3ILKA

The structure of a probable methylase family protein from haemophilus influenzae rd kw20
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
240
structure length
239
Chain Sequence
b'NAMLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNILNGMLSAVEKRIDLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized tRNA/rRNA methyltransferase HI0380
publication title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 239
sequence length 240
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ilkA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ilkA01
1K3RA 1VHYA 4MCBA 4YPYA 1V6ZA 4YQ8A 2I6DA 2O3AA 3KW2A 3BBEA 4YPXA 4YQIA 2QWVA 3GYQA 4YQ3A 2EGVA 4PZKA 1P9PA 3BBDA 4YPWA 4YQ2A 4CNFA 1UALA 1NS5A 1X7OA 3OIJA 1VHKA 4YQRA 3O7BA 1VH0A 4YQQA 4YQPA 4YQCA 4YQ6A 2QMMA 4YQ7A 4YQSA 4KDZA 4MCCA 3IEFA 2V3KA 1MXIA 4YQBA 4JALA 1GZ0A 3KNUA 4YVGA 5D9FA 3L8UA 5FAIA 4JAKA 4X3MA 1UAMA 4YQDA 4YVHA 4YQ5A 5CO4A 4FAKA 4YQ4A 4H3ZA 4L69A 4MCDA 3AXZA 3NK7A 4CNGA 3OINA 1OY5A 3KY7A 4YQLA 4YPZA 4YQTA 3KTYA 1X7PA 4XBOA 1J85A 1O6DA 4J3CA 1ZJRA 4YQKA 1TO0A 5GMBA 4YQ0A 5GMCA 4KGNA 3DCMX 3E5YA 2EGWA 4E8BA 1UAJA 4X3LA 3BBHA 4YQ1A 3ILKA 3OIIA 2Z0YA 4IG6A 4CNEA 4YQGA 2CX8A 4YVIA 3IC6A 4YQAA 1V2XA 3ONPA 4YQOA 3N4KA 1NXZA 3AI9X 2HA8A 4YQNA 2YY8A 4YQJA 4CNDA 4RG1A 4YVKA 3AIAA 3NK6A 1UAKA 1IPAA 4YVJA 1Z85A 4H3YA 4YQ9A 2V3JA 5GM8A 3N4JA 3QUVA
chains in the Genus database with same CATH superfamily
1QQWA 4LFAM 3SBJA 1XNRM 4YQ8A 4YPYA 1XXHA 3K8ZA 1T6OA 2QZ4A 3B7QA 4YPXA 4P17A 2VF7A 1GJTA 4M9XA 2QPAA 5DYGA 4A3VB 2DZOB 1QDRA 4CIZA 3GYQA 5FSWA 4LF4M 3K92A 3W68A 2X49A 3PFIA 4CHTB 1J09A 3BOSA 4QNRA 1F4IA 3BBDA 2XEPA 5ITUA 1N33M 1GABA 4CNFA 1OIZA 4NC6A 3DZDA 4JN6A 2HWJA 2FOIC 4LGMA 3SMSA 4Z6YA 4LF9M 3TL4X 1YE9A 3GQ5A 3T1HM 1XNQM 4OW0A 4XGIA 3U6EA 4LFBM 3O7BA 3U61A 1NNJA 3ZH9B 2Q2EB 2Y0TA 4NOOB 2CHGA 2ZTCA 1IN5A 1VDDA 2CV2A 2XSZD 3JR4A 1L1TA 3L2AA 1G71A 2CRUA 3GLHA 4AKIA 2V3KA 1IY2A 3HU3A 2CHVA 2XZUA 1VEJA 2YNMD 2OOAA 4IBBA 3IECA 3QAUA 4YVGA 2EKFA 4G6ZA 1XMQM 4YQ5A 4L16A 4MGYE 2CV0A 1MU5A 1R6BX 1WXQA 4L8RC 3KP1E 4X65M 2R65A 5ITRA 3TE6A 2CE7A 4DR4M 4H3ZA 2EKKA 2C99A 2LVNC 2R46A 1HNZM 3SATA 2DVWB 4FMWA 3U5ZB 4LJ7A 4MGIE 5JI3E 2Y21A 4DR7M 2MR9A 2V6ZM 4LJ9A 4Y28F 4D82A 2JY6B 1E9SA 4BLCA 1IBLM 2UUAM 3KSJA 3HHYA 4YQLA 3GLIA 2DWZB 1OJLA 4L6V6 3U6OA 3SAVA 1IN7A 1GKIA 4L78A 3E4RA 1X7PA 4G4RA 2F5QA 2WZJA 4XBOA 4JWGA 3IG5A 2DWLA 1W5SA 2DNAA 3SAWA 2XSZA 1TO0A 2R44A 2OOBA 3SAUA 4YQ0A 5ITQA 1GL7A 3LQRA 3DCMX 3RE8A 2CHQA 1NJGA 3HWSA 2KDLA 4PDIA 4G4NA 5KPTA 3FKEA 4GMQA 4MGZE 1T3TA 2J7OA 3LCUA 4YQ1A 2RKOA 4I81A 3GP1A 3HJ8A 5DNYA 2F5OA 2CX8A 4DV3M 4DV1M 4IBKA 1FNNA 4ZPXA 2I7NA 5EXSA 2N35A 3LQQA 1TF0B 2LVQD 5EXXA 1SXJE 1NO1A 1PGYA 3B9PA 3TWMA 1NXZA 2E5LM 2HAKA 2QCUA 5C1BA 1WGLA 1OTRA 4YQJA 2DHYA 1P3QQ 2EO2A 3SC3A 4X66M 4RG1A 3Q8GA 4IBDA 4DR1M 2LNHC 3U6QA 3MHVC 2Z4SA 1UM8A 3B89A 3MK6A 1TDHA 1QAMA 5JI2E 2DWNA 4HL4A 4M9SA 2KEBA 2H1RA 1L2BA 5IT9S 1IPAA 4NL4H 3B74A 2GNOA 4WURA 2Y0QA 2R4JA 3FUTA 3T15A 1PJSA 1SXJB 4OVZB 4NXNM 3ZQJA 4H3YA 1IQPA 3UGJA 4FW9A 4WP2A 5GM8A 1HT2E 3WHLA 3UK6A 1E94E 2XH9A 3K9OA 1K3RA 1VHYA 2FE8A 3L29A 4FVMA 4GC5A 3GPXA 2HKJA 3A46A 2JNHA 2L09A 1G3IA 3J80S 2UU9M 1XXHE 3KFUG 2DAMA 1HQCA 1R4GA 4BB9A 3VKHA 2FH0A 3SYLA 1ZV1A 4PZKA 1P9PA 3CF0A 1N78A 1YSYA 4JI6M 1QDTA 1Z5BA 4P16A 3BBZA 3VDUA 3LVWA 4KT0F 3OIJA 4DV7M 1QANA 4KODA 2C9CA 1VHKA 4IIWA 1IFYA 5BPVA 2OPFA 3TWLA 3FD9A 2Y20A 1QVRA 4YQPA 1V92A 1N77A 3U60A 2UUCM 3IHPA 2DAGA 1PJQA 3C3EA 4DV0M 4HEOA 1VDLA 2UXBM 2LHCA 3DA1A 4YQCA 3GLGA 3KOXE 2JY8A 4LGYA 4YQ7A 4LJ6A 1SG9A 2EJSA 1HQYE 4KDZA 4OX9M 1YUBA 5FTJA 1QYRA 5FTMA 4YQSA 3L28A 5EJCA 3U6CA 2GQFA 3I4YA 3GQ3A 3M6AA 4LF8M 1TH4A 5FTKA 2X4AA 3JAMS 5D9FA 3GLHE 1PM5A 1DGHA 2UUBM 2QBYA 3KS8A 5FAIA 4X3MA 2RRUA 3T38A 4RF1A 3ZCBB 1N34M 3E21A 2B3TA 4YQ4A 1NSFA 1TH3A 3U61B 4L69A 3E46A 2R18A 4IBEA 2UXDM 2DAKA 5GKNA 1FJGM 4YVIA 2W82A 1PJIA 2CUZA 3GRUA 2HCBA 4LRTA 3ZC7B 4YPZA 1VQ1A 2FNAA 4I5SA 4DUZM 1DV0A 1T43A 1J85A 2KZUA 4JWJA 3DFZA 4RNAA 4J3CA 3GLIE 1C1KA 4FWGA 1UFZA 1W5TA 2D7HA 2K9DA 2KW0A 2MGWA 3KW6A 4GC9A 1ZJRA 1HT1E 4R71A 2KRUA 1BVSA 4DR2M 4M0DA 4KGNA 4MGHA 3T1YM 2K0BX 2EGWA 1UAJA 3HX3A 2D7GA 1S3SA 4QNMA 3PVSA 1OAIA 2JWSA 3D8BA 4JI8M 2MJ5B 4QOZC 3UMMA 