 M;  1F4I A;  2DAI A;  1X7O A;  1DGF A;  2KA6 B;  4R71 A;  4OW0 A;  3R8F A;  3DOA A;  4DR3 M;  3KY7 A;  4JYA M;  3GLI B;  3IEF A;  4XK8 F;  1J5E M;  1IQP A;  4M9S A;  1Q3C A;  1V2X A;  2O3A A;  3HJQ A;  3L2A A;  3HY5 A;  2XZF A;  3KSX A;  4GKJ M;  1OIZ A;  1N34 M;  3RGP A;  3C3E A;  3D8L A;  2Y21 A;  5KQ8 A;  1NSF A;  3DCM X;  2MGW A;  2XGN A;  4IBE A;  1TH2 A;  3SHG B;  3BXW A;  1IBM M;  1TTE A;  2YR0 A;  2CV1 A;  3Q8G A;  4YPW A;  3V76 A;  4L8R C;  1OAO C;  4YQO A;  1EFU B;  4FW9 A;  4P17 A;  4OU7 A;  5DFL A;  4B3T M;  1ZAE A;  4YQJ A;  2GQF A;  3UK6 A;  4FCT A;  2KDL A;  4DV5 M;  4YQ8 A;  2OPF A;  2OO9 A;  3EIH A;  1R2Y A;  1WGL A;  2XF3 A;  2NQ8 C;  4NOO B;  4ITQ A;  4MCB A;  4YPX A;  1XXH B;  4II7 A;  4YQD A;  1IM2 A;  3LVV A;  2BNK A;  4JI3 M;  2BJW A;  2R6F A;  2O5R A;  2G3Q A;  2BWE A;  2CFO A;  3IEC A;  4IBF A;  2FH0 A;  7CAT A;  1SXJ A;  4JI2 M;  4NSR A;  3U6O A;  1Y8G A;  2QQ8 A;  5GMB A;  2DAM A;  2X49 A;  2LHG A;  5C1B A;  3LQR A;  2V1C A;  4AG6 A;  4DR7 M;  4FD2 A;  2LH0 A;  4Z6Y A;  4LGY A;  1OJL A;  1NXZ A;  1SG9 A;  1VQ1 A;  3T15 A;  3TQS A;  1VG5 A;  4D81 A;  4LF7 M;  3TWK A;  3IG5 A;  3ZCB B;  1W5S A;  1QUS A;  2DXI A;  3OIJ A;  1DV0 A;  1J09 A;  4RKU F;  1VHK A;  3OIN A;  2QZ4 A;  3HU3 A;  4WP2 A;  4LJ8 A;  1ZMU A;  3C58 A;  1G59 A;  1Z6T A;  3BBH A;  4LF5 M;  4GC9 A;  2A5Y B;  1IBK M;  4YQ9 A;  2V3K A;  1LV7 A;  2QP9 X;  3FYC A;  2I6D A;  3K92 A;  5E6J A;  1GKI A;  4YQR A;  4OVZ A;  1ZJR A;  4D80 A;  1J85 A;  3CF2 A;  1XMO M;  3OII A;  4KGN A;  1N75 A;  4DR1 M;  3VK7 A;  5EP4 A;  4LF8 M;  4JWF A;  2C9O A;  1LTM A;  1ZQ9 A;  3GLH E;  1DO2 A;  4KOD A;  4LZJ A;  1JR3 E;  1D0K A;  5FLX S;  1GO5 A;  3EIE A;  2ERC A;  3HX3 A;  1NJG A;  1IY1 A;  4I81 A;  4L6V 6;  3RFW A;  1OAI A;  2D7H A;  1G4A E;  4PCZ A;  5ITX E;  4DR5 M;  2Z7J A;  1YSY A;  2XZU A;  2DI0 A;  1VDD A;  5IRE B;  1FJG M;  1KFV A;  2HA8 A;  3FYD A;  1QAQ A;  3U6E A;  1W5T A;  1GL7 A;  4CNF A;  1IPA A;  2F5S A;  3N4K A;  2WZJ A;  3FRI A;  4M9X A;  4WW0 A;  3SMS A;  3W68 A;  2F5O A;  2RGH A;  4LCB A;  1QVR A;  4JWJ A;  3U5Z B;  3MJ5 A;  4I4L A;  1XMQ M;  4J3C A;  2ZTC A;  5LMU M;  2L4E A;  4DV6 M;  2JXN A;  1XHB A;  4LRT A;  4RNA A;  2E5L M;  2GNO A;  3VFD A;  2JP7 A;  2ZBK B;  1K3W A;  1AUA A;  5BPV A;  5FTN A;  1IXS B;  1IFY A;  3KS8 A;  3J81 S; 
