3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
2V3JA 1P9PA 4XBOA 2EGVA 1NXZA 4YQCA 1IPAA 4H3YA 3KNUA 4RG1A 4YQ1A 4E8BA 3GYQA 2Z0YA 4IG6A 3BBHA 3N4JA 3OINA 3QUVA 1J85A 2YY8A 4YVHA 4J3CA 5GMCA 4CNDA 2QMMA 1O6DA 4YVIA 4MCDA 4X3MA 1VHYA 5GM8A 1TO0A 1V6ZA 4YVGA 4YQ7A 3E5YA 3IC6A 3NK7A 1MXIA 3AI9X 3L8UA 4FAKA 4YQGA 5D9FA 2I6DA 4CNGA 4YQRA 4YQ4A 4YQ6A 4YQ5A 2V3KA 3KY7A 4YQ2A 4YQNA 5GMBA 4YQIA 1VHKA 3N4KA 1Z85A 1X7OA 4YQTA 1X7PA 1UAMA 4YQKA 4JAKA 1NS5A 3BBDA 3ILKA 4YQ0A 4YQ8A 4KGNA 4YVJA 1OY5A 4YQOA 4YQ3A 2EGWA 3DCMX 4YPYA 1ZJRA 3BBEA 5CO4A 4YQBA 3OIIA 4YQQA 5FAIA 3ONPA 4YQLA 3AXZA 4KDZA 4YQAA 4YVKA 1VH0A 4CNEA 4CNFA 3AIAA 4X3LA 4YQPA 4L69A 4YPZA 2O3AA 4YQ9A 2HA8A 3IEFA 4YQJA 4PZKA 4YQSA 1UALA 4YPXA 2QWVA 4YPWA 1K3RA 1UAJA 4MCBA 3KW2A 4H3ZA 3O7BA 1V2XA 3NK6A 3OIJA 1UAKA 4YQDA 4JALA 4MCCA 3KTYA 1GZ0A 2CX8A
chains in the Genus database with same CATH superfamily
1NJGA 2LVPC 2YQZA 2R45A 1TTEA 2M60A 3JR5A 2DXIA 1QAMA 2Z8YM 1IXZA 2C9OA 1D2NA 3U6QA 4AKGA 3SBJA 2KZUA 3PVSA 5C1BA 3KFUG 4GITA 3W68A 1VHYA 1NXZA 3MMPA 3VK7A 3ZCBB 3KOXE 1GO5A 3IHPA 3U6EA 1NY6A 4YQ1A 3BBHA 2DAGA 4MGKE 3QUVA 2CP8A 4M9ZA 5KQ8A 1J85A 4DUYM 1JR3E 1VEGA 2K0BX 3SARA 1HJPA 3FTEA 2QQ8A 2L7IA 1SG9A 2Z7JA 2R18A 5IZ7D 2QMMA 3IG5A 4FCWA 4YVIA 5EP4A 1YLAA 2LTUA 3LMMA 2O25A 3TWLA 3EIEA 4DR2M 3HHXA 2DKLA 4OU7A 4DV0M 3J7AS 3VDUA 1XMOM 3B74A 2Y20A 2LH0A 3D8BA 1GLNA 3VFDA 1WGLA 2DWNA 1L8QA 4MH0E 3TWMA 1XXHE 3I4VA 2QBYA 1MXIA 3GRUA 1AIPC 4FWDA 2EKKA 2XEPA 2XLJA 5H37D 2QP9X 3GP1A 1IY2A 4MB7A 5E26A 3THGA 1OAOC 2Y0QA 4YQ4A 4A3VB 3HU1A 3U60B 1A5TA 1OKSA 2DAEA 1K3XA 5IWAM 4NL4H 1TDZA 1Q39A 2DI0A 1L2BA 1XXHB 4YQIA 3HJ8A 4YQNA 4FWHA 2WZJA 1VHKA 3RE8A 2MR9A 4LF7M 1GVNA 1OQYA 2GQFA 2KW0A 2N35A 2XSZD 3J80S 1GL7A 4L16A 2I7PA 2J7OA 3NBIA 3W67A 3TE6A 3QAUA 1X7PA 1SXJA 5ITTA 1QAOA 3WHLA 5BPVA 1GKIA 4X64M 3GPUA 3R9XB 2KDLA 4G4QA 1NY5A 1XXHA 2KNAA 4JAKA 5FTNA 1IN5A 1EE8A 1WR1B 3L27A 3LW5F 4B08A 4WW0A 2C5RA 1IXSA 2HWJA 3UK6A 5E6JA 1D0KA 3U5ZB 3SHFA 3E21A 4DR4M 4JI4M 1Q02A 2OOAA 2RGHA 4PCZA 4YHHM 4LGMA 1OY5A 1PGYA 1ZJRA 3BBEA 2J7NA 3OIIA 1VEKA 2XFSA 5FAIA 4F1IA 2CHQA 5ITRA 1Q3BA 2OO9A 3B7QA 1J5EM 3ONPA 2C98A 4KDZA 3FKEA 2H5XA 3H4MA 1SXJB 2KNZA 2ZAMA 3FE3A 4NSRA 5JI3E 2UUBM 4B3TM 3CF0A 4OVZA 3L26A 1QANA 3A42A 5KPZA 5ITYA 3GQ3A 4NRWA 2LVAA 3B89A 3AV0A 4IBDA 3U6PA 4YQJA 4PDIA 1TR8A 2L2DA 4IBGA 4QNMA 2CUZA 1NV8A 5KQDA 4JXJA 1MJGM 2LNHC 4AG6A 3UZUA 3KOZE 1Z5CA 3K9OA 1NHGC 2EKFA 1L2CA 4JI5M 4YPWA 1Q3CA 4REZA 1N34M 2LXEA 3KOYE 2JY7A 4MCBA 3FRIA 3KW2A 1NJFA 4XGIA 2M5ZA 3SMSA 2EO2A 1V2XA 3K9PA 4LF4M 3NK6A 2WSFF 3GLIE 1PJTA 1QZMA 3T1HM 1HT1E 2ZTDA 2DZOB 1D0LA 2YFQA 1J09A 1D0MA 4GH9A 4IBCA 4M9SA 2O5RA 2VQEM 3U5ZA 1KFVA 3C3EA 4DR5M 4B3RM 1Z59A 2Y0TA 3HHZA 4JI7M 1NNJA 1IFYA 3CF6E 2KZSA 4KHPM 4JWHA 1ORYB 1GJTA 4L6V6 3ZH9B 2KHHA 3AL0C 1HNXM 4YQCA 4H3YA 1OIZA 4RG1A 2FS1A 3NBXX 3KDSE 5GKNA 2Z0YA 3LVWA 1HQYE 1JR3D 2KEBA 3BBZA 3N4JA 3SHGB 3HHWA 1IY0A 4FCTA 3GRYA 2FOIC 2JP7A 1S3SA 3T38A 3JAMS 4KODA 2JXNA 3KSXA 2O01F 1N78A 2CV1A 1XWIA 4HL4A 1HQCA 4JN6A 4IBIA 2EJSA 5ITQA 1TGUA 2QNJA 3QYEA 4FD2A 2JY5A 1ZAEA 3GRVA 4P17A 3GO8A 3GLFE 2R4JA 1TO0A 1DGGA 5FLXS 2QPAA 4DV7M 1QUSA 3FD9A 3GPYA 1TH4A 3IC6A 4OW0A 3AI9X 1RU3A 2D7EA 4FAKA 3M0EA 4AKIA 1VDDA 4BLCA 2KNVA 3FUWA 3KS4A 5BR8M 2Z3XA 1E9RA 2HKJA 2G5GX 3C9PA 4I4LA 2MGWA 2MH8A 4NXNM 2VQFM 2RGOA 4LJ9A 4GHLA 4GKJM 4LRTA 1DV0A 1IY1A 2XGNA 4OVZB 1KYIA 5KO3A 5GMBA 2DAMA 4IBKA 3CTWB 3A45A 4QHSA 1R2YA 2L7HA 3SMPA 1Z85A 3WHKA 2FFJA 2FH0A 2R65A 4DV1M 1ZMUA 1UAMA 4YQKA 4LFAM 4BB9A 4NC6A 3U6SA 1I94M 1NS5A 4D82A 3AKZA 4RF0A 3FUXA 1HR0M 2XFTA 3BBDA 4YQ0A 3U61B 1QDRA 1FJGM 3FTDA 2H1RA 1EFUB 2VF8A 3LQQA 2LVOC 2BJVA 1BVSA 3NWLA 4R3DA 4CISA 4YQOA 3U6OA 2HAKA 3ZQJA 4MGZE 4PDGA 2DZNB 4LFBM 4GIPA 3K2LA 1I4WA 4YQQA 5L8RF 1L1ZA 7CATA 3AXZA 2L09A 4TUWA 1IN4A 2CFOA 1ZMWA 2QENA 3LVVA 2LHGA 2V6ZM 3FUVA 3AOEC 3KW6A 4CNFA 2GNOA 4IIWA 3GLFA 1QQWA 2KA6B 4AW4A 4JI2M 5DYIA 2UU9M 1W5TA 3LCUA 1QDTA 3KP1E 4YQPA 4L69A 4IJFA 4II7A 4YPZA 2JZ0A 2R6FA 3BOSA 3HU2A 3HWSA 5EQTA 4ANRA 3U6LA 1UALA 1IQPA 2X8AA 3I01M 1OIPA 1QAQA 2X4AA 3HZJA 4Y28F 1N32M 3SATA 4JI0M 1MX0A 3IECA 4IJEA 4DR1M 1UAJA 1GL6A 2Z4SA 2F4VM 2L6OA 4W5WA 3L28A 4B7FA 4X62M 4H3ZA 3FUTA 4ZPXA 2XF3A 3M7GA 