4IBJA 4CISA 4JXJA 2Z0YA 4CNEA 3SHFA 1ORYB 3GLIB 3GRVA 3U6LA 2XFSA 2ZTDA 1Z5CA 4MM3B 3RFWA 4EIWA 3ONPA 4YQBA 1MN3A 3I51A 4IBGA 4MH0E 3FUVA 2ZM6M 3J7BA 1A5TA 2F5SA 2HA8A 4I8OA 4YQNA 3GRYA 2VF8A 4AW4A 4YY3M 2LTUA 4JI0M 2BWBA 5C18A 1J5EM 3GPYA 3FE3A 3HU1A 4GKJM 4FCTA 3NK6A 1R5LA 3AJIB 3HJQA 3KOZE 1UAKA 3HHXA 2KRKA 4G3OA 1QZEA 3FTFA 1WIVA 4GKKM 4YVJA 1QAOA 2V1UA 3CGWA 3HZJA 2FFJA 4G4QA 2DAEA 1ZMUA 2C98A 1OAOC 3EIHA 2XF3A 3U5ZA 1X37A 4YPWA 3J2PB 5KQ8A 4JI2M 2BNKA 1Q39A 1WJ7A 5EQTA 1XMOM 7CATA 1DO0A 3LVVA 4Z8XA 2K6BA 3D8LA 4JWFA 4MCBA 2I6DA 3BBEA 2XFTA 1GO5A 1WHCA 2QHOB 4NRWA 4KO8A 1VEKA 3E9SA 4DUYM 3NBIA 1HNWM 2WSFF 1WGNA 1OFHA 3UZUA 1JR3D 4YQ3A 3HJSA 3C3DA 4LZZA 2EGVA 2LH0A 4B3SM 4JI7M 4YQ2A 5FLXS 3CF2A 2O5RA 3CTWB 3PNYA 4QHTA 4LF6M 1PJTA 5L8RF 4DV4M 1OIPA 4LFCM 2H5XA 3DOAA 1UALA 1X7OA 2J5YA 2LBCA 1D0MA 4I4LA 3A42A 4M9ZA 1VH0A 1IXSA 1V34A 5FTNA 4B7HA 3Q8XA 4L4UA 1RU3A 3KOYE 5ITYA 4FWHA 4LF7M 1Y8GA 2A5YB 1L8QA 3HHWA 4GITA 3QWLA 1JQJC 3J27B 3I4VA 4JYAM 4YQ6A 4PT5A 2VQFM 4PD2A 5EXPA 1K3XA 1ZQ9A 3K9PA 3W67A 5ITXA 3C58A 3C9PA 2ERCA 3SARA 3IEFA 4NSRA 5E6JA 4IBFA 4MCCA 2DI0A 2XLJA 2CFOA 4DR5M 3GLGE 3SFZA 2DENA 2ZBKB 4OU7A 1JB0F 2VQEM 1GZ0A 3FTDA 3LCVB 4B7GA 1ZMVA 3I04M 2Z3XA 1H6UA 3L8UA 2D7EA 2R6FA 1UAMA 2WSCF 2EUCA 4LJ8A 4YVHA 4D81A 2C9OA 1JR3A 3FTCA 2WSEF 4GHAA 3IG8A 1N75A 4KHPM 3QYBA 4CJ6A 1IM2A 3BXWA 1VEGA 2L2DA 1XHBA 1CUKA 4X62M 2C5RA 2L4EA 4DV6M 4B3RM 2JXNA 5LMNM 2F4VM 1GL6A 2L6OA 2ZAOA 5EP2A 3SHGB 1NJFA 4F2LA 5H37D 1G8PA 3VLFB 3GLGB 4F1IA 1XXHB 4DBGB 4K0KM 3AFHA 1K82A 1NV9A 4GEWA 3GPPA 1K3WA 4YQTA 4HLQA 3KTYA 4B3MM 1IN4A 1R7RA 3HHZA 4G4OA 1O6DA 2HL7A 2O25A 2DHRA 2QNJA 1DGBA 1DGHB 3B7NA 1L2DA 5ITTA 2DZNB 3KP0E 2QBYB 2G8LA 2YFQA 2K47A 4IJEA 5GMCA 2KHHA 5LMUM 4DR6M 1EE8A 1AUAA 1NVMA 5KO3A 1GLNA 3L27A 2MH8A 4GIPA 1ZMWA 3H4MA 3TPZA 1EIJA 3KOWE 1L1ZA 4FAKA 4E8BA 1QUTA 3M0EA 4X3LA 3KSXA 2DWMA 3RGSA 2HHHM 3R9XB 3H4JA 1NY6A 3GLFA 3ILKA 2YQZA 5IZ7D 3HKPA 3KXEC 4LJAA 3OIIA 3CF6E 4Q7JA 5EP4A 1MX0A 3VK7A 3GO8A 3HGIA 3U6MA 3FTEA 5BR8M 3IC6A 4YQGA 1HR0M 2KXEA 4WW0A 4YQOA 1KFVA 1DGGA 4LZJA 4W5WA 5E26A 1Z59A 3VKGA 1I94M 3GLHB 3N4KA 4LRSA 2CWBA 2XZFA 4NXMM 1IY1A 3AI9X 1OFIA 1KSFX 1Z5AA 3FRIA 3TWKA 1MJGM 4LJ5A 5KQDA 2QQ8A 5EP1A 4X64M 3L26A 3W0LB 1PJJA 2YY8A 4JI3M 1OQYA 4PCZA 3KDSE 3HY5A 4YVKA 4JWHA 4NRVA 2KNAA 4REZA 4LCBA 3K1JA 1Q3BA 2ZAMA 5IWAM 2XGNA 2JY5A 1R2YA 1Z85A 1XB2B 1HNXM 2DKLA 2LVOC 1XC8A 4AKGA 2BJVA 3GPUA 1NY5A 5IREB 1QZMA 2OQ4A 2QP9X 3JR5A 3KS4A 1J7KA 3LW5F 3QYEA 1G41A 1HJPA 1NHGC 1G4AE 3FUUA 1V6ZA 2O3AA 3KW2A 3U6SA 2L7HA 4YQIA 4TUWA 3K2LA 1IN8A 2CEAA 5EP3A 2RGOA 2JZ1A 2QWVA 3EIEA 2UXCM 3MMPA 1TH2A 4LY6A 3PNVA 1N32M 2NQ8C 1L2CA 4II7A 3J7AS 2VDBB 2MROB 2RGHA 1NHWC 4ITQA 1DO2A 3VK8A 2LWXA 1IN6A 2M60A 4LG2A 2JUJA 3NBXX 3FRHA 4LF5M 1NS5A 2G3QA 4B7FA 4YQRA 3F92A 1E32A 1LV7A 1I4WA 4R3DA 3SYKA 3J81S 1IXZA 1LTMA 1V33A 1XWIA 4GH9A 4YQQA 3VDPA 4PDGA 5KPRA 2KZSA 2V1CA 4JI5M 2R62A 3OTOM 4AI6A 1QAQA 1N36M 3VFDA 3UJNA 5KPZA 4IBCA 2JY7A 4YHHM 4UN2B 2QMMA 4QOSA 3B7ZA 2KA6B 4S12A 1TDZA 2LHGA 1TTEA 3THGA 1IXRC 1MXIA 1QUSA 1Z6TA 1D0KA 2FS1A 3KNUA 3RGPA 2QSFX 4JV5M 4JALA 2AHMA 5ITXE 2O01F 3AV0A 1R2ZA 4JAKA 1KYIA 2DZLA 4AZFA 4YQDA 4XK8F 5A2QS 1D2NA 3GQ4A 1G59A 1SXJD 2KNZA 3KVWA 5CO4A 2G5GX 3HU2A 4DV2M 4JI1M 1IXSB 2M5ZA 5FTLA 2BWEA 2JA2A 3AOGA 2R45A 3L25A 4MCDA 3AKZA 1OKSA 1JR3E 2R0IA 3AXZA 2JP7A 8CATA 4FCWA 3PXGA 1NV8A 1Q02A 4KLNA 1IBMM 1GJSA 3NK7A 3U6PA 4CNGA 1OY5A 3OINA 3KY7A 2VIIA 4D80A 5F3WA 3AL0C 4M0WA 1AIPC 1EFUB 1D0LA 2CV1A 2CP8A 2F5NA 2Z7JA 3M7GA 2DAIA 4QHSA 4YQKA 3W0FA 4FD2A 3V76A 5GMBA 5DYIA 3NWLA 4BBAA 2DXIA 3E5YA 4AG6A 3FUXA 3FYDA 4NSOB 4B08A 2F5PA 4AKHA 2Z4RA 2C96A 2R4EA 3T6PA 3BBHA 2J7NA 3I01M 4AQYM 4GHLA 1Q3CA 2APLA 3U6DA 1TR8A 3AOEA 3U60B 4IG6A 4OVZA 1SXJA 2Z8YM 3WHKA 4YQAA 4GRIA 2EA0A 3MJ5A 2ZANA 1IY0A 1NNUC 4RKUF 1PRBA 3GLFE 1V2XA 4DR3M 1WR1B 4RF0A 3TQSA 1YLAA 4IBIA 4B3TM 4JI4M 1E9RA 1GVNA 4MGKE 3SASA 2LVPC 3GRRA 4LJ4A 3R8FA 2JZ0A 4CNDA 3SMPA 3A45A 2QENA 3A98B 4FWDA 1VG5A 4IJFA 2I7PA 3AIAA 2X8AA 2L4FA 4DV5M 1ZAEA 2BJWA 3GLFB 2L7IA 1DGFA 4AG5A 1IBKM 2LVAA 2LXEA 3AOEC 5DFLA 2OO9A 3LMMA 2KNVA 1SXJC 3FUWA 3FYCA 5EXTA 4ANRA 4R7GA 4CGYB 1TGUA 4MB7A 4YQ9A 2YR0A 1C7YA 2V3JA 3N4JA 4FCVA 3QUVA 2P5TA 4L15A