#chains in the Genus database with same CATH homology
 3T1Y M;  1Z5C A;  4YQT A;  4LFC M;  4MGY E;  3SAR A;  3U60 A;  3KOX E;  3BBD A;  4EIW A;  2F5Q A;  1UAJ A;  1TGU A;  3WHK A;  2CV0 A;  3RGS A;  2R46 A;  4YVJ A;  3K8Z A;  2W82 A;  3AOG A;  4Z8X A;  3AL0 C;  3SBJ A;  2I7P A;  5EXP A;  4FWG A;  4GIT A;  4DR4 M;  3ZC7 B;  3SAU A;  3ILK A;  3GLH A;  3GLF B;  1E9R A;  4IBG A;  1IY2 A;  4IBJ A;  1IN6 A;  3UJN A;  5ITX A;  2DWZ B;  4CNE A;  1DGG A;  1JR3 D;  2JA2 A;  4GMQ A;  2UUC M;  2C98 A;  2KRU A;  3BBE A;  2K47 A;  3KW2 A;  3KP1 E;  5IWA M;  1ORY B;  3AXZ A;  4KDZ A;  3CTW B;  5IZ7 D;  3NBI A;  4JXJ A;  4LGM A;  3HHZ A;  1UAK A;  2KXE A;  4KO8 A;  2FFJ A;  3B9P A;  4DV4 M;  1XNQ M;  4IJF A;  3GO8 A;  3FUT A;  2LXE A;  3IC6 A;  2DVW B;  2YFQ A;  4X3M A;  5EXS A;  1SXJ B;  2Y0T A;  3ONP A;  3UZU A;  3SAW A;  2XFT A;  1HNW M;  1K3R A;  4YQ6 A;  3L27 A;  5BR8 M;  4XBO A;  3J27 B;  3TWL A;  1IN8 A;  1FNN A;  3GLG B;  4CNG A;  2QPA A;  2C5R A;  1MU5 A;  2Z0Y A;  1NY6 A;  2L6O A;  3JR5 A;  4LY6 A;  1E94 E;  5FTL A;  1PM5 A;  1QAO A;  3A46 A;  1G3I A;  4KHP M;  3U6P A;  1R6B X;  4HL4 A;  1QAN A;  2XSZ D;  3BOS A;  3GRV A;  4QOS A;  4BBA A;  2YNM D;  3SAS A;  4X64 M;  1Z85 A;  4JI6 M;  2UUB M;  2V6Z M;  4BLC A;  4YQ1 A;  2QCU A;  4YVH A;  1IY0 A;  5DYG A;  3AJI B;  3PXG A;  5ITR A;  2FE8 A;  1QAM A;  4WUR A;  4PD2 A;  2ZAM A;  2J7O A;  2V1U A;  4QHS A;  3KNU A;  3HGI A;  3TPZ A;  2V3J A;  2DHR A;  3CF6 E;  4GHA A;  4RG1 A;  4YVG A;  4YQL A;  3GPU A;  4LF4 M;  4AZF A;  4MCC A;  2RGO A;  3W0L B;  1IBL M;  5ITY A;  5KPR A;  4LFB M;  4YQR A;  2VQF M;  2I7N A;  1S3S A;  4GRI A;  5ITT A;  4L69 A;  3FTF A;  2R65 A;  4AKG A;  1DGH A;  3KDS E;  3L28 A;  5KPZ A;  4AKH A;  2C96 A;  4JI8 M;  5KPT A;  2KZS A;  2HCB A;  4JI1 M;  4JN6 A;  2D7E A;  3I4Y A;  1UM8 A;  5GMC A;  4LF9 M;  1HT1 E;  4B7H A;  5FTJ A;  4FAK A;  2VII A;  2KZU A;  3I4V A;  3M6A A;  4JI0 M;  