3GLIA 3HKPA 4MCCA 4DV5M 3U6MA 1T6OA 3FUUA 3GLHB 3SASA 1PJSA 4FCVA 4GC5A 2ZANA 3F92A 3LCVB 4RF1A 4LY6A 2LVQD 1NV9A 4M9XA 5EJCA 1OFHA 5F3WA 1PJJA 4JWJA 1XNRM 2DHYA 3L2AA 4MGIE 3E4RA 1P9PA 3AFHA 4JI8M 1XB2B 3V76A 1SXJD 4B7HA 4QOZC 3UJNA 3U6DA 4X65M 3LQRA 3RFWA 4PT5A 3KNUA 1G8PA 1G41A 2ERCA 1DGHB 1OFIA 1TH2A 2R46A 4KO8A 3GQ5A 4LF6M 3GYQA 3QYBA 4MCDA 4IG6A 4QHTA 2UXCM 3SFZA 2LHCA 4AKHA 3J81S 2R0IA 2HL7A 3GLIB 3QWLA 1QUTA 3IG8A 2BNKA 4DR7M 3SYKA 4MGHA 2DAKA 4YVHA 5GMCA 4CNDA 4NOOB 1O6DA 1XHBA 1V34A 3HX3A 4WURA 2CV0A 1ZMVA 4LG2A 4Q7JA 2CE7A 1SXJC 1Z5AA 3DOAA 4NSOB 5C18A 2FE8A 1ZQ9A 5ITXA 3TPZA 5GM8A 4LZZA 2Y21A 3SYLA 2X49A 4YQ7A 3GQ4A 3PFIA 4IBJA 1V33A 1QZEA 2JUJA 3BXWA 3NK7A 1N77A 2JA2A 4IBEA 4G4RA 1HNWM 5KPRA 1FNNA 2APLA 3OTOM 4YQGA 2OPFA 4P16A 1TF0B 2A5YB 4B7GA 3SAVA 4G4NA 1IBMM 4CNGA 2QCUA 4YQ6A 1X37A 4FVMA 2QHOB 2V3KA 3C3DA 1N75A 3KY7A 4YQ5A 1WXQA 3AJIB 1DO2A 2JY6B 3J27B 3DZDA 4M0WA 1R5LA 2G3QA 3VK8A 1T43A 3K8ZA 2C9CA 3B9PA 2YNMD 4FW9A 5LMUM 4PD2A 3N4KA 2JWSA 4JI6M 5EP2A 3K92A 3GLGB 5ITXE 4XK8F 3A46A 2DNAA 3T6PA 2F5OA 5A2QS 3GLGE 2VIIA 5IREB 2P5TA 1R7RA 4FWGA 2DENA 3TQSA 4G6ZA 1UM8A 2ZM6M 4DR3M 1Y8GA 2BWBA 3K1JA 1VDLA 4X66M 2R62A 5EXTA 4EIWA 4Z6YA 4OX9M 2C99A 3MK6A 2CRUA 5ITUA 3JR4A 1YE9A 2VDBB 4YVJA 4LJ7A 3FYCA 1HT2E 2KRKA 3GLFB 3VKHA 1UFZA 3E9SA 2J5YA 3GLHE 3I04M 3W0LB 4YPYA 1JB0F 4I81A 1DGFA 2JY8A 1F4IA 1MN3A 3EIHA 1C7YA 4DV3M 4HLQA 4YQLA 1VG5A 2DWZB 4LJAA 2CHGA 2YR0A 4JV5M 4GHAA 2K6BA 1NO1A 1TDHA 1LV7A 5LMNM 4LF5M 2D7HA 1XNQM 1VH0A 2K9DA 3AOGA 3AIAA 3U60A 2D7GA 1IN8A 2R44A 1EIJA 2XSZA 5FTLA 1NVMA 1DGBA 4DBGB 1G59A 4MM3B 4X3LA 3W0FA 1GJSA 2LBCA 4L4UA 3IEFA 1H6UA 2W82A 4PZKA 4DR6M 3VLFB 1L1TA 2QWVA 3U6CA 2AHMA 1DGHA 4AI6A 2RRUA 3HJSA 2FNAA 4AQYM 1VEJA 2Q2EB 3B7NA 2CEAA 8CATA 3O7BA 3KOWE 3HHYA 2L4EA 1IN6A 3DFZA 2F5PA 4GKKM 2B3TA 5IT9S 3GPXA 1UAKA 2G8LA 1AUAA 1QVRA 2EUCA 1IBKM 4B3MM 4DV2M 2LWXA 4R71A 2DVWB 2L4FA 2CX8A 5EXPA 2V3JA 4KLNA 5FTJA 1Z5BA 1IBLM 1PJQA 2HCBA 1LTMA 1OTRA 3GRRA 3VKGA 4R7GA 4XBOA 1WIVA 3L29A 4KT0F 1WHCA 4CGYB 5EXSA 1OJLA 2EGVA 1J7KA 1IPAA 2WSCF 3CGWA 2JZ1A 3HU3A 2XZUA 4GC9A 3J7BA 4E8BA 2OOBA 3TWKA 2VF7A 3J2PB 2DWMA 1K3WA 2UUAM 3OINA 3RGSA 1QYRA 2UXBM 1K82A 1XC8A 2YY8A 4NXMM 1N33M 2UXDM 1T3TA 4RKUF 4LF9M 1W5SA 1YUBA 4J3CA 3TL4X 3PNYA 1DO0A 1IXSB 4I8OA 4X3MA 1NNUC 2K47A 1PJIA 1VQ1A 1SXJE 2NQ8C 2ZBKB 4LJ8A 1V6ZA 3CF2A 4GRIA 3RGPA 3C58A 1N36M 4YVGA 1ZV1A 3E5YA 4LJ5A 4MGYE 4B3SM 1MU5A 3L8UA 4CIZA 1R4GA 1E9SA 3SAWA 2F5QA 3HGIA 5D9FA 3GPPA 3PXGA 3I4YA 4YVKA 2QZ4A 4QNRA 3U61A 3VDPA 5KPTA 4G4OA 4ITQA 1G71A 3I51A 4JI1M 2I6DA 4YQRA 1P3QQ 2RKOA 4S12A 1E94E 2CV2A 2UUCM 4DUZM 2V1CA 5DFLA 1Z6TA 4LGYA 4QOSA 1PM5A 1IM2A 4CHTB 4L8RC 3H4JA 4YQ2A 2QBYB 1TH3A 4RNAA 4LZJA 5FTKA 1NSFA 1G3IA 1V92A 1X7OA 1OAIA 3KSJA 2C96A 3PNVA 4YQTA 3HJQA 3ZC7B 3E46A 2I7NA 1IXRC 2MROB 2ZAOA 4L15A 1R2ZA 4JI3M 4JYAM 1NHWC 4LCBA 3FTFA 2F5NA 2ZTCA 3KXEC 1KSFX 3R8FA 2HHHM 3DA1A 1CUKA 3T15A 3ILKA 3FRHA 4YQ8A 4BBAA 1L2DA 3M6AA 4GMQA 4KGNA 3UMMA 4D81A 3KVWA 5EP3A 3T1YM 4JWGA 3FTCA 4YQ3A 2OQ4A 4K0KM 2EGWA 3DCMX 2R4EA 2DWLA 4LF8M 1JR3A 1IN7A 5CO4A 4YQBA 3Q8XA 1YSYA 4F2LA 1XMQM 2DAIA 4L78A 4YQAA 3SC3A 5JI2E 3GLGA 2QSFX 2EA0A 5EP1A 4CNEA 5EXXA 1WJ7A 3Q8GA 4Z8XA 4AZFA 3KP0E 2LVNC 5FSWA 4G3OA 4YY3M 2E5LM 1G4AE 2CHVA 2XH9A 4WP2A 4I5SA 2XZFA 4YQ9A 2O3AA 2HA8A 4FMWA 1R6BX 4YQSA 2MJ5B 5DYGA 4YPXA 2BWEA 2DZLA 1HNZM 1WGNA 4LJ6A 4IBBA 3MJ5A 4HEOA 4NRVA 2F5SA 1K3RA 2V1UA 3HY5A 3AOEA 2CWBA 4UN2B 1GABA 2JNHA 5DNYA 4JWFA 1E32A 2WSEF 2KRUA 4AG5A 4LFCM 1PRBA 2KXEA 4LRSA 4LJ4A 3SAUA 3MHVC 3D8LA 4GEWA 4DV4M 4IBFA 1JQJC 4JALA 4YQDA 2Z4RA 3GLHA 3L25A 3OIJA 1C1KA 2BJWA 4M0DA 4DV6M 3A98B 3B7ZA 2DHRA 3UGJA 1GZ0A 3KTYA 5FTMA 4D80A 3FYDA 3KS8A 4CJ6A
chains in the Genus database with same CATH topology