chains in the Genus database with same CATH topology
1QQWA 4LFAM 3SBJA 1XNRM 4YQ8A 4YPYA 1XXHA 3K8ZA 2QZ4A 4YPXA 4M9XA 2QPAA 5DYGA 4A3VB 2DZOB 3GYQA 5FSWA 4LF4M 3K92A 2X49A 3PFIA 4CHTB 1J09A 3BOSA 4QNRA 3BBDA 2XEPA 5ITUA 1N33M 4CNFA 3DZDA 4JN6A 4LF9M 2FOIC 4LGMA 3SMSA 4Z6YA 1NS5A 3TL4X 1YE9A 3GQ5A 3T1HM 1XNQM 4OW0A 4XGIA 3U6EA 4LFBM 3O7BA 3U61A 1NNJA 3ZH9B 2Q2EB 2Y0TA 4NOOB 2CHGA 1IN5A 1VDDA 2CV2A 2XSZD 3JR4A 1L1TA 3L2AA 3GLHA 4AKIA 2V3KA 1IY2A 3HU3A 2CHVA 2XZUA 2YNMD 4IBBA 3QAUA 4YVGA 4G6ZA 1XMQM 4YQ5A 4L16A 4MGYE 2CV0A 1MU5A 1R6BX 1WXQA 4L8RC 3KP1E 4X65M 2R65A 5ITRA 3TE6A 2CE7A 4DR4M 4H3ZA 2C99A 2R46A 1HNZM 3SATA 2DVWB 4FMWA 3U5ZB 4LJ7A 4MGIE 5JI3E 2Y21A 4DR7M 2V6ZM 4LJ9A 4D82A 4BLCA 1E9SA 1IBLM 2UUAM 3KSJA 3HHYA 4YQLA 3GLIA 2DWZB 1OJLA 3U6OA 3SAVA 1IN7A 1GKIA 4L78A 3E4RA 1X7PA 4G4RA 2F5QA 4XBOA 4JWGA 3IG5A 2DWLA 1W5SA 3SAWA 2XSZA 1TO0A 4YQ0A 3SAUA 5ITQA 1GL7A 3LQRA 3DCMX 3RE8A 2CHQA 1NJGA 3HWSA 4PDIA 4G4NA 5KPTA 3FKEA 4GMQA 4MGZE 1T3TA 2J7OA 4YQ1A 2RKOA 4I81A 3GP1A 3HJ8A 5DNYA 2F5OA 2CX8A 4DV3M 4DV1M 4IBKA 1FNNA 4ZPXA 2I7NA 5EXSA 3LQQA 5EXXA 1SXJE 3B9PA 3TWMA 1NXZA 2E5LM 2QCUA 5C1BA 4YQJA 2EO2A 3SC3A 4X66M 4RG1A 4IBDA 4DR1M 2LNHC 3U6QA 3MHVC 2Z4SA 1UM8A 3MK6A 5JI2E 1TDHA 1QAMA 2DWNA 4HL4A 4M9SA 2KEBA 2H1RA 1L2BA 5IT9S 1IPAA 4NL4H 4WURA 2Y0QA 2R4JA 3FUTA 3T15A 4OVZB 1SXJB 4H3YA 4NXNM 1IQPA 3UGJA 4FW9A 5GM8A 1HT2E 3WHLA 3UK6A 1E94E 2XH9A 1K3RA 1VHYA 2FE8A 3L29A 4FVMA 4GC5A 3GPXA 2HKJA 3A46A 2L09A 1G3IA 3J80S 2UU9M 3KFUG 1HQCA 4BB9A 3VKHA 3SYLA 4PZKA 1P9PA 3CF0A 1N78A 1YSYA 4JI6M 1Z5BA 4P16A 3VDUA 3LVWA 3OIJA 4DV7M 1QANA 4KODA 2C9CA 1VHKA 4IIWA 5BPVA 2OPFA 3TWLA 3FD9A 2Y20A 1QVRA 4YQPA 1N77A 3U60A 2UUCM 4DV0M 2UXBM 4YQCA 3DA1A 3GLGA 3KOXE 4LGYA 4YQ7A 4LJ6A 4YQSA 1HQYE 4KDZA 4OX9M 1YUBA 5FTJA 1QYRA 5FTMA 3L28A 5EJCA 3U6CA 3I4YA 3GQ3A 3M6AA 4LF8M 1TH4A 5FTKA 2X4AA 3JAMS 5D9FA 1PM5A 1DGHA 2UUBM 2QBYA 3KS8A 5FAIA 4X3MA 3T38A 4RF1A 3ZCBB 1N34M 4YQ4A 1NSFA 1TH3A 3U61B 4L69A 2R18A 4IBEA 2UXDM 5GKNA 1FJGM 4YVIA 2W82A 1PJIA 2CUZA 3GRUA 2HCBA 4LRTA 3ZC7B 4YPZA 4DUZM 2FNAA 4I5SA 1J85A 2KZUA 4JWJA 3DFZA 4RNAA 4J3CA 1C1KA 4FWGA 2D7HA 1W5TA 1ZJRA 3KW6A 2KW0A 4GC9A 1HT1E 2KRUA 4DR2M 4M0DA 4KGNA 4MGHA 3T1YM 2EGWA 1UAJA 2D7GA 1S3SA 4QNMA 3PVSA 3D8BA 4JI8M 4QOZC 3UMMA 4IBJA 4CISA 4JXJA 2Z0YA 4CNEA 3SHFA 1ORYB 3GLIB 3GRVA 3U6LA 2XFSA 3RFWA 1Z5CA 4MM3B 4EIWA 3ONPA 3I51A 4IBGA 4MH0E 3FUVA 2ZM6M 3J7BA 2F5SA 2HA8A 4I8OA 4YQNA 3GRYA 4AW4A 4YY3M 4JI0M 5C18A 1J5EM 3GPYA 3HU1A 4GKJM 4FCTA 3NK6A 3AJIB 3HJQA 3KOZE 1UAKA 3HHXA 2KRKA 3FTFA 4GKKM 4YVJA 1QAOA 2V1UA 2FFJA 4G4QA 3U5ZA 2C98A 3EIHA 2XF3A 1X37A 4YPWA 3J2PB 5KQ8A 4JI2M 2BNKA 1Q39A 5EQTA 1XMOM 7CATA 1DO0A 3LVVA 4Z8XA 3D8LA 4JWFA 4MCBA 2I6DA 3BBEA 2XFTA 4NRWA 4KO8A 3E9SA 4DUYM 3NBIA 1HNWM 3UZUA 1OFHA 1JR3D 4YQ3A 3HJSA 4LZZA 2EGVA 2LH0A 4B3SM 4JI7M 4YQ2A 5FLXS 3CF2A 2O5RA 3CTWB 3PNYA 4QHTA 4LF6M 4LFCM 4DV4M 1UALA 3DOAA 1X7OA 4I4LA 3A42A 4M9ZA 1VH0A 4B7HA 5FTNA 3Q8XA 4L4UA 5ITYA 3KOYE 4LF7M 4FWHA 2A5YB 1L8QA 3HHWA 4GITA 3QWLA 1JQJC 3J27B 3I4VA 4JYAM 4YQ6A 4PT5A 2VQFM 4PD2A 5EXPA 1K3XA 1ZQ9A 5ITXA 3C58A 4MCCA 2ERCA 3SARA 3IEFA 4NSRA 5E6JA 4IBFA 2XLJA 2CFOA 4DR5M 3SFZA 4OU7A 2ZBKB 1GZ0A 2VQEM 3FTDA 4B7GA 2Z3XA 3L8UA 1H6UA 2D7EA 1UAMA 2EUCA 4LJ8A 4YVHA 4D81A 2C9OA 1JR3A 3FTCA 4GHAA 3IG8A 1N75A 4KHPM 1IM2A 2C5RA 1XHBA 4B3RM 4X62M 4DV6M 5LMNM 2F4VM 1GL6A 2L6OA 2ZAOA 5EP2A 3SHGB 1NJFA 5H37D 1G8PA 3VLFB 3GLGB 4K0KM 1XXHB 3AFHA 1K82A 3GPPA 1K3WA 4YQTA 4HLQA 3KTYA 4B3MM 1IN4A 1R7RA 3HHZA 4G4OA 1O6DA 2HL7A 2DHRA 1L2DA 1DGBA 1DGHB 2QBYB 5ITTA 2DZNB 3KP0E 2G8LA 2YFQA 2K47A 4IJEA 5GMCA 5LMUM 4DR6M 1EE8A 1NVMA 5KO3A 1GLNA 3L27A 4GIPA 3H4MA 3TPZA 3KOWE 1L1ZA 4E8BA 3M0EA 4X3LA 3KSXA 2DWMA 3RGSA 2HHHM 3R9XB 1NY6A 3GLFA 3ILKA 2YQZA 5IZ7D 3HKPA 3KXEC 4LJAA 3OIIA 3CF6E 5EP4A 1MX0A 3VK7A 3GO8A 3HGIA 3U6MA 3FTEA 5BR8M 3IC6A 4YQGA 1HR0M 2KXEA 4WW0A 4YQOA 1KFVA 1DGGA 4LZJA 4W5WA 5E26A 1Z59A 3VKGA 1I94M 3GLHB 3N4KA 4LRSA 2XZFA 4NXMM 1IY1A 3AI9X 1OFIA 1KSFX 1Z5AA 4JI4M 3TWKA 4LJ5A 5KQDA 4X64M 5EP1A 3L26A 1PJJA 3W0LB 2YY8A 4JI3M 4PCZA 3KDSE 4YVKA 4JWHA 4NRVA 4REZA 4LCBA 3K1JA 1Q3BA 2ZAMA 5IWAM 2XGNA 1R2YA 1Z85A 1HNXM 1XC8A 4AKGA 2BJVA 3GPUA 1NY5A 5IREB 1QZMA 2OQ4A 2QP9X 3JR5A 3KS4A 1J7KA 1G41A 1NHGC 1G4AE 