3SMP A;  4YQK A;  4RF1 A;  4LFA M;  4GHL A;  3NK7 A;  3FTC A;  5E26 A;  2ZM6 M;  3Q8X A;  1UAM A;  3QWL A;  4G4N A;  2Z3X A;  3AFH A;  4FCW A;  2KEB A;  3U60 B;  4GIP A;  2DZO B;  4B3R M;  4CGY B;  4L4U A;  1P9P A;  4QHT A;  1N77 A;  2M60 A;  2UXD M;  2KW0 A;  2BJV A;  2CUZ A;  4FVM A;  4S12 A;  3U6S A;  2F5N A;  2QBY A;  4NL4 H;  4CHT B;  2R62 A;  3VLF B;  2F5P A;  3AKZ A;  2UXC M;  3SHF A;  3H4M A;  3GQ5 A;  2QEN A;  4LJ6 A;  2CV2 A;  3U6M A;  3FKE A;  4YQ3 A;  1QQW A;  3N4J A;  3GRY A;  3L26 A;  4MGH A;  4AW4 A;  4YQS A;  3KP0 E;  3CF0 A;  2QWV A;  3SYL A;  4PDG A;  4LRS A;  4R3D A;  2YY8 A;  3U6L A;  4PT5 A;  4QNM A;  5DYI A;  2F4V M;  4K0K M;  1XXH A;  1QZM A;  3U61 B;  1QYR A;  1HQY E;  2CHV A;  1OFI A;  3A98 B;  1K3X A;  2UU9 M;  1VH0 A;  1XWI A;  2G8L A;  3HJ8 A;  4B3S M;  3IG8 A;  3HHY A;  4I8O A;  3AV0 A;  3U6C A;  3JAM S;  5CO4 A;  4MM3 B;  1JQJ C;  3KXE C;  1Z5A A;  2FNA A;  4M9Z A;  1X37 A;  4GC5 A;  4YQC A;  3GPX A;  1UAL A;  4OX9 M;  1EE8 A;  3O7B A;  2P5T A;  3THG A;  4B7F A;  2EA0 A;  4LJA A;  1JR3 A;  5FTK A;  2UXB M;  3VDU A;  2C9C A;  3T38 A;  4YPY A;  3GPP A;  4TUW A;  4JAL A;  1YE9 A;  2ZAN A;  3PNY A;  4YQ7 A;  1L2B A;  1NHW C;  2R4J A;  2LWX A;  3KOW E;  5FTM A;  3TL4 X;  3LVW A;  3PFI A;  1G41 A;  5F3W A;  1X7P A;  1GZ0 A;  1Q39 A;  3KOY E;  1DO0 A;  3GRU A;  3UMM A;  3UGJ A;  4I5S A;  2AHM A;  3M7G A;  5DNY A;  4YQI A;  4QNR A;  1Q3B A;  1KSF X;  3A42 A;  1L2D A;  2HL7 A;  4FWD A;  4X66 M;  5EP3 A;  1DGH B;  3NWL A;  2UUA M;  1IXZ A;  4JI7 M;  3FUV A;  4W5W A;  4GKK M;  4YQ2 A;  3HKP A;  3LMM A;  4B3M M;  2D7G A;  4LJ7 A;  2L09 A;  1WXQ A;  2HHH M;  4H3Z A;  1N78 A;  2XSZ A;  5GM8 A;  3E5Y A;  1TH3 A;  5EP2 A;  1Z59 A;  1L1Z A;  5EXX A;  3VK8 A;  3HHX A;  2Y0Q A;  4X62 M;  2DWL A;  4G4R A;  3VKG A;  4AKI A;  4XGI A;  3DFZ A;  4NRV A;  3PVS A;  4OVZ B;  3OTO M;  4REZ A;  1V6Z A;  1TO0 A;  4IBB A;  2R18 A;  3HWS A;  1R7R A;  3TWM A;  4AQY M;  1TH4 A;  3M0E A;  3HHW A;  4G4Q A;  2G5G X;  3AIA A;  5A2Q S;  3MK6 A;  5GKN A;  1KYI A;  3VDP A;  4E8B A;  3QAU A;  4L15 A;  4ZPX A;  2QBY B;  1L8Q A;  3J7B A;  3W0F A;  