1NJGA 2YQZA 2R45A 2M60A 3JR5A 2DXIA 1QAMA 1IXZA 2C9OA 1D2NA 3U6QA 4AKGA 3SBJA 2KZUA 3PVSA 5C1BA 3KFUG 4GITA 1NXZA 3VK7A 3ZCBB 3KOXE 3U6EA 4YQ1A 1NY6A 3BBHA 4MGKE 3QUVA 4M9ZA 5KQ8A 1J85A 4DUYM 3SARA 3FTEA 2L7IA 2Z7JA 5IZ7D 2R18A 2QMMA 3IG5A 4FCWA 4YVIA 5EP4A 3TWLA 3LMMA 4DR2M 4MCDA 3EIEA 3HHXA 4OU7A 4DV0M 3J7AS 3VDUA 1XMOM 2Y20A 2LH0A 3D8BA 1GLNA 3VFDA 2DWNA 1L8QA 4MH0E 3TWMA 3I4VA 1MXIA 2QBYA 3GRUA 4FWDA 2XEPA 2XLJA 5H37D 2QP9X 3GP1A 1IY2A 4MB7A 5E26A 3THGA 2Y0QA 4YQ4A 4A3VB 3HU1A 3U60B 1K3XA 5IWAM 4NL4H 1TDZA 1Q39A 1L2BA 4YQNA 1XXHB 4YQIA 3HJ8A 4FWHA 1VHKA 3RE8A 4LF7M 1GVNA 2KW0A 2XSZD 3J80S 1GL7A 4L16A 2I7PA 2J7OA 3NBIA 3TE6A 3QAUA 1X7PA 1SXJA 5ITTA 1QAOA 3WHLA 5BPVA 1GKIA 4X64M 3GPUA 3R9XB 4G4QA 1NY5A 1XXHA 4JAKA 5FTNA 1IN5A 1EE8A 4B08A 3L27A 4WW0A 2C5RA 3UK6A 5E6JA 3U5ZB 3SHFA 4DR4M 4JI4M 2RGHA 4YHHM 1OY5A 4PCZA 4LGMA 1ZJRA 3BBEA 2J7NA 3OIIA 2XFSA 5FAIA 2CHQA 5ITRA 1Q3BA 1J5EM 3ONPA 4KDZA 2C98A 3FKEA 3H4MA 1SXJB 2ZAMA 4NSRA 5JI3E 2UUBM 4B3TM 3CF0A 4OVZA 3L26A 1QANA 3A42A 5KPZA 5ITYA 3GQ3A 4NRWA 3AV0A 4IBDA 3U6PA 4YQJA 4PDIA 4IBGA 4QNMA 2CUZA 5KQDA 4JXJA 2LNHC 4AG6A 3UZUA 3KOZE 1Z5CA 4JI5M 1NHGC 1L2CA 4YPWA 1Q3CA 4REZA 1N34M 2LXEA 3KOYE 4MCBA 3KW2A 1NJFA 4XGIA 2M5ZA 3SMSA 2EO2A 1V2XA 4LF4M 3NK6A 1QZMA 3T1HM 1HT1E 2DZOB 2YFQA 4GH9A 1J09A 4IBCA 4M9SA 2VQEM 2O5RA 3U5ZA 1KFVA 4DR5M 4B3RM 1Z59A 2Y0TA 3HHZA 4JI7M 1NNJA 3CF6E 2KZSA 4KHPM 4JWHA 1ORYB 3ZH9B 3AL0C 1HNXM 4YQCA 4H3YA 4RG1A 3KDSE 5GKNA 2Z0YA 3LVWA 1HQYE 1JR3D 2KEBA 3N4JA 3SHGB 3HHWA 1IY0A 4FCTA 3GRYA 2FOIC 3T38A 1S3SA 3JAMS 4KODA 3KSXA 1N78A 2CV1A 1XWIA 4HL4A 1HQCA 4JN6A 4IBIA 5ITQA 1TGUA 4FD2A 3GRVA 1ZAEA 3GO8A 2R4JA 1TO0A 1DGGA 5FLXS 2QPAA 4DV7M 3GPYA 3FD9A 1TH4A 3IC6A 4OW0A 3AI9X 2D7EA 4FAKA 3M0EA 4AKIA 1VDDA 4BLCA 2Z3XA 3FUWA 3KS4A 5BR8M 1E9RA 2HKJA 2G5GX 4I4LA 2VQFM 4NXNM 2RGOA 4LJ9A 4GHLA 4GKJM 4LRTA 1IY1A 2XGNA 4OVZB 1KYIA 5KO3A 5GMBA 4IBKA 3CTWB 3A45A 4QHSA 1R2YA 2L7HA 3SMPA 1Z85A 3WHKA 2FFJA 2R65A 4DV1M 1UAMA 4YQKA 4LFAM 4BB9A 3U6SA 1I94M 1NS5A 4D82A 3AKZA 4RF0A 3FUXA 1HR0M 2XFTA 3BBDA 4YQ0A 3U61B 1FJGM 3FTDA 2H1RA 3LQQA 2BJVA 3NWLA 4R3DA 4CISA 4YQOA 3U6OA 4MGZE 4PDGA 2DZNB 4LFBM 4GIPA 3K2LA 1I4WA 4YQQA 1L1ZA 7CATA 3AXZA 2L09A 4TUWA 1IN4A 2CFOA 2QENA 3LVVA 2V6ZM 4YVKA 3FUVA 3AOEC 3KW6A 4CNFA 4IIWA 3GLFA 4JI2M 1QQWA 2KA6B 4AW4A 5DYIA 2UU9M 1W5TA 3KP1E 4YQPA 4L69A 4IJFA 4II7A 4YPZA 3BOSA 3HU2A 3HWSA 5EQTA 3U6LA 1UALA 1IQPA 2X8AA 1N32M 1QAQA 2X4AA 3SATA 4JI0M 1MX0A 4DR1M 4IJEA 1UAJA 1GL6A 2Z4SA 2F4VM 2L6OA 4W5WA 3L28A 4B7FA 4X62M 4H3ZA 3FUTA 4ZPXA 2XF3A 3M7GA 3GLIA 3HKPA 4MCCA 4DV5M 3U6MA 3FUUA 3GLHB 3SASA 4FCVA 4GC5A 2ZANA 4RF1A 4LY6A 5EJCA 4M9XA 1OFHA 5F3WA 1PJJA 4JWJA 1XNRM 3L2AA 4MGIE 3E4RA 1P9PA 3AFHA 4JI8M 1SXJD 4B7HA 4QOZC 3UJNA 3U6DA 4X65M 3LQRA 3RFWA 4PT5A 3KNUA 1G8PA 1G41A 2ERCA 1DGHB 1OFIA 1TH2A 2R46A 4KO8A 3GQ5A 4LF6M 3GYQA 4IG6A 4QHTA 2UXCM 3SFZA 4AKHA 3J81S 2HL7A 3GLIB 3QWLA 3IG8A 2BNKA 4DR7M 3SYKA 4MGHA 4YVHA 5GMCA 4CNDA 4NOOB 1O6DA 1XHBA 4WURA 4LG2A 2CV0A 2CE7A 1SXJC 1Z5AA 3DOAA 4NSOB 5C18A 2FE8A 1ZQ9A 5ITXA 3TPZA 5GM8A 4LZZA 2Y21A 3SYLA 2X49A 4YQ7A 3GQ4A 3PFIA 4IBJA 3NK7A 1N77A 2JA2A 4IBEA 4G4RA 1HNWM 5KPRA 1FNNA 3OTOM 4YQGA 2OPFA 4P16A 2A5YB 3SAVA 4B7GA 1IBMM 4G4NA 4CNGA 2QCUA 4YQ6A 1X37A 4FVMA 2V3KA 3KY7A 4YQ5A 1N75A 1WXQA 3AJIB 1DO2A 3J27B 3DZDA 4M0WA 3VK8A 3K8ZA 2C9CA 3B9PA 2YNMD 4FW9A 5LMUM 4PD2A 3N4KA 4JI6M 5EP2A 3K92A 3GLGB 5ITXE 3A46A 2F5OA 5A2QS 2VIIA 5IREB 2P5TA 1R7RA 4FWGA 2ZM6M 3TQSA 4G6ZA 1UM8A 4DR3M 3K1JA 4X66M 4EIWA 2R62A 5EXTA 4Z6YA 4OX9M 2C99A 3MK6A 5ITUA 3JR4A 1YE9A 4YVJA 4LJ7A 3FYCA 1HT2E 2KRKA 3GLFB 3VKHA 3E9SA 4YPYA 3W0LB 4I81A 1DGFA 3EIHA 4DV3M 4HLQA 4YQLA 2DWZB 4LJAA 2CHGA 2YR0A 4JV5M 4GHAA 1TDHA 1VH0A 1LV7A 5LMNM 4LF5M 2D7HA 1XNQM 3AIAA 3AOGA 3U60A 2D7GA 1IN8A 4X3LA 2XSZA 5FTLA 1NVMA 1DGBA 1G59A 4MM3B 3W0FA 4L4UA 3IEFA 1H6UA 2W82A 4PZKA 4DR6M 3VLFB 1L1TA 2QWVA 3U6CA 2AHMA 1DGHA 4AI6A 3HJSA 2FNAA 4AQYM 2Q2EB 2CEAA 8CATA 3O7BA 3KOWE 3HHYA 2F5PA 1IN6A 3DFZA 4GKKM 5IT9S 1UAKA 3GPXA 2G8LA 1QVRA 2EUCA 1IBKM 4B3MM 4DV2M 2LWXA 2DVWB 2CX8A 5EXPA 2V3JA 4KLNA 5FTJA 1Z5BA 1IBLM 2HCBA 3GRRA 3VKGA 4R7GA 4XBOA 3L29A 4CGYB 5EXSA 1OJLA 2EGVA 1J7KA 1IPAA 2XZUA 3HU3A 4GC9A 3J7BA 4E8BA 3TWKA 3J2PB 2DWMA 1K3WA 2UUAM 3OINA 3RGSA 1QYRA 2UXBM 1K82A 1XC8A 2YY8A 4NXMM 1N33M 2UXDM 1T3TA 4LF9M 1W5SA 1YUBA 4J3CA 3TL4X 3PNYA 1DO0A 1IXSB 4I8OA 4X3MA 1NNUC 2K47A 1PJIA 2ZBKB 1SXJE 2NQ8C 4LJ8A 1V6ZA 1VHYA 3CF2A 4GRIA 3RGPA 3C58A 1N36M 4YVGA 3E5YA 4LJ5A 4MGYE 4B3SM 1MU5A 3L8UA 1E9SA 3SAWA 2F5QA 3HGIA 5D9FA 3GPPA 3PXGA 3I4YA 2QZ4A 4QNRA 3U61A 3VDPA 5KPTA 4G4OA 4ITQA 4JI1M 3I51A 2I6DA 4YQRA 2RKOA 4S12A 1E94E 2CV2A 2UUCM 4DUZM 2V1CA 4YQ2A 