3FUUA 1V6ZA 2O3AA 3KW2A 3U6SA 2L7HA 4YQIA 4TUWA 3K2LA 1IN8A 2CEAA 5EP3A 2RGOA 2QWVA 3EIEA 2UXCM 1TH2A 4LY6A 3PNVA 1N32M 2NQ8C 1L2CA 4II7A 3J7AS 2RGHA 1NHWC 4ITQA 1DO2A 3VK8A 2LWXA 1IN6A 2M60A 4LG2A 4LF5M 4B7FA 4YQRA 1E32A 1LV7A 1I4WA 4R3DA 3SYKA 3J81S 1IXZA 4YQQA 1XWIA 4GH9A 3VDPA 4PDGA 5KPRA 2KZSA 2V1CA 4JI5M 2R62A 3OTOM 4AI6A 1QAQA 1N36M 3VFDA 3UJNA 5KPZA 4IBCA 4YHHM 2QMMA 4QOSA 2KA6B 4S12A 1TDZA 3THGA 1IXRC 1MXIA 1Z6TA 4YQBA 4JALA 3KNUA 3RGPA 4JV5M 2AHMA 5ITXE 3AV0A 1R2ZA 4JAKA 1KYIA 4AZFA 4YQDA 5A2QS 1D2NA 3GQ4A 1G59A 3KVWA 1SXJD 5CO4A 4FAKA 2G5GX 3HU2A 4DV2M 4JI1M 1IXSB 2M5ZA 5FTLA 2JA2A 3AOGA 2R45A 3L25A 4MCDA 3AKZA 3AXZA 8CATA 4FCWA 3PXGA 4KLNA 3NK7A 1IBMM 4CNGA 3U6PA 3OINA 1OY5A 3KY7A 2VIIA 4D80A 5F3WA 3AL0C 4M0WA 2CV1A 2F5NA 2Z7JA 3M7GA 4QHSA 4YQKA 3W0FA 4FD2A 5GMBA 5DYIA 3NWLA 4BBAA 2DXIA 3E5YA 4AG6A 3FUXA 3FYDA 4NSOB 4B08A 2F5PA 4AKHA 2Z4RA 2C96A 2R4EA 3BBHA 2J7NA 4GHLA 4AQYM 1Q3CA 3U6DA 3U60B 3AOEA 4IG6A 4OVZA 1SXJA 3WHKA 4YQAA 4GRIA 2EA0A 3MJ5A 2ZANA 1NNUC 1IY0A 1V2XA 4DR3M 4RF0A 3TQSA 4IBIA 4B3TM 1E9RA 1GVNA 4MGKE 3SASA 3GRRA 4LJ4A 3R8FA 4CNDA 3SMPA 3A45A 2QENA 3A98B 4FWDA 4IJFA 2I7PA 3AIAA 2X8AA 4DV5M 1ZAEA 2BJWA 3GLFB 2L7IA 1DGFA 4AG5A 1IBKM 2LXEA 3AOEC 4CGYB 3LMMA 5EXTA 1SXJC 3FUWA 3FYCA 4R7GA 1TGUA 4MB7A 4YQ9A 2YR0A 2V3JA 3N4JA 4FCVA 3QUVA 2P5TA 4L15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  1VHY A;  4MCB A;  4YPY A;  1V6Z A;  4YQ8 A;  2I6D A;  2O3A A;  3KW2 A;  3BBE A;  4YPX A;  4YQI A;  2QWV A;  3GYQ A;  4YQ3 A;  2EGV A;  4PZK A;  1P9P A;  3BBD A;  4YPW A;  4YQ2 A;  4CNF A;  1UAL A;  1NS5 A;  1X7O A;  3OIJ A;  1VHK A;  4YQR A;  3O7B A;  1VH0 A;  4YQQ A;  4YQP A;  4YQC A;  4YQ6 A;  2QMM A;  4YQ7 A;  4YQS A;  4KDZ A;  4MCC A;  3IEF A;  2V3K A;  1MXI A;  4YQB A;  4JAL A;  1GZ0 A;  3KNU A;  4YVG A;  5D9F A;  3L8U A;  5FAI A;  4JAK A;  4X3M A;  1UAM A;  4YQD A;  4YVH A;  4YQ5 A;  5CO4 A;  4FAK A;  4YQ4 A;  4H3Z A;  4L69 A;  4MCD A;  3AXZ A;  3NK7 A;  4CNG A;  3OIN A;  1OY5 A;  3KY7 A;  4YQL A;  4YPZ A;  4YQT A;  3KTY A;  1X7P A;  4XBO A;  1J85 A;  1O6D A;  4J3C A;  1ZJR A;  4YQK A;  1TO0 A;  5GMB A;  4YQ0 A;  5GMC A;  4KGN A;  3DCM X;  3E5Y A;  2EGW A;  4E8B A;  1UAJ A;  4X3L A;  3BBH A;  4YQ1 A;  3ILK A;  3OII A;  2Z0Y A;  4IG6 A;  4CNE A;  4YQG A;  2CX8 A;  4YVI A;  3IC6 A;  4YQA A;  1V2X A;  3ONP A;  4YQO A;  3N4K A;  1NXZ A;  3AI9 X;  2HA8 A;  4YQN A;  2YY8 A;  4YQJ A;  4CND A;  4RG1 A;  4YVK A;  3AIA A;  3NK6 A;  1UAK A;  1IPA A;  4YVJ A;  1Z85 A;  4H3Y A;  4YQ9 A;  2V3J A;  5GM8 A;  3N4J A;  3QUV A; 
#chains in the Genus database with same CATH topology
 1QQW A;  4LFA M;  3SBJ A;  1XNR M;  4YQ8 A;  4YPY A;  1XXH A;  3K8Z A;  1T6O A;  2QZ4 A;  3B7Q A;  4YPX A;  4P17 A;  2VF7 A;  1GJT A;  4M9X A;  2QPA A;  5DYG A;  4A3V B;  2DZO B;  1QDR A;  4CIZ A;  3GYQ A;  5FSW A;  4LF4 M;  3K92 A;  3W68 A;  2X49 A;  3PFI A;  4CHT B;  1J09 A;  3BOS A;  4QNR A;  1F4I A;  3BBD A;  2XEP A;  5ITU A;  1N33 M;  1GAB A;  4CNF A;  1OIZ A;  4NC6 A;  3DZD A;  4JN6 A;  2HWJ A;  2FOI C;  4LGM A;  3SMS A;  4Z6Y A;  4LF9 M;  3TL4 X;  1YE9 A;  3GQ5 A;  3T1H M;  1XNQ M;  4OW0 A;  4XGI A;  3U6E A;  4LFB M;  3O7B A;  3U61 A;  1NNJ A;  3ZH9 B;  2Q2E B;  2Y0T A;  4NOO B;  2CHG A;  2ZTC A;  1IN5 A;  1VDD A;  2CV2 A;  2XSZ D;  3JR4 A;  1L1T A;  3L2A A;  1G71 A;  2CRU A;  3GLH A;  4AKI A;  2V3K A;  1IY2 A;  3HU3 A;  2CHV A;  2XZU A;  1VEJ A;  2YNM D;  2OOA A;  4IBB A;  3IEC A;  3QAU A;  4YVG A;  2EKF A;  4G6Z A;  1XMQ M;  4YQ5 A;  4L16 A;  4MGY E;  2CV0 A;  1MU5 A;  1R6B X;  1WXQ A;  4L8R C;  3KP1 E;  4X65 M;  2R65 A;  5ITR A;  3TE6 A;  2CE7 A;  4DR4 M;  4H3Z A;  2EKK A;  2C99 A;  2LVN C;  2R46 A;  1HNZ M;  3SAT A;  2DVW B;  4FMW A;  3U5Z B;  4LJ7 A;  4MGI E;  5JI3 E;  2Y21 A;  4DR7 M;  2MR9 A;  2V6Z M;  4LJ9 A;  4Y28 F;  4D82 A;  2JY6 B;  1E9S A;  4BLC A;  1IBL M;  2UUA M;  3KSJ A;  3HHY A;  4YQL A;  3GLI A;  2DWZ B;  1OJL A;  4L6V 6;  3U6O A;  3SAV A;  1IN7 A;  1GKI A;  4L78 A;  3E4R A;  1X7P A;  4G4R A;  2F5Q A;  2WZJ A;  4XBO A;  4JWG A;  3IG5 A;  2DWL A;  1W5S A;  2DNA A;  3SAW A;  2XSZ A;  1TO0 A;  2R44 A;  2OOB A;  3SAU A;  4YQ0 A;  5ITQ A;  1GL7 A;  3LQR A;  3DCM X;  3RE8 A;  2CHQ A;  1NJG