3HJS A;  2EO2 A;  3QUV A;  4IBC A;  4LJ4 A;  3GPY A;  2DWM A;  2M5Z A;  4DV2 M;  3ZH9 B;  4MGK E;  3J2P B;  4YQQ A;  3GLF A;  2YQZ A;  3J7A S;  4FWH A;  4X65 M;  1O6D A;  4JWG A;  2CX8 A;  4G4O A;  4LG2 A;  4JAK A;  2CHQ A;  2CHG A;  2Y20 A;  1HNZ M;  2ZAO A;  2RKO A;  3K1J A;  4X3L A;  4YQG A;  5JI2 E;  3E9S A;  1HT2 E;  3GRR A;  3GQ4 A;  4IIW A;  4YHH M;  3E4R A;  4P16 A;  3T1H M;  4JI4 M;  1C1K A;  2QMM A;  1L2C A;  1L1T A;  3GYQ A;  1MX0 A;  4M0W A;  1OFH A;  3MHV C;  1MXI A;  5FAI A;  2LNH C;  4BB9 A;  3D8B A;  5ITU A;  3SAT A;  1SXJ D;  4PZK A;  2DZN B;  3KSJ A;  2H1R A;  3FD9 A;  3GLI A;  1E32 A;  3NK6 A;  4YQ0 A;  5KO3 A;  3GLG A;  2CE7 A;  4MCD A;  4YQN A;  1PJI A;  1NJF A;  1VHY A;  5EQT A;  4DR2 M;  4NXM M;  2R45 A;  4KLN A;  5EXT A;  4DR6 M;  2XEP A;  2CEA A;  3WHL A;  2EGV A;  5LMN M;  4DUZ M;  4YY3 M;  2R4E A;  3GLH B;  3KS4 A;  2EGW A;  1IN5 A;  3AOE C;  3FUW A;  1K82 A;  2XFS A;  3L8U A;  1OY5 A;  1G8P A;  4YQP A;  3RE8 A;  4YQB A;  1NHG C;  4AG5 A;  3KW6 A;  3AI9 X;  1H6U A;  4LJ9 A;  1T3T A;  4DV7 M;  3KTY A;  1HNX M;  4MGI E;  2L7I A;  3SC3 A;  5JI3 E;  3KFU G;  1NS5 A;  1NY5 A;  1E9S A;  1GL6 A;  1D2N A;  3PNV A;  3DA1 A;  5ITQ A;  3LQQ A;  4DV1 M;  2EUC A;  1J7K A;  4JWH A;  5IT9 S;  4YQA A;  1DGB A;  3SAV A;  4A3V B;  2C99 A;  5EP1 A;  1R2Z A;  4FMW A;  4H3Y A;  3K2L A;  4YVI A;  1PJJ A;  2L7H A;  4IBD A;  1XNR M;  3DZD A;  1HQC A;  4IJE A;  5FSW A;  2XH9 A;  4LJ5 A;  1N36 M;  4MB7 A;  4IG6 A;  2VQE M;  2FOI C;  4M0D A;  3A45 A;  4JV5 M;  4JI5 M;  4YQ4 A;  2Z4S A;  3L29 A;  2DWN A;  4NXN M;  4FCV A;  2Q2E B;  4IBI A;  1N33 M;  3TE6 A;  1NNU C;  4AI6 A;  1IXR C;  3VKH A;  1SXJ C;  4MGZ E;  3KOZ E;  1NVM A;  3L25 A;  3JR4 A;  3HU2 A;  2Z4R A;  2XLJ A;  1IN7 A;  4LZZ A;  3I51 A;  4IBK A;  3FUX A;  4DUY M;  5EJC A;  4D82 A;  4YPZ A;  4B7G A;  1XC8 A;  2HKJ A;  4G6Z A;  4CND A;  4LF6 M;  4GH9 A;  4B08 A;  4YQ5 A;  4CIS A;  2X4A A;  4NSO B;  1TDH A;  3SYK A;  3R9X B;  4L16 A;  1Z5B A;  2J7N A;  3FUU A;  1GLN A;  1IN4 A;  4PDI A;  3GP1 A;  3GQ3 A;  1I4W A;  4DV3 M;  1HR0 M;  4HLQ A;  3U6D A;  3U5Z A;  2OQ4 A;  3U6Q A;  