1Z6TA 4LGYA 4QOSA 1PM5A 1IM2A 4CHTB 4L8RC 2QBYB 1TH3A 4RNAA 4LZJA 5FTKA 1NSFA 1G3IA 1X7OA 3KSJA 2C96A 3PNVA 4YQTA 3HJQA 3ZC7B 2I7NA 1IXRC 2ZAOA 4L15A 1R2ZA 4JI3M 4JYAM 1NHWC 4LCBA 3FTFA 2F5NA 3KXEC 1KSFX 3R8FA 2HHHM 3DA1A 3T15A 3ILKA 4YQ8A 4BBAA 1L2DA 3M6AA 4GMQA 4KGNA 3UMMA 4D81A 3KVWA 5EP3A 3T1YM 4JWGA 3FTCA 4YQ3A 2OQ4A 4K0KM 2EGWA 3DCMX 2R4EA 2DWLA 4LF8M 1JR3A 1IN7A 5CO4A 4YQBA 3Q8XA 1YSYA 1XMQM 4L78A 4YQAA 3SC3A 5JI2E 3GLGA 2EA0A 5EP1A 4CNEA 5EXXA 4AZFA 4Z8XA 3KP0E 5FSWA 4YY3M 2E5LM 1G4AE 2CHVA 2XH9A 4I5SA 2XZFA 4YQ9A 2O3AA 2HA8A 4FMWA 1R6BX 4YQSA 5DYGA 4YPXA 1HNZM 4LJ6A 4IBBA 3MJ5A 4NRVA 2F5SA 1K3RA 2V1UA 3AOEA 5DNYA 4JWFA 1E32A 2KRUA 4AG5A 4LFCM 2KXEA 4LRSA 4LJ4A 3SAUA 3MHVC 3D8LA 3OIJA 4DV4M 4IBFA 1JQJC 4JALA 4YQDA 2Z4RA 3GLHA 3L25A 1C1KA 2BJWA 4M0DA 4DV6M 3A98B 1GZ0A 2DHRA 3UGJA 3KTYA 5FTMA 4D80A 3FYDA 3KS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3J A;  1P9P A;  4XBO A;  2EGV A;  1NXZ A;  4YQC A;  1IPA A;  4H3Y A;  3KNU A;  4RG1 A;  4YQ1 A;  4E8B A;  3GYQ A;  2Z0Y A;  4IG6 A;  3BBH A;  3N4J A;  3OIN A;  3QUV A;  1J85 A;  2YY8 A;  4YVH A;  4J3C A;  5GMC A;  4CND A;  2QMM A;  1O6D A;  4YVI A;  4MCD A;  4X3M A;  1VHY A;  5GM8 A;  1TO0 A;  1V6Z A;  4YVG A;  4YQ7 A;  3E5Y A;  3IC6 A;  3NK7 A;  1MXI A;  3AI9 X;  3L8U A;  4FAK A;  4YQG A;  5D9F A;  2I6D A;  4CNG A;  4YQR A;  4YQ4 A;  4YQ6 A;  4YQ5 A;  2V3K A;  3KY7 A;  4YQ2 A;  4YQN A;  5GMB A;  4YQI A;  1VHK A;  3N4K A;  1Z85 A;  1X7O A;  4YQT A;  1X7P A;  1UAM A;  4YQK A;  4JAK A;  1NS5 A;  3BBD A;  3ILK A;  4YQ0 A;  4YQ8 A;  4KGN A;  4YVJ A;  1OY5 A;  4YQO A;  4YQ3 A;  2EGW A;  3DCM X;  4YPY A;  1ZJR A;  3BBE A;  5CO4 A;  4YQB A;  3OII A;  4YQQ A;  5FAI A;  3ONP A;  4YQL A;  3AXZ A;  4KDZ A;  4YQA A;  4YVK A;  1VH0 A;  4CNE A;  4CNF A;  3AIA A;  4X3L A;  4YQP A;  4L69 A;  4YPZ A;  2O3A A;  4YQ9 A;  2HA8 A;  3IEF A;  4YQJ A;  4PZK A;  4YQS A;  1UAL A;  4YPX A;  2QWV A;  4YPW A;  1K3R A;  1UAJ A;  4MCB A;  3KW2 A;  4H3Z A;  3O7B A;  1V2X A;  3NK6 A;  3OIJ A;  1UAK A;  4YQD A;  4JAL A;  4MCC A;  3KTY A;  1GZ0 A;  2CX8 A; 
#chains in the Genus database with same CATH topology
 1NJG A;  2LVP C;  2YQZ A;  2R45 A;  1TTE A;  2M60 A;  3JR5 A;  2DXI A;  1QAM A;  2Z8Y M;  1IXZ A;  2C9O A;  1D2N A;  3U6Q A;  4AKG A;  3SBJ A;  2KZU A;  3PVS A;  5C1B A;  3KFU G;  4GIT A;  3W68 A;  1VHY A;  1NXZ A;  3MMP A;  3VK7 A;  3ZCB B;  3KOX E;  1GO5 A;  3IHP A;  3U6E A;  1NY6 A;  4YQ1 A;  3BBH A;  2DAG A;  4MGK E;  3QUV A;  2CP8 A;  4M9Z A;  5KQ8 A;  1J85 A;  4DUY M;  1JR3 E;  1VEG A;  2K0B X;  3SAR A;  1HJP A;  3FTE A;  2QQ8 A;  2L7I A;  1SG9 A;  2Z7J A;  2R18 A;  5IZ7 D;  2QMM A;  3IG5 A;  4FCW A;  4YVI A;  5EP4 A;  1YLA A;  2LTU A;  3LMM A;  2O25 A;  3TWL A;  3EIE A;  4DR2 M;  3HHX A;  2DKL A;  4OU7 A;  4DV0 M;  3J7A S;  3VDU A;  1XMO M;  3B74 A;  2Y20 A;  2LH0 A;  3D8B A;  1GLN A;  3VFD A;  1WGL A;  2DWN A;  1L8Q A;  4MH0 E;  3TWM A;  1XXH E;  3I4V A;  2QBY A;  1MXI A;  3GRU A;  1AIP C;  4FWD A;  2EKK A;  2XEP A;  2XLJ A;  5H37 D;  2QP9 X;  3GP1 A;  1IY2 A;  4MB7 A;  5E26 A;  3THG A;  1OAO C;  2Y0Q A;  4YQ4 A;  4A3V B;  3HU1 A;  3U60 B;  1A5T A;  1OKS A;  2DAE A;  1K3X A;  5IWA M;  4NL4 H;  1TDZ A;  1Q39 A;  2DI0 A;  1L2B A;  1XXH B;  4YQI A;  3HJ8 A;  4YQN A;  4FWH A;  2WZJ A;  1VHK A;  3RE8 A;  2MR9 A;  4LF7 M;  1GVN A;  1OQY A;  2GQF A;  2KW0 A;  2N35 A;  2XSZ D;  3J80 S;  1GL7 A;  4L16 A;  2I7P A;  2J7O A;  3NBI A;  3W67 A;  3TE6 A;  3QAU A;  1X7P A;  1SXJ A;  5ITT A;  1QAO A;  3WHL A;  5BPV A;  1GKI A;  4X64 M;  3GPU A;  3R9X B;  2KDL A;  4G4Q A;  1NY5 A;  1XXH A;  2KNA A;  4JAK A;  5FTN A;  1IN5 A;  1EE8 A;  1WR1 B;  3L27 A;  3LW5 F;  4B08 A;  4WW0 A;  2C5R A;  1IXS A;  2HWJ A;  3UK6 A;  5E6J A;  1D0K A;  3U5Z B;  3SHF A;  3E21 A;  4DR4 M;  4JI4 M;  1Q02 A;  2OOA A;  2RGH A;  4PCZ A;  4YHH M;  4LGM A;  1OY5 A;  1PGY A;  1ZJR A;  3BBE A;  2J7N A;  3OII A;  1VEK A;  2XFS A;  5FAI A;  4F1I A;  2CHQ A;  5ITR A;  1Q3B A;  2OO9 A;  3B7Q A;  1J5E M;  3ONP A;  2C98 A;  4KDZ A;  3FKE A;  2H5X A;  3H4M A;  1SXJ B;  2KNZ A;  2ZAM A;  3FE3 A;  4NSR A;  5JI3 E;  2UUB M;  4B3T M;  3CF0 A;  4OVZ A;  3L26 A;  1QAN A;  3A42 A;  5KPZ A;  5ITY A;  