A;  3HWS A;  2KDL A;  4PDI A;  4G4N A;  5KPT A;  3FKE A;  4GMQ A;  4MGZ E;  1T3T A;  2J7O A;  3LCU A;  4YQ1 A;  2RKO A;  4I81 A;  3GP1 A;  3HJ8 A;  5DNY A;  2F5O A;  2CX8 A;  4DV3 M;  4DV1 M;  4IBK A;  1FNN A;  4ZPX A;  2I7N A;  5EXS A;  2N35 A;  3LQQ A;  1TF0 B;  2LVQ D;  5EXX A;  1SXJ E;  1NO1 A;  1PGY A;  3B9P A;  3TWM A;  1NXZ A;  2E5L M;  2HAK A;  2QCU A;  5C1B A;  1WGL A;  1OTR A;  4YQJ A;  2DHY A;  1P3Q Q;  2EO2 A;  3SC3 A;  4X66 M;  4RG1 A;  3Q8G A;  4IBD A;  4DR1 M;  2LNH C;  3U6Q A;  3MHV C;  2Z4S A;  1UM8 A;  3B89 A;  3MK6 A;  1TDH A;  1QAM A;  5JI2 E;  2DWN A;  4HL4 A;  4M9S A;  2KEB A;  2H1R A;  1L2B A;  5IT9 S;  1IPA A;  4NL4 H;  3B74 A;  2GNO A;  4WUR A;  2Y0Q A;  2R4J A;  3FUT A;  3T15 A;  1PJS A;  1SXJ B;  4OVZ B;  4NXN M;  3ZQJ A;  4H3Y A;  1IQP A;  3UGJ A;  4FW9 A;  4WP2 A;  5GM8 A;  1HT2 E;  3WHL A;  3UK6 A;  1E94 E;  2XH9 A;  3K9O A;  1K3R A;  1VHY A;  2FE8 A;  3L29 A;  4FVM A;  4GC5 A;  3GPX A;  2HKJ A;  3A46 A;  2JNH A;  2L09 A;  1G3I A;  3J80 S;  2UU9 M;  1XXH E;  3KFU G;  2DAM A;  1HQC A;  1R4G A;  4BB9 A;  3VKH A;  2FH0 A;  3SYL A;  1ZV1 A;  4PZK A;  1P9P A;  3CF0 A;  1N78 A;  1YSY A;  4JI6 M;  1QDT A;  1Z5B A;  4P16 A;  3BBZ A;  3VDU A;  3LVW A;  4KT0 F;  3OIJ A;  4DV7 M;  1QAN A;  4KOD A;  2C9C A;  1VHK A;  4IIW A;  1IFY A;  5BPV A;  2OPF A;  3TWL A;  3FD9 A;  2Y20 A;  1QVR A;  4YQP A;  1V92 A;  1N77 A;  3U60 A;  2UUC M;  3IHP A;  2DAG A;  1PJQ A;  3C3E A;  4DV0 M;  4HEO A;  1VDL A;  2UXB M;  2LHC A;  3DA1 A;  4YQC A;  3GLG A;  3KOX E;  2JY8 A;  4LGY A;  4YQ7 A;  4LJ6 A;  1SG9 A;  2EJS A;  1HQY E;  4KDZ A;  4OX9 M;  1YUB A;  5FTJ A;  1QYR A;  5FTM A;  4YQS A;  3L28 A;  5EJC A;  3U6C A;  2GQF A;  3I4Y A;  3GQ3 A;  3M6A A;  4LF8 M;  1TH4 A;  5FTK A;  2X4A A;  3JAM S;  5D9F A;  3GLH E;  1PM5 A;  1DGH A;  2UUB M;  2QBY A;  3KS8 A;  5FAI A;  4X3M A;  2RRU A;  3T38 A;  4RF1 A;  3ZCB B;  1N34 M;  3E21 A;  2B3T A;  4YQ4 A;  1NSF A;  1TH3 A;  3U61 B;  4L69 A;  3E46 A;  2R18 A;  4IBE A;  2UXD M;  2DAK A;  5GKN A;  1FJG M;  4YVI A;  2W82 A;  1PJI A;  2CUZ A;  3GRU A;  2HCB A;  4LRT A;  3ZC7 B;  4YPZ A;  1VQ1 A;  2FNA A;  4I5S A;  4DUZ M;  1DV0 A;  1T43 A;  1J85 A;  2KZU A;  4JWJ A;  3DFZ A;  4RNA A;  4J3C A;  3GLI E;  1C1K A;  4FWG A;  1UFZ A;  1W5T A;  2D7H A;  2K9D A;  2KW0 A;  2MGW A;  3KW6 A;  4GC9 A;  1ZJR A;  1HT1 E;  4R71 A;  2KRU A;  1BVS A;  4DR2 M;  4M0D A;  4KGN A;  4MGH A;  3T1Y M;  2K0B X;  2EGW A;  1UAJ A;  3HX3 A;  2D7G A;  1S3S A;  4QNM A;  3PVS A;  1OAI A;  2JWS A;  3D8B A;  4JI8 M;  2MJ5 B;  4QOZ C;  3UMM A;  4IBJ A;  4CIS A;  4JXJ A;  2Z0Y A;  4CNE A;  3SHF A;  1ORY B;  3GLI B;  3GRV A;  3U6L A;  2XFS A;  2ZTD A;  1Z5C A;  4MM3 B;  3RFW A;  4EIW A;  3ONP A;  4YQB A;  1MN3 A;  3I51 A;  4IBG A;  4MH0 E;  3FUV A;  2ZM6 M;  3J7B A;  1A5T A;  2F5S A;  2HA8 A;  4I8O A;  4YQN A;  3GRY A;  2VF8 A;  4AW4 A;  4YY3 M;  2LTU A;  4JI0 M;  2BWB A;  5C18 A;  1J5E M;  3GPY A;  3FE3 A;  3HU1 A;  4GKJ M;  4FCT A;  3NK6 A;  1R5L A;  3AJI B;  3HJQ A;  3KOZ E;  1UAK A;  3HHX A;  2KRK A;  4G3O A;  1QZE A;  3FTF A;  1WIV A;  4GKK M;  4YVJ A;  1QAO A;  2V1U A;  3CGW A;  3HZJ A;  2FFJ A;  4G4Q A;  2DAE A;  1ZMU A;  2C98 A;  1OAO C;  3EIH A;  2XF3 A;  3U5Z A;  1X37 A;  4YPW A;  3J2P B;  5KQ8 A;  4JI2 M;  2BNK A;  1Q39 A;  1WJ7 A;  5EQT A;  1XMO M;  7CAT A;  1DO0 A;  3LVV A;  4Z8X A;  2K6B A;  3D8L A;  4JWF A;  4MCB A;  2I6D A;  3BBE A;  2XFT A;  1GO5 A;  1WHC A;  2QHO B;  4NRW A;  4KO8 A;  1VEK A;  3E9S A;  4DUY M;  3NBI A;  1HNW M;  2WSF F;  1WGN A;  1OFH A;  3UZU A;  1JR3 D;  4YQ3 A;  3HJS A;  3C3D A;  4LZZ A;  2EGV A;  2LH0 A;  4B3S M;  4JI7 M;  4YQ2 A;  5FLX S;  3CF2 A;  2O5R A;  3CTW B;  3PNY A;  4QHT A;  4LF6 M;  1PJT A;  5L8R F;  4DV4 M;  1OIP A;  4LFC M;  2H5X A;  3DOA A;  1UAL A;  1X7O A;  2J5Y A;  2LBC A;  1D0M A;  4I4L A;  3A42 A;  4M9Z A;  1VH0 A;  1IXS A;  1V34 A;  5FTN A;  4B7H A;  3Q8X A;  4L4U A;  1RU3 A;  3KOY E;  5ITY A;  4FWH A;  4LF7 M;  1Y8G A;  2A5Y B;  1L8Q A;  3HHW A;  4GIT A;  3QWL A;  1JQJ C;  3J27 B;  3I4V A;  4JYA M;  4YQ6 A;  4PT5 A;  2VQF M;  4PD2 A;  5EXP A;  1K3X A;  1ZQ9 A;  3K9P A;  3W67 A;  5ITX A;  3C58 A;  3C9P A;  2ERC A;  3SAR A;  3IEF A;  4NSR