5D9F A;  1YUB A;  4NRW A;  4R7G A;  1SXJ E;  1I94 M;  3FTE A;  3KVW A;  4QOZ C;  2X8A A;  1TDZ A;  3SFZ A;  8CAT A;  1NNJ A;  3J80 S;  5C18 A;  3AOE A;  3HU1 A;  5H37 D;  4DV0 M;  3U61 A;  5KQD A;  1GVN A;  2KRK A;  3FTD A;  4MH0 E;  4RF0 A;  4L78 A;  1N32 M;  1X7O A;  1DGF A;  2KA6 B;  4OW0 A;  3R8F A;  3DOA A;  4DR3 M;  3KY7 A;  4JYA M;  3GLI B;  3IEF A;  1J5E M;  1IQP A;  4M9S A;  1Q3C A;  1V2X A;  2O3A A;  3HJQ A;  3L2A A;  2XZF A;  3KSX A;  4GKJ M;  1N34 M;  3RGP A;  3D8L A;  2Y21 A;  5KQ8 A;  1NSF A;  3DCM X;  2XGN A;  4IBE A;  1TH2 A;  3SHG B;  1IBM M;  2YR0 A;  2CV1 A;  4YPW A;  4L8R C;  4YQO A;  4OU7 A;  4FW9 A;  4B3T M;  1ZAE A;  4YQJ A;  3UK6 A;  4FCT A;  4DV5 M;  4YQ8 A;  2OPF A;  3EIH A;  1R2Y A;  2XF3 A;  2NQ8 C;  4NOO B;  4ITQ A;  4MCB A;  4YPX A;  1XXH B;  4II7 A;  4YQD A;  1IM2 A;  3LVV A;  2BNK A;  4JI3 M;  2BJW A;  2O5R A;  2CFO A;  4IBF A;  7CAT A;  1SXJ A;  4JI2 M;  4NSR A;  3U6O A;  5GMB A;  2X49 A;  5C1B A;  3LQR A;  2V1C A;  4AG6 A;  4DR7 M;  4FD2 A;  2LH0 A;  4Z6Y A;  4LGY A;  1OJL A;  1NXZ A;  3T15 A;  3TQS A;  4D81 A;  4LF7 M;  3TWK A;  3IG5 A;  3ZCB B;  1W5S A;  3OIJ A;  2DXI A;  1VHK A;  1J09 A;  3OIN A;  2QZ4 A;  3HU3 A;  4LJ8 A;  3C58 A;  1G59 A;  1Z6T A;  3BBH A;  4LF5 M;  4GC9 A;  2A5Y B;  1IBK M;  4YQ9 A;  2V3K A;  1LV7 A;  2QP9 X;  3FYC A;  2I6D A;  3K92 A;  5E6J A;  1GKI A;  4OVZ A;  1ZJR A;  4D80 A;  1J85 A;  3CF2 A;  1XMO M;  4KGN A;  1N75 A;  4DR1 M;  3VK7 A;  5EP4 A;  4LF8 M;  4JWF A;  2C9O A;  4KOD A;  1ZQ9 A;  3OII A;  1DO2 A;  4LZJ A;  5FLX S;  4YVK A;  3EIE A;  2ERC A;  4I81 A;  1NJG A;  1IY1 A;  3RFW A;  4PCZ A;  5ITX E;  2D7H A;  4DR5 M;  1G4A E;  4JWJ A;  2Z7J A;  1YSY A;  2XZU A;  1VDD A;  5IRE B;  1FJG M;  1KFV A;  2HA8 A;  3FYD A;  1QAQ A;  3U6E A;  1W5T A;  1GL7 A;  4CNF A;  1IPA A;  2F5S A;  3N4K A;  4M9X A;  4WW0 A;  3SMS A;  2F5O A;  2RGH A;  4LCB A;  1QVR A;  3U5Z B;  3MJ5 A;  4I4L A;  1XMQ M;  4J3C A;  5LMU M;  4DV6 M;  1XHB A;  4LRT A;  4RNA A;  2E5L M;  3VFD A;  2ZBK B;  1K3W A;  5BPV A;  5FTN A;  1IXS B;  3KS8 A;  3J81 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...