3GQ3 A;  4NRW A;  2LVA A;  3B89 A;  3AV0 A;  4IBD A;  3U6P A;  4YQJ A;  4PDI A;  1TR8 A;  2L2D A;  4IBG A;  4QNM A;  2CUZ A;  1NV8 A;  5KQD A;  4JXJ A;  1MJG M;  2LNH C;  4AG6 A;  3UZU A;  3KOZ E;  1Z5C A;  3K9O A;  1NHG C;  2EKF A;  1L2C A;  4JI5 M;  4YPW A;  1Q3C A;  4REZ A;  1N34 M;  2LXE A;  3KOY E;  2JY7 A;  4MCB A;  3FRI A;  3KW2 A;  1NJF A;  4XGI A;  2M5Z A;  3SMS A;  2EO2 A;  1V2X A;  3K9P A;  4LF4 M;  3NK6 A;  2WSF F;  3GLI E;  1PJT A;  1QZM A;  3T1H M;  1HT1 E;  2ZTD A;  2DZO B;  1D0L A;  2YFQ A;  1J09 A;  1D0M A;  4GH9 A;  4IBC A;  4M9S A;  2O5R A;  2VQE M;  3U5Z A;  1KFV A;  3C3E A;  4DR5 M;  4B3R M;  1Z59 A;  2Y0T A;  3HHZ A;  4JI7 M;  1NNJ A;  1IFY A;  3CF6 E;  2KZS A;  4KHP M;  4JWH A;  1ORY B;  1GJT A;  4L6V 6;  3ZH9 B;  2KHH A;  3AL0 C;  1HNX M;  4YQC A;  4H3Y A;  1OIZ A;  4RG1 A;  2FS1 A;  3NBX X;  3KDS E;  5GKN A;  2Z0Y A;  3LVW A;  1HQY E;  1JR3 D;  2KEB A;  3BBZ A;  3N4J A;  3SHG B;  3HHW A;  1IY0 A;  4FCT A;  3GRY A;  2FOI C;  2JP7 A;  1S3S A;  3T38 A;  3JAM S;  4KOD A;  2JXN A;  3KSX A;  2O01 F;  1N78 A;  2CV1 A;  1XWI A;  4HL4 A;  1HQC A;  4JN6 A;  4IBI A;  2EJS A;  5ITQ A;  1TGU A;  2QNJ A;  3QYE A;  4FD2 A;  2JY5 A;  1ZAE A;  3GRV A;  4P17 A;  3GO8 A;  3GLF E;  2R4J A;  1TO0 A;  1DGG A;  5FLX S;  2QPA A;  4DV7 M;  1QUS A;  3FD9 A;  3GPY A;  1TH4 A;  3IC6 A;  4OW0 A;  3AI9 X;  1RU3 A;  2D7E A;  4FAK A;  3M0E A;  4AKI A;  1VDD A;  4BLC A;  2KNV A;  3FUW A;  3KS4 A;  5BR8 M;  2Z3X A;  1E9R A;  2HKJ A;  2G5G X;  3C9P A;  4I4L A;  2MGW A;  2MH8 A;  4NXN M;  2VQF M;  2RGO A;  4LJ9 A;  4GHL A;  4GKJ M;  4LRT A;  1DV0 A;  1IY1 A;  2XGN A;  4OVZ B;  1KYI A;  5KO3 A;  5GMB A;  2DAM A;  4IBK A;  3CTW B;  3A45 A;  4QHS A;  1R2Y A;  2L7H A;  3SMP A;  1Z85 A;  3WHK A;  2FFJ A;  2FH0 A;  2R65 A;  4DV1 M;  1ZMU A;  1UAM A;  4YQK A;  4LFA M;  4BB9 A;  4NC6 A;  3U6S A;  1I94 M;  1NS5 A;  4D82 A;  3AKZ A;  4RF0 A;  3FUX A;  1HR0 M;  2XFT A;  3BBD A;  4YQ0 A;  3U61 B;  1QDR A;  1FJG M;  3FTD A;  2H1R A;  1EFU B;  2VF8 A;  3LQQ A;  2LVO C;  2BJV A;  1BVS A;  3NWL A;  4R3D A;  4CIS A;  4YQO A;  3U6O A;  2HAK A;  3ZQJ A;  4MGZ E;  4PDG A;  2DZN B;  4LFB M;  4GIP A;  3K2L A;  1I4W A;  4YQQ A;  5L8R F;  1L1Z A;  7CAT A;  3AXZ A;  2L09 A;  4TUW A;  1IN4 A;  2CFO A;  1ZMW A;  2QEN A;  3LVV A;  2LHG A;  2V6Z M;  3FUV A;  3AOE C;  3KW6 A;  4CNF A;  2GNO A;  4IIW A;  3GLF A;  1QQW A;  2KA6 B;  4AW4 A;  4JI2 M;  5DYI A;  2UU9 M;  1W5T A;  3LCU A;  1QDT A;  3KP1 E;  4YQP A;  4L69 A;  4IJF A;  4II7 A;  4YPZ A;  2JZ0 A;  2R6F A;  3BOS A;  3HU2 A;  3HWS A;  5EQT A;  4ANR A;  3U6L A;  1UAL A;  1IQP A;  2X8A A;  3I01 M;  1OIP A;  1QAQ A;  2X4A A;  3HZJ A;  4Y28 F;  1N32 M;  3SAT A;  4JI0 M;  1MX0 A;  3IEC A;  4IJE A;  4DR1 M;  1UAJ A;  1GL6 A;  2Z4S A;  2F4V M;  2L6O A;  4W5W A;  3L28 A;  4B7F A;  4X62 M;  4H3Z A;  3FUT A;  4ZPX A;  2XF3 A;  3M7G A;  3GLI A;  3HKP A;  4MCC A;  4DV5 M;  3U6M A;  1T6O A;  3FUU A;  3GLH B;  3SAS A;  1PJS A;  4FCV A;  4GC5 A;  2ZAN A;  3F92 A;  3LCV B;  4RF1 A;  4LY6 A;  2LVQ D;  1NV9 A;  4M9X A;  5EJC A;  1OFH A;  5F3W A;  1PJJ A;  4JWJ A;  1XNR M;  2DHY A;  3L2A A;  4MGI E;  3E4R A;  1P9P A;  3AFH A;  4JI8 M;  1XB2 B;  3V76 A;  1SXJ D;  4B7H A;  4QOZ C;  3UJN A;  3U6D A;  4X65 M;  3LQR A;  3RFW A;  4PT5 A;  3KNU A;  1G8P A;  1G41 A;  2ERC A;  1DGH B;  1OFI A;  1TH2 A;  2R46 A;  4KO8 A;  3GQ5 A;  4LF6 M;  3GYQ A;  3QYB A;  4MCD A;  4IG6 A;  4QHT A;  2UXC M;  3SFZ A;  2LHC A;  4AKH A;  3J81 S;  2R0I A;  2HL7 A;  3GLI B;  3QWL A;  1QUT A;  3IG8 A;  2BNK A;  4DR7 M;  3SYK A;  4MGH A;  2DAK A;  4YVH A;  5GMC A;  4CND A;  4NOO B;  1O6D A;  1XHB A;  1V34 A;  3HX3 A;  4WUR A;  2CV0 A;  1ZMV A;  4LG2 A;  4Q7J A;  2CE7 A;  1SXJ C;  1Z5A A;  3DOA A;  4NSO B;  5C18 A;  2FE8 A;  1ZQ9 A;  5ITX A;  3TPZ A;  5GM8 A;  4LZZ A;  2Y21 A;  3SYL A;  2X49 A;  4YQ7 A;  3GQ4 A;  3PFI A;  4IBJ A;  1V33 A;  1QZE A;  2JUJ A;  3BXW A;  3NK7 A;  1N77 A;  2JA2 A;  4IBE A;  4G4R A;  1HNW M;  5KPR A;  1FNN A;  2APL A;  3OTO M;  4YQG A;  2OPF A;  4P16 A;  1TF0 B;  2A5Y B;  4B7G A;  3SAV A;  4G4N A;  1IBM M;  4CNG A;  2QCU A;  4YQ6 A;  1X37 A;  4FVM A;  2QHO B;  2V3K A;  3C3D A;  1N75 A;  