A;  5E6J A;  4IBF A;  4MCC A;  2DI0 A;  2XLJ A;  2CFO A;  4DR5 M;  3GLG E;  3SFZ A;  2DEN A;  2ZBK B;  4OU7 A;  1JB0 F;  2VQE M;  1GZ0 A;  3FTD A;  3LCV B;  4B7G A;  1ZMV A;  3I04 M;  2Z3X A;  1H6U A;  3L8U A;  2D7E A;  2R6F A;  1UAM A;  2WSC F;  2EUC A;  4LJ8 A;  4YVH A;  4D81 A;  2C9O A;  1JR3 A;  3FTC A;  2WSE F;  4GHA A;  3IG8 A;  1N75 A;  4KHP M;  3QYB A;  4CJ6 A;  1IM2 A;  3BXW A;  1VEG A;  2L2D A;  1XHB A;  1CUK A;  4X62 M;  2C5R A;  2L4E A;  4DV6 M;  4B3R M;  2JXN A;  5LMN M;  2F4V M;  1GL6 A;  2L6O A;  2ZAO A;  5EP2 A;  3SHG B;  1NJF A;  4F2L A;  5H37 D;  1G8P A;  3VLF B;  3GLG B;  4F1I A;  1XXH B;  4DBG B;  4K0K M;  3AFH A;  1K82 A;  1NV9 A;  4GEW A;  3GPP A;  1K3W A;  4YQT A;  4HLQ A;  3KTY A;  4B3M M;  1IN4 A;  1R7R A;  3HHZ A;  4G4O A;  1O6D A;  2HL7 A;  2O25 A;  2DHR A;  2QNJ A;  1DGB A;  1DGH B;  3B7N A;  1L2D A;  5ITT A;  2DZN B;  3KP0 E;  2QBY B;  2G8L A;  2YFQ A;  2K47 A;  4IJE A;  5GMC A;  2KHH A;  5LMU M;  4DR6 M;  1EE8 A;  1AUA A;  1NVM A;  5KO3 A;  1GLN A;  3L27 A;  2MH8 A;  4GIP A;  1ZMW A;  3H4M A;  3TPZ A;  1EIJ A;  3KOW E;  1L1Z A;  4FAK A;  4E8B A;  1QUT A;  3M0E A;  4X3L A;  3KSX A;  2DWM A;  3RGS A;  2HHH M;  3R9X B;  3H4J A;  1NY6 A;  3GLF A;  3ILK A;  2YQZ A;  5IZ7 D;  3HKP A;  3KXE C;  4LJA A;  3OII A;  3CF6 E;  4Q7J A;  5EP4 A;  1MX0 A;  3VK7 A;  3GO8 A;  3HGI A;  3U6M A;  3FTE A;  5BR8 M;  3IC6 A;  4YQG A;  1HR0 M;  2KXE A;  4WW0 A;  4YQO A;  1KFV A;  1DGG A;  4LZJ A;  4W5W A;  5E26 A;  1Z59 A;  3VKG A;  1I94 M;  3GLH B;  3N4K A;  4LRS A;  2CWB A;  2XZF A;  4NXM M;  1IY1 A;  3AI9 X;  1OFI A;  1KSF X;  1Z5A A;  3FRI A;  3TWK A;  1MJG M;  4LJ5 A;  5KQD A;  2QQ8 A;  5EP1 A;  4X64 M;  3L26 A;  3W0L B;  1PJJ A;  2YY8 A;  4JI3 M;  1OQY A;  4PCZ A;  3KDS E;  3HY5 A;  4YVK A;  4JWH A;  4NRV A;  2KNA A;  4REZ A;  4LCB A;  3K1J A;  1Q3B A;  2ZAM A;  5IWA M;  2XGN A;  2JY5 A;  1R2Y A;  1Z85 A;  1XB2 B;  1HNX M;  2DKL A;  2LVO C;  1XC8 A;  4AKG A;  2BJV A;  3GPU A;  1NY5 A;  5IRE B;  1QZM A;  2OQ4 A;  2QP9 X;  3JR5 A;  3KS4 A;  1J7K A;  3LW5 F;  3QYE A;  1G41 A;  1HJP A;  1NHG C;  1G4A E;  3FUU A;  1V6Z A;  2O3A A;  3KW2 A;  3U6S A;  2L7H A;  4YQI A;  4TUW A;  3K2L A;  1IN8 A;  2CEA A;  5EP3 A;  2RGO A;  2JZ1 A;  2QWV A;  3EIE A;  2UXC M;  3MMP A;  1TH2 A;  4LY6 A;  3PNV A;  1N32 M;  2NQ8 C;  1L2C A;  4II7 A;  3J7A S;  2VDB B;  2MRO B;  2RGH A;  1NHW C;  4ITQ A;  1DO2 A;  3VK8 A;  2LWX A;  1IN6 A;  2M60 A;  4LG2 A;  2JUJ A;  3NBX X;  3FRH A;  4LF5 M;  1NS5 A;  2G3Q A;  4B7F A;  4YQR A;  3F92 A;  1E32 A;  1LV7 A;  1I4W A;  4R3D A;  3SYK A;  3J81 S;  1IXZ A;  1LTM A;  1V33 A;  1XWI A;  4GH9 A;  4YQQ A;  3VDP A;  4PDG A;  5KPR A;  2KZS A;  2V1C A;  4JI5 M;  2R62 A;  3OTO M;  4AI6 A;  1QAQ A;  1N36 M;  3VFD A;  3UJN A;  5KPZ A;  4IBC A;  2JY7 A;  4YHH M;  4UN2 B;  2QMM A;  4QOS A;  3B7Z A;  2KA6 B;  4S12 A;  1TDZ A;  2LHG A;  1TTE A;  3THG A;  1IXR C;  1MXI A;  1QUS A;  1Z6T A;  1D0K A;  2FS1 A;  3KNU A;  3RGP A;  2QSF X;  4JV5 M;  4JAL A;  2AHM A;  5ITX E;  2O01 F;  3AV0 A;  1R2Z A;  4JAK A;  1KYI A;  2DZL A;  4AZF A;  4YQD A;  4XK8 F;  5A2Q S;  1D2N A;  3GQ4 A;  1G59 A;  1SXJ D;  2KNZ A;  3KVW A;  5CO4 A;  2G5G X;  3HU2 A;  4DV2 M;  4JI1 M;  1IXS B;  2M5Z A;  5FTL A;  2BWE A;  2JA2 A;  3AOG A;  2R45 A;  3L25 A;  4MCD A;  3AKZ A;  1OKS A;  1JR3 E;  2R0I A;  3AXZ A;  2JP7 A;  8CAT A;  4FCW A;  3PXG A;  1NV8 A;  1Q02 A;  4KLN A;  1IBM M;  1GJS A;  3NK7 A;  3U6P A;  4CNG A;  1OY5 A;  3OIN A;  3KY7 A;  2VII A;  4D80 A;  5F3W A;  3AL0 C;  4M0W A;  1AIP C;  1EFU B;  1D0L A;  2CV1 A;  2CP8 A;  2F5N A;  2Z7J A;  3M7G A;  2DAI A;  4QHS A;  4YQK A;  3W0F A;  4FD2 A;  3V76 A;  5GMB A;  5DYI A;  3NWL A;  4BBA A;  2DXI A;  3E5Y A;  4AG6 A;  3FUX A;  3FYD A;  4NSO B;  4B08 A;  2F5P A;  4AKH A;  2Z4R A;  2C96 A;  2R4E A;  3T6P A;  3BBH A;  2J7N A;  3I01 M;  4AQY M;  4GHL A;  1Q3C A;  2APL A;  3U6D A;  1TR8 A;  3AOE A;  3U60 B;  4IG6 A;  4OVZ A;  1SXJ A;  2Z8Y M;  3WHK A;  4YQA A;  4GRI A;  2EA0 A;  3MJ5 A;  2ZAN A;  1IY0 A;  1NNU C;  4RKU F;  1PRB A;  3GLF E;  1V2X A;  4DR3 M;  1WR1 B;  4RF0 A;  3TQS A;  1YLA A;  4IBI A;  4B3T M;  4JI4 M;  1E9R A;  1GVN A;  4MGK E;  3SAS A;  2LVP C;  3GRR A;  4LJ4 A;  3R8F A;  2JZ0 A;  4CND A;  3SMP A;  3A45 A;  2QEN A;  3A98 B;  4FWD A;  1VG5 A;  4IJF A;  2I7P A;  3AIA A;  2X8A A;  2L4F A;  4DV5 M;  1ZAE A;  2BJW A;  3GLF B;  2L7I A;  1DGF A;  4AG5 A;  1IBK M;  2LVA A;  2LXE A;  3AOE C;  5DFL A;  2OO9 A;  3LMM A;  2KNV A;  1SXJ C;  3FUW A;  3FYC A;  5EXT A;  4ANR A;  4R7G A;  4CGY B;  1TGU A;  4MB7 A;  4YQ9 A;  2YR0 A;  1C7Y A;  2V3J A;  3N4J A;  4FCV A;  3QUV A;  2P5T A;  4L15 A; 
#chains in the Genus database with same CATH homology
 1QQW A;  4LFA M;  3SBJ A;  1XNR M;  4YQ8 A;  4YPY A;  1XXH A;  3K8Z A;  2QZ4 A;  4YPX A;  4M9X A;  2QPA A;  5DYG A;  4A3V B;  2DZO B;  3GYQ A;  5FSW A;  4LF4 M;  3K92 A;  2X49 A;  3PFI A;  4CHT B;  1J09 A;  3BOS A;  4QNR A;  3BBD A;  2XEP A;  5ITU A;  1N33 M;  4CNF A;  3DZD A;  4JN6 A;  4LF9 M;  2FOI C;  4LGM A;  3SMS A;  4Z6Y A;  1NS5 A;  3TL4 X;  1YE9 A;  3GQ5 A;  3T1H M;  1XNQ M;  4OW0 A;  4XGI A;  3U6E A;  4LFB M;  3O7B A;  3U61 A;  1NNJ A;  3ZH9 B;  2Q2E B;  2Y0T A;  4NOO B;  2CHG A;  1IN5 A;  1VDD A;  2CV2 A;  2XSZ D;  3JR4 A;  1L1T A;  3L2A A;  3GLH A;  4AKI A;  2V3K A;  1IY2 A;  3HU3 A;  2CHV A;  2XZU A;  2YNM D;  4IBB A;  3QAU A;  4YVG A;  4G6Z A;  1XMQ M;  4YQ5 A;  4L16 A;  4MGY E;  2CV0 A;  1MU5 A;  1R6B X;  1WXQ A;  4L8R C;  3KP1 E;  4X65 M;  2R65 A;  5ITR A;  3TE6 A;  2CE7 A;  4DR4 M;  4H3Z A;  2C99 A;  2R46 A;  1HNZ M;  3SAT A;  2DVW B;  4FMW A;  3U5Z B;  4LJ7 A;  4MGI E;  5JI3 E;  2Y21 A;  4DR7 M;  2V6Z M;  4LJ9 A;  4D82 A;  4BLC A;  1E9S A;  1IBL M;  2UUA M;  3KSJ A;  3HHY A;  4YQL A;  3GLI A;  2DWZ B;  1OJL A;  3U6O A;  3SAV A;  1IN7 A;  1GKI A;  4L78 A;  3E4R A;  1X7P A;  4G4R A;  2F5Q A;  4XBO A;  4JWG A;  3IG5 A;  2DWL A;  1W5S A;  3SAW A;  2XSZ A;  1TO0 A;  4YQ0 A;  3SAU A;  5ITQ A;  1GL7 A;  3LQR A;  3DCM X;  3RE8 A;  2CHQ A;  1NJG A;  3HWS A;  4PDI A;  4G4N A;  5KPT A;  3FKE A;  4GMQ A;  4MGZ E;  1T3T A;  2J7O A;  4YQ1 A;  2RKO A;  4I81 A;  3GP1 A;  3HJ8 A;  5DNY A;  2F5O A;  2CX8 A;  4DV3 M;  4DV1 M;  4IBK A;  1FNN A;  4ZPX A;  2I7N A;  5EXS A;  3LQQ A;  5EXX A;  1SXJ E;  3B9P A;  3TWM A;  1NXZ A;  2E5L M;  2QCU A;  5C1B A;  4YQJ A;  2EO2 A;  3SC3 A;  4X66 M;  4RG1 A;  4IBD A;  4DR1 M;  2LNH C;  3U6Q A;  3MHV C;  2Z4S A;  1UM8 A;  3MK6 A;  5JI2 E;  1TDH A;  1QAM A;  2DWN A;  4HL4 A;  4M9S A;  2KEB A;  2H1R A;  1L2B A;  5IT9 S;  1IPA A;  4NL4 H;  4WUR A;  2Y0Q A;  2R4J A;  3FUT A;  3T15 A;  4OVZ B;  1SXJ B;  4H3Y A;  4NXN M;  1IQP A;  3UGJ A;  4FW9 A;  5GM8 A;  1HT2 E;  3WHL A;  3UK6 A;  1E94 E;  2XH9 A;  1K3R A;  1VHY A;  2FE8 A;  3L29 A;  4FVM A;  4GC5 A;  3GPX A;  2HKJ A;  3A46 A;  2L09 A;  1G3I A;  3J80 S;  2UU9 M;  3KFU G;  1HQC A;  4BB9 A;  3VKH A;  3SYL A;  4PZK A;  1P9P A;  3CF0 A;  1N78 A;  1YSY A;  4JI6 M;  1Z5B A;  4P16 A;  3VDU A;  3LVW A;  3OIJ A;  4DV7 M;  1QAN A;  4KOD A;  2C9C A;  1VHK A;  4IIW A;  5BPV A;  2OPF A;  3TWL A;  3FD9 A;  2Y20 A;  1QVR A;  4YQP A;  1N77 A;  3U60 A;  2UUC M;  4DV0 M;  2UXB M;  4YQC A;  3DA1 A;  3GLG A;  3KOX E;  4LGY A;  4YQ7 A;  4LJ6 A;  4YQS A;  1HQY E;  4KDZ A;  4OX9 M;  1YUB A;  5FTJ A;  1QYR A;  5FTM A;  3L28 A;  5EJC A;  3U6C A;  3I4Y A;  3GQ3 A;  3M6A A;  4LF8 M;  1TH4 A;  5FTK A;  2X4A A;  3JAM S;  5D9F A;  1PM5 A;  1DGH A;  2UUB M;  2QBY A;  3KS8 A;  5FAI A;  4X3M A;  3T38 A;  4RF1 A;  3ZCB B;  1N34 M;  4YQ4 A;  1NSF A;  1TH3 A;  3U61 B;  4L69 A;  2R18 A;  4IBE A;  2UXD M;  5GKN A;  1FJG M;  4YVI A;  2W82 A;  1PJI A;  2CUZ A;  3GRU A;  2HCB A;  4LRT A;  3ZC7 B;  4YPZ A;  4DUZ M;  2FNA A;  4I5S A;  1J85 A;  2KZU A;  4JWJ A;  3DFZ A;  4RNA A;  4J3C A;  1C1K A;  4FWG A;  2D7H A;  1W5T A;  1ZJR A;  3KW6 A;  2KW0 A;  4GC9 A;  1HT1 E;  2KRU A;  4DR2 M;  4M0D A;  4KGN A;  4MGH A;  3T1Y M;  2EGW A;  1UAJ A;  2D7G A;  1S3S A;  4QNM A;  3PVS A;  3D8B A;  4JI8 M;  4QOZ C;  3UMM A;  4IBJ A;  4CIS A;  4JXJ A;  2Z0Y A;  4CNE A;  3SHF A;  1ORY B;  3GLI B;  3GRV A;  3U6L A;  2XFS A;  3RFW A;  1Z5C A;  4MM3 B;  4EIW A;  3ONP A;  3I51 A;  4IBG A;  4MH0 E;  3FUV A;  2ZM6 M;  3J7B A;  2F5S A;  2HA8 A;  4I8O A;  4YQN A;  3GRY A;  4AW4 A;  4YY3 M;  4JI0 M;  5C18 A;  1J5E M;  3GPY A;  3HU1 A;  4GKJ M;  4FCT A;  3NK6 A;  3AJI B;  3HJQ A;  3KOZ E;  1UAK A;  