3KY7 A;  4YQ5 A;  1WXQ A;  3AJI B;  1DO2 A;  2JY6 B;  3J27 B;  3DZD A;  4M0W A;  1R5L A;  2G3Q A;  3VK8 A;  1T43 A;  3K8Z A;  2C9C A;  3B9P A;  2YNM D;  4FW9 A;  5LMU M;  4PD2 A;  3N4K A;  2JWS A;  4JI6 M;  5EP2 A;  3K92 A;  3GLG B;  5ITX E;  4XK8 F;  3A46 A;  2DNA A;  3T6P A;  2F5O A;  5A2Q S;  3GLG E;  2VII A;  5IRE B;  2P5T A;  1R7R A;  4FWG A;  2DEN A;  3TQS A;  4G6Z A;  1UM8 A;  2ZM6 M;  4DR3 M;  1Y8G A;  2BWB A;  3K1J A;  1VDL A;  4X66 M;  2R62 A;  5EXT A;  4EIW A;  4Z6Y A;  4OX9 M;  2C99 A;  3MK6 A;  2CRU A;  5ITU A;  3JR4 A;  1YE9 A;  2VDB B;  4YVJ A;  4LJ7 A;  3FYC A;  1HT2 E;  2KRK A;  3GLF B;  3VKH A;  1UFZ A;  3E9S A;  2J5Y A;  3GLH E;  3I04 M;  3W0L B;  4YPY A;  1JB0 F;  4I81 A;  1DGF A;  2JY8 A;  1F4I A;  1MN3 A;  3EIH A;  1C7Y A;  4DV3 M;  4HLQ A;  4YQL A;  1VG5 A;  2DWZ B;  4LJA A;  2CHG A;  2YR0 A;  4JV5 M;  4GHA A;  2K6B A;  1NO1 A;  1TDH A;  1LV7 A;  5LMN M;  4LF5 M;  2D7H A;  1XNQ M;  1VH0 A;  2K9D A;  3AOG A;  3AIA A;  3U60 A;  2D7G A;  1IN8 A;  2R44 A;  1EIJ A;  2XSZ A;  5FTL A;  1NVM A;  1DGB A;  4DBG B;  1G59 A;  4MM3 B;  4X3L A;  3W0F A;  1GJS A;  2LBC A;  4L4U A;  3IEF A;  1H6U A;  2W82 A;  4PZK A;  4DR6 M;  3VLF B;  1L1T A;  2QWV A;  3U6C A;  2AHM A;  1DGH A;  4AI6 A;  2RRU A;  3HJS A;  2FNA A;  4AQY M;  1VEJ A;  2Q2E B;  3B7N A;  2CEA A;  8CAT A;  3O7B A;  3KOW E;  3HHY A;  2L4E A;  1IN6 A;  3DFZ A;  2F5P A;  4GKK M;  2B3T A;  5IT9 S;  3GPX A;  1UAK A;  2G8L A;  1AUA A;  1QVR A;  2EUC A;  1IBK M;  4B3M M;  4DV2 M;  2LWX A;  4R71 A;  2DVW B;  2L4F A;  2CX8 A;  5EXP A;  2V3J A;  4KLN A;  5FTJ A;  1Z5B A;  1IBL M;  1PJQ A;  2HCB A;  1LTM A;  1OTR A;  3GRR A;  3VKG A;  4R7G A;  4XBO A;  1WIV A;  3L29 A;  4KT0 F;  1WHC A;  4CGY B;  5EXS A;  1OJL A;  2EGV A;  1J7K A;  1IPA A;  2WSC F;  3CGW A;  2JZ1 A;  3HU3 A;  2XZU A;  4GC9 A;  3J7B A;  4E8B A;  2OOB A;  3TWK A;  2VF7 A;  3J2P B;  2DWM A;  1K3W A;  2UUA M;  3OIN A;  3RGS A;  1QYR A;  2UXB M;  1K82 A;  1XC8 A;  2YY8 A;  4NXM M;  1N33 M;  2UXD M;  1T3T A;  4RKU F;  4LF9 M;  1W5S A;  1YUB A;  4J3C A;  3TL4 X;  3PNY A;  1DO0 A;  1IXS B;  4I8O A;  4X3M A;  1NNU C;  2K47 A;  1PJI A;  1VQ1 A;  1SXJ E;  2NQ8 C;  2ZBK B;  4LJ8 A;  1V6Z A;  3CF2 A;  4GRI A;  3RGP A;  3C58 A;  1N36 M;  4YVG A;  1ZV1 A;  3E5Y A;  4LJ5 A;  4MGY E;  4B3S M;  1MU5 A;  3L8U A;  4CIZ A;  1R4G A;  1E9S A;  3SAW A;  2F5Q A;  3HGI A;  5D9F A;  3GPP A;  3PXG A;  3I4Y A;  4YVK A;  2QZ4 A;  4QNR A;  3U61 A;  3VDP A;  5KPT A;  4G4O A;  4ITQ A;  1G71 A;  3I51 A;  4JI1 M;  2I6D A;  4YQR A;  1P3Q Q;  2RKO A;  4S12 A;  1E94 E;  2CV2 A;  2UUC M;  4DUZ M;  2V1C A;  5DFL A;  1Z6T A;  4LGY A;  4QOS A;  1PM5 A;  1IM2 A;  4CHT B;  4L8R C;  3H4J A;  4YQ2 A;  2QBY B;  1TH3 A;  4RNA A;  4LZJ A;  5FTK A;  1NSF A;  1G3I A;  1V92 A;  1X7O A;  1OAI A;  3KSJ A;  2C96 A;  3PNV A;  4YQT A;  3HJQ A;  3ZC7 B;  3E46 A;  2I7N A;  1IXR C;  2MRO B;  2ZAO A;  4L15 A;  1R2Z A;  4JI3 M;  4JYA M;  1NHW C;  4LCB A;  3FTF A;  2F5N A;  2ZTC A;  3KXE C;  1KSF X;  3R8F A;  2HHH M;  3DA1 A;  1CUK A;  3T15 A;  3ILK A;  3FRH A;  4YQ8 A;  4BBA A;  1L2D A;  3M6A A;  4GMQ A;  4KGN A;  3UMM A;  4D81 A;  3KVW A;  5EP3 A;  3T1Y M;  4JWG A;  3FTC A;  4YQ3 A;  2OQ4 A;  4K0K M;  2EGW A;  3DCM X;  2R4E A;  2DWL A;  4LF8 M;  1JR3 A;  1IN7 A;  5CO4 A;  4YQB A;  3Q8X A;  1YSY A;  4F2L A;  1XMQ M;  2DAI A;  4L78 A;  4YQA A;  3SC3 A;  5JI2 E;  3GLG A;  2QSF X;  2EA0 A;  5EP1 A;  4CNE A;  5EXX A;  1WJ7 A;  3Q8G A;  4Z8X A;  4AZF A;  3KP0 E;  2LVN C;  5FSW A;  4G3O A;  4YY3 M;  2E5L M;  1G4A E;  2CHV A;  2XH9 A;  4WP2 A;  4I5S A;  2XZF A;  4YQ9 A;  2O3A A;  2HA8 A;  4FMW A;  1R6B X;  4YQS A;  2MJ5 B;  5DYG A;  4YPX A;  2BWE A;  2DZL A;  1HNZ M;  1WGN A;  4LJ6 A;  4IBB A;  3MJ5 A;  4HEO A;  4NRV A;  2F5S A;  1K3R A;  2V1U A;  3HY5 A;  3AOE A;  2CWB A;  4UN2 B;  1GAB A;  2JNH A;  5DNY A;  4JWF A;  1E32 A;  2WSE F;  2KRU A;  4AG5 A;  4LFC M;  1PRB A;  2KXE A;  4LRS A;  4LJ4 A;  3SAU A;  3MHV C;  3D8L A;  4GEW A;  4DV4 M;  4IBF A;  1JQJ C;  4JAL A;  4YQD A;  2Z4R A;  3GLH A;  3L25 A;  3OIJ A;  1C1K A;  2BJW A;  4M0D A;  4DV6 M;  3A98 B;  3B7Z A;  2DHR A;  3UGJ A;  1GZ0 A;  3KTY A;  5FTM A;  4D80 A;  3FYD A;  3KS8 A;  4CJ6 A; 
#chains in the Genus database with same CATH homology
 1NJG A;  2YQZ A;  2R45 A;  2M60 A;  3JR5 A;  2DXI A;  1QAM A;  1IXZ A;  2C9O A;  1D2N A;  3U6Q A;  4AKG A;  3SBJ A;  2KZU A;  3PVS A;  5C1B A;  3KFU G;  4GIT A;  1NXZ A;  3VK7 A;  3ZCB B;  3KOX E;  3U6E A;  4YQ1 A;  1NY6 A;  3BBH A;  4MGK E;  3QUV A;  4M9Z A;  5KQ8 A;  1J85 A;  4DUY M;  3SAR A;  3FTE A;  2L7I A;  2Z7J A;  5IZ7 D;  2R18 A;  2QMM A;  3IG5 A;  4FCW A;  4YVI A;  5EP4 A;  3TWL A;  3LMM A;  4DR2 M;  4MCD A;  3EIE A;  3HHX A;  4OU7 A;  4DV0 M;  3J7A S;  3VDU A;  1XMO M;  2Y20 A;  2LH0 A;  3D8B A;  1GLN A;  3VFD A;  2DWN A;  1L8Q A;  4MH0 E;  3TWM A;  3I4V A;  1MXI A;  2QBY A;  3GRU A;  4FWD A;  2XEP A;  2XLJ A;  5H37 D;  2QP9 X;  3GP1 A;  1IY2 A;  4MB7 A;  5E26 A;  3THG A;  2Y0Q A;  4YQ4 A;  4A3V B;  3HU1 A;  3U60 B;  1K3X A;  5IWA M;  4NL4 H;  1TDZ A;  1Q39 A;  1L2B A;  4YQN A;  1XXH B;  4YQI A;  3HJ8 A;  4FWH A;  1VHK A;  3RE8 A;  4LF7 M;  1GVN A;  2KW0 A;  2XSZ D;  3J80 S;  1GL7 A;  4L16 A;  2I7P A;  2J7O A;  3NBI A;  3TE6 A;  3QAU A;  1X7P A;  1SXJ A;  5ITT A;  1QAO A;  3WHL A;  5BPV A;  1GKI A;  4X64 M;  3GPU A;  3R9X B;  4G4Q A;  1NY5 A;  1XXH A;  4JAK A;  5FTN A;  1IN5 A;  1EE8 A;  4B08 A;  3L27 A;  4WW0 A;  2C5R A;  3UK6 A;  5E6J A;  3U5Z B;  3SHF A;  4DR4 M;  4JI4 M;  2RGH A;  4YHH M;  1OY5 A;  4PCZ A;  4LGM A;  1ZJR A;  3BBE A;  2J7N A;  3OII A;  2XFS A;  5FAI A;  2CHQ A;  5ITR A;  1Q3B A;  1J5E M;  3ONP A;  4KDZ A;  2C98 A;  3FKE A;  3H4M A;  1SXJ B;  2ZAM A;  4NSR A;  5JI3 E;  2UUB M;  4B3T M;  3CF0 A;  4OVZ A;  3L26 A;  1QAN A;  3A42 A;  5KPZ A;  5ITY A;  3GQ3 A;  4NRW A;  3AV0 A;  4IBD A;  3U6P A;  4YQJ A;  4PDI A;  4IBG A;  4QNM A;  2CUZ A;  5KQD A;  4JXJ A;  2LNH C;  4AG6 A;  3UZU A;  3KOZ E;  1Z5C A;  4JI5 M;  1NHG C;  1L2C A;  4YPW A;  1Q3C A;  4REZ A;  1N34 M;  2LXE A;  3KOY E;  4MCB A;  3KW2 A;  1NJF A;  4XGI A;  2M5Z A;  3SMS A;  2EO2 A;  1V2X A;  4LF4 M;  3NK6 A;  1QZM A;  3T1H M;  1HT1 E;  2DZO B;  2YFQ A;  4GH9 A;  1J09 A;  4IBC A;  4M9S A;  2VQE M;  2O5R A;  3U5Z A;  1KFV A;  4DR5 M;  4B3R M;  1Z59 A;  2Y0T A;  3HHZ A;  4JI7 M;  1NNJ A;  3CF6 E;  2KZS A;  4KHP M;  4JWH A;  1ORY B;  3ZH9 B;  3AL0 C;  1HNX M;  4YQC A;  4H3Y A;  4RG1 A;  3KDS E;  5GKN A;  2Z0Y A;  3LVW A;  1HQY E;  1JR3 D;  2KEB A;  3N4J A;  3SHG B;  3HHW A;  1IY0 A;  4FCT A;  3GRY A;  2FOI C;  3T38 A;  1S3S A;  3JAM S;  4KOD A;  3KSX A;  1N78 A;  2CV1 A;  1XWI A;  4HL4 A;  1HQC A;  4JN6 A;  4IBI A;  5ITQ A;  1TGU A;  4FD2 A;  3GRV A;  1ZAE A;  3GO8 A;  2R4J A;  1TO0 A;  1DGG A;  5FLX S;  2QPA A;  4DV7 M;  3GPY A;  3FD9 A;  1TH4 A;  3IC6 A;  4OW0 A;  3AI9 X;  2D7E A;  4FAK A;  3M0E A;  4AKI A;  1VDD A;  4BLC A;  2Z3X A;  3FUW A;  3KS4 A;  5BR8 M;  1E9R A;  2HKJ A;  2G5G X;  4I4L A;  2VQF M;  4NXN M;  2RGO A;  4LJ9 A;  4GHL A;  4GKJ M;  4LRT A;  1IY1 A;  2XGN A;  4OVZ B;  1KYI A;  5KO3 A;  5GMB A;  4IBK A;  3CTW B;  3A45 A;  4QHS A;  1R2Y A;  2L7H A;  3SMP A;  1Z85 A;  3WHK A;  2FFJ A;  2R65 A;  4DV1 M;  1UAM A;  4YQK A;  4LFA M;  4BB9 A;  3U6S A;  1I94 M;  1NS5 A;  4D82 A;  3AKZ A;  4RF0 A;  3FUX A;  1HR0 M;  2XFT A;  3BBD A;  4YQ0 A;  3U61 B;  1FJG M;  3FTD A;  2H1R A;  3LQQ A;  2BJV A;  3NWL A;  4R3D A;  4CIS A;  4YQO A;  3U6O A;  4MGZ E;  4PDG A;  2DZN B;  4LFB M;  4GIP A;  3K2L A;  1I4W A;  4YQQ A;  1L1Z A;  7CAT A;  3AXZ A;  2L09 A;  4TUW A;  1IN4 A;  2CFO A;  2QEN A;  3LVV A;  2V6Z M;  4YVK A;  3FUV A;  3AOE C;  3KW6 A;  4CNF A;  4IIW A;  3GLF A;  4JI2 M;  1QQW A;  2KA6 B;  4AW4 A;  5DYI A;  2UU9 M;  1W5T A;  3KP1 E;  4YQP A;  4L69 A;  4IJF A;  4II7 A;  4YPZ A;  3BOS A;  3HU2 A;  3HWS A;  5EQT A;  3U6L A;  1UAL A;  1IQP A;  2X8A A;  1N32 M;  1QAQ A;  2X4A A;  3SAT A;  4JI0 M;  1MX0 A;  4DR1 M;  4IJE A;  1UAJ A;  1GL6 A;  2Z4S A;  2F4V M;  2L6O A;  4W5W A;  3L28 A;  4B7F A;  4X62 M;  4H3Z A;  3FUT A;  4ZPX A;  2XF3 A;  3M7G A;  3GLI A;  3HKP A;  4MCC A;  4DV5 M;  3U6M A;  3FUU A;  3GLH B;  3SAS A;  4FCV A;  4GC5 A;  2ZAN A;  4RF1 A;  4LY6 A;  5EJC A;  4M9X A;  1OFH A;  5F3W A;  1PJJ A;  4JWJ A;  1XNR M;  3L2A A;  4MGI E;  3E4R A;  1P9P A;  3AFH A;  4JI8 M;  1SXJ D;  4B7H A;  4QOZ C;  3UJN A;  3U6D A;  4X65 M;  3LQR A;  3RFW A;  4PT5 A;  3KNU A;  1G8P A;  1G41 A;  2ERC A;  1DGH B;  1OFI A;  1TH2 A;  2R46 A;  4KO8 A;  3GQ5 A;  4LF6 M;  3GYQ A;  4IG6 A;  4QHT A;  2UXC M;  3SFZ A;  4AKH A;  3J81 S;  2HL7 A;  3GLI B;  3QWL A;  3IG8 A;  2BNK A;  4DR7 M;  3SYK A;  4MGH A;  4YVH A;  5GMC A;  4CND A;  4NOO B;  1O6D A;  1XHB A;  4WUR A;  4LG2 A;  2CV0 A;  2CE7 A;  1SXJ C;  1Z5A A;  3DOA A;  4NSO B;  5C18 A;  2FE8 A;  1ZQ9 A;  5ITX A;  3TPZ A;  5GM8 A;  4LZZ A;  2Y21 A;  3SYL A;  2X49 A;  4YQ7 A;  3GQ4 A;  3PFI A;  4IBJ A;  3NK7 A;  1N77 A;  2JA2 A;  4IBE A;  4G4R A;  1HNW M;  5KPR A;  1FNN A;  3OTO M;  4YQG A;  2OPF A;  4P16 A;  2A5Y B;  3SAV A;  4B7G A;  1IBM M;  4G4N A;  4CNG A;  2QCU A;  4YQ6 A;  1X37 A;  4FVM A;  2V3K A;  3KY7 A;  4YQ5 A;  1N75 A;  1WXQ A;  3AJI B;  1DO2 A;  3J27 B;  3DZD A;  4M0W A;  3VK8 A;  3K8Z A;  2C9C A;  3B9P A;  2YNM D;  4FW9 A;  5LMU M;  4PD2 A;  3N4K A;  4JI6 M;  5EP2 A;  3K92 A;  3GLG B;  5ITX E;  3A46 A;  2F5O A;  5A2Q S;  2VII A;  5IRE B;  2P5T A;  1R7R A;  4FWG A;  2ZM6 M;  3TQS A;  4G6Z A;  1UM8 A;  4DR3 M;  3K1J A;  4X66 M;  4EIW A;  2R62 A;  5EXT A;  4Z6Y A;  4OX9 M;  2C99 A;  3MK6 A;  5ITU A;  3JR4 A;  1YE9 A;  4YVJ A;  4LJ7 A;  3FYC A;  1HT2 E;  2KRK A;  3GLF B;  3VKH A;  3E9S A;  4YPY A;  3W0L B;  4I81 A;  1DGF A;  3EIH A;  4DV3 M;  4HLQ A;  4YQL A;  2DWZ B;  4LJA A;  2CHG A;  2YR0 A;  4JV5 M;  4GHA A;  1TDH A;  1VH0 A;  1LV7 A;  5LMN M;  4LF5 M;  2D7H A;  1XNQ M;  3AIA A;  3AOG A;  3U60 A;  2D7G A;  1IN8 A;  4X3L A;  2XSZ A;  5FTL A;  1NVM A;  1DGB A;  1G59 A;  4MM3 B;  3W0F A;  4L4U A;  3IEF A;  1H6U A;  2W82 A;  4PZK A;  4DR6 M;  3VLF B;  1L1T A;  2QWV A;  3U6C A;  2AHM A;  1DGH A;  4AI6 A;  3HJS A;  2FNA A;  4AQY M;  2Q2E B;  2CEA A;  8CAT A;  3O7B A;  3KOW E;  3HHY A;  2F5P A;  1IN6 A;  3DFZ A;  4GKK M;  5IT9 S;  1UAK A;  3GPX A;  2G8L A;  1QVR A;  2EUC A;  1IBK M;  4B3M M;  4DV2 M;  2LWX A;  2DVW B;  2CX8 A;  5EXP A;  2V3J A;  4KLN A;  5FTJ A;  1Z5B A;  1IBL M;  2HCB A;  3GRR A;  3VKG A;  4R7G A;  4XBO A;  3L29 A;  4CGY B;  5EXS A;  1OJL A;  2EGV A;  1J7K A;  1IPA A;  2XZU A;  3HU3 A;  4GC9 A;  3J7B A;  4E8B A;  3TWK A;  3J2P B;  2DWM A;  1K3W A;  2UUA M;  3OIN A;  3RGS A;  1QYR A;  2UXB M;  1K82 A;  1XC8 A;  2YY8 A;  4NXM M;  1N33 M;  2UXD M;  1T3T A;  4LF9 M;  1W5S A;  1YUB A;  4J3C A;  3TL4 X;  3PNY A;  1DO0 A;  1IXS B;  4I8O A;  4X3M A;  1NNU C;  2K47 A;  1PJI A;  2ZBK B;  1SXJ E;  2NQ8 C;  4LJ8 A;  1V6Z A;  1VHY A;  3CF2 A;  4GRI A;  3RGP A;  3C58 A;  1N36 M;  4YVG A;  3E5Y A;  4LJ5 A;  4MGY E;  4B3S M;  1MU5 A;  3L8U A;  1E9S A;  3SAW A;  2F5Q A;  3HGI A;  5D9F A;  3GPP A;  3PXG A;  3I4Y A;  2QZ4 A;  4QNR A;  3U61 A;  3VDP A;  5KPT A;  4G4O A;  4ITQ A;  4JI1 M;  3I51 A;  2I6D A;  4YQR A;  2RKO A;  4S12 A;  1E94 E;  2CV2 A;  2UUC M;  4DUZ M;  2V1C A;  4YQ2 A;  1Z6T A;  4LGY A;  4QOS A;  1PM5 A;  1IM2 A;  4CHT B;  4L8R C;  2QBY B;  1TH3 A;  4RNA A;  4LZJ A;  5FTK A;  1NSF A;  1G3I A;  1X7O A;  3KSJ A;  2C96 A;  3PNV A;  4YQT A;  3HJQ A;  3ZC7 B;  2I7N A;  1IXR C;  2ZAO A;  4L15 A;  1R2Z A;  4JI3 M;  4JYA M;  1NHW C;  4LCB A;  3FTF A;  2F5N A;  3KXE C;  1KSF X;  3R8F A;  2HHH M;  3DA1 A;  3T15 A;  3ILK A;  4YQ8 A;  4BBA A;  1L2D A;  3M6A A;  4GMQ A;  4KGN A;  3UMM A;  4D81 A;  3KVW A;  5EP3 A;  3T1Y M;  4JWG A;  3FTC A;  4YQ3 A;  2OQ4 A;  4K0K M;  2EGW A;  3DCM X;  2R4E A;  2DWL A;  4LF8 M;  1JR3 A;  1IN7 A;  5CO4 A;  4YQB A;  3Q8X A;  1YSY A;  1XMQ M;  4L78 A;  4YQA A;  3SC3 A;  5JI2 E;  3GLG A;  2EA0 A;  5EP1 A;  4CNE A;  5EXX A;  4AZF A;  4Z8X A;  3KP0 E;  5FSW A;  4YY3 M;  2E5L M;  1G4A E;  2CHV A;  2XH9 A;  4I5S A;  2XZF A;  4YQ9 A;  2O3A A;  2HA8 A;  4FMW A;  1R6B X;  4YQS A;  5DYG A;  4YPX A;  1HNZ M;  4LJ6 A;  4IBB A;  3MJ5 A;  4NRV A;  2F5S A;  1K3R A;  2V1U A;  3AOE A;  5DNY A;  4JWF A;  1E32 A;  2KRU A;  4AG5 A;  4LFC M;  2KXE A;  4LRS A;  4LJ4 A;  3SAU A;  3MHV C;  3D8L A;  3OIJ A;  4DV4 M;  4IBF A;  1JQJ C;  4JAL A;  4YQD A;  2Z4R A;  3GLH A;  3L25 A;  1C1K A;  2BJW A;  4M0D A;  4DV6 M;  3A98 B;  1GZ0 A;  2DHR A;  3UGJ A;  3KTY A;  5FTM A;  4D80 A;  3FYD A;  3KS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...