3HHX A;  2KRK A;  3FTF A;  4GKK M;  4YVJ A;  1QAO A;  2V1U A;  2FFJ A;  4G4Q A;  3U5Z A;  2C98 A;  3EIH A;  2XF3 A;  1X37 A;  4YPW A;  3J2P B;  5KQ8 A;  4JI2 M;  2BNK A;  1Q39 A;  5EQT A;  1XMO M;  7CAT A;  1DO0 A;  3LVV A;  4Z8X A;  3D8L A;  4JWF A;  4MCB A;  2I6D A;  3BBE A;  2XFT A;  4NRW A;  4KO8 A;  3E9S A;  4DUY M;  3NBI A;  1HNW M;  3UZU A;  1OFH A;  1JR3 D;  4YQ3 A;  3HJS A;  4LZZ A;  2EGV A;  2LH0 A;  4B3S M;  4JI7 M;  4YQ2 A;  5FLX S;  3CF2 A;  2O5R A;  3CTW B;  3PNY A;  4QHT A;  4LF6 M;  4LFC M;  4DV4 M;  1UAL A;  3DOA A;  1X7O A;  4I4L A;  3A42 A;  4M9Z A;  1VH0 A;  4B7H A;  5FTN A;  3Q8X A;  4L4U A;  5ITY A;  3KOY E;  4LF7 M;  4FWH A;  2A5Y B;  1L8Q A;  3HHW A;  4GIT A;  3QWL A;  1JQJ C;  3J27 B;  3I4V A;  4JYA M;  4YQ6 A;  4PT5 A;  2VQF M;  4PD2 A;  5EXP A;  1K3X A;  1ZQ9 A;  5ITX A;  3C58 A;  4MCC A;  2ERC A;  3SAR A;  3IEF A;  4NSR A;  5E6J A;  4IBF A;  2XLJ A;  2CFO A;  4DR5 M;  3SFZ A;  4OU7 A;  2ZBK B;  1GZ0 A;  2VQE M;  3FTD A;  4B7G A;  2Z3X A;  3L8U A;  1H6U A;  2D7E A;  1UAM A;  2EUC A;  4LJ8 A;  4YVH A;  4D81 A;  2C9O A;  1JR3 A;  3FTC A;  4GHA A;  3IG8 A;  1N75 A;  4KHP M;  1IM2 A;  2C5R A;  1XHB A;  4B3R M;  4X62 M;  4DV6 M;  5LMN M;  2F4V M;  1GL6 A;  2L6O A;  2ZAO A;  5EP2 A;  3SHG B;  1NJF A;  5H37 D;  1G8P A;  3VLF B;  3GLG B;  4K0K M;  1XXH B;  3AFH A;  1K82 A;  3GPP A;  1K3W A;  4YQT A;  4HLQ A;  3KTY A;  4B3M M;  1IN4 A;  1R7R A;  3HHZ A;  4G4O A;  1O6D A;  2HL7 A;  2DHR A;  1L2D A;  1DGB A;  1DGH B;  2QBY B;  5ITT A;  2DZN B;  3KP0 E;  2G8L A;  2YFQ A;  2K47 A;  4IJE A;  5GMC A;  5LMU M;  4DR6 M;  1EE8 A;  1NVM A;  5KO3 A;  1GLN A;  3L27 A;  4GIP A;  3H4M A;  3TPZ A;  3KOW E;  1L1Z A;  4E8B A;  3M0E A;  4X3L A;  3KSX A;  2DWM A;  3RGS A;  2HHH M;  3R9X B;  1NY6 A;  3GLF A;  3ILK A;  2YQZ A;  5IZ7 D;  3HKP A;  3KXE C;  4LJA A;  3OII A;  3CF6 E;  5EP4 A;  1MX0 A;  3VK7 A;  3GO8 A;  3HGI A;  3U6M A;  3FTE A;  5BR8 M;  3IC6 A;  4YQG A;  1HR0 M;  2KXE A;  4WW0 A;  4YQO A;  1KFV A;  1DGG A;  4LZJ A;  4W5W A;  5E26 A;  1Z59 A;  3VKG A;  1I94 M;  3GLH B;  3N4K A;  4LRS A;  2XZF A;  4NXM M;  1IY1 A;  3AI9 X;  1OFI A;  1KSF X;  1Z5A A;  4JI4 M;  3TWK A;  4LJ5 A;  5KQD A;  4X64 M;  5EP1 A;  3L26 A;  1PJJ A;  3W0L B;  2YY8 A;  4JI3 M;  4PCZ A;  3KDS E;  4YVK A;  4JWH A;  4NRV A;  4REZ A;  4LCB A;  3K1J A;  1Q3B A;  2ZAM A;  5IWA M;  2XGN A;  1R2Y A;  1Z85 A;  1HNX M;  1XC8 A;  4AKG A;  2BJV A;  3GPU A;  1NY5 A;  5IRE B;  1QZM A;  2OQ4 A;  2QP9 X;  3JR5 A;  3KS4 A;  1J7K A;  1G41 A;  1NHG C;  1G4A E;  3FUU A;  1V6Z A;  2O3A A;  3KW2 A;  3U6S A;  2L7H A;  4YQI A;  4TUW A;  3K2L A;  1IN8 A;  2CEA A;  5EP3 A;  2RGO A;  2QWV A;  3EIE A;  2UXC M;  1TH2 A;  4LY6 A;  3PNV A;  1N32 M;  2NQ8 C;  1L2C A;  4II7 A;  3J7A S;  2RGH A;  1NHW C;  4ITQ A;  1DO2 A;  3VK8 A;  2LWX A;  1IN6 A;  2M60 A;  4LG2 A;  4LF5 M;  4B7F A;  4YQR A;  1E32 A;  1LV7 A;  1I4W A;  4R3D A;  3SYK A;  3J81 S;  1IXZ A;  4YQQ A;  1XWI A;  4GH9 A;  3VDP A;  4PDG A;  5KPR A;  2KZS A;  2V1C A;  4JI5 M;  2R62 A;  3OTO M;  4AI6 A;  1QAQ A;  1N36 M;  3VFD A;  3UJN A;  5KPZ A;  4IBC A;  4YHH M;  2QMM A;  4QOS A;  2KA6 B;  4S12 A;  1TDZ A;  3THG A;  1IXR C;  1MXI A;  1Z6T A;  4YQB A;  4JAL A;  3KNU A;  3RGP A;  4JV5 M;  2AHM A;  5ITX E;  3AV0 A;  1R2Z A;  4JAK A;  1KYI A;  4AZF A;  4YQD A;  5A2Q S;  1D2N A;  3GQ4 A;  1G59 A;  3KVW A;  1SXJ D;  5CO4 A;  4FAK A;  2G5G X;  3HU2 A;  4DV2 M;  4JI1 M;  1IXS B;  2M5Z A;  5FTL A;  2JA2 A;  3AOG A;  2R45 A;  3L25 A;  4MCD A;  3AKZ A;  3AXZ A;  8CAT A;  4FCW A;  3PXG A;  4KLN A;  3NK7 A;  1IBM M;  4CNG A;  3U6P A;  3OIN A;  1OY5 A;  3KY7 A;  2VII A;  4D80 A;  5F3W A;  3AL0 C;  4M0W A;  2CV1 A;  2F5N A;  2Z7J A;  3M7G A;  4QHS A;  4YQK A;  3W0F A;  4FD2 A;  5GMB A;  5DYI A;  3NWL A;  4BBA A;  2DXI A;  3E5Y A;  4AG6 A;  3FUX A;  3FYD A;  4NSO B;  4B08 A;  2F5P A;  4AKH A;  2Z4R A;  2C96 A;  2R4E A;  3BBH A;  2J7N A;  4GHL A;  4AQY M;  1Q3C A;  3U6D A;  3U60 B;  3AOE A;  4IG6 A;  4OVZ A;  1SXJ A;  3WHK A;  4YQA A;  4GRI A;  2EA0 A;  3MJ5 A;  2ZAN A;  1NNU C;  1IY0 A;  1V2X A;  4DR3 M;  4RF0 A;  3TQS A;  4IBI A;  4B3T M;  1E9R A;  1GVN A;  4MGK E;  3SAS A;  3GRR A;  4LJ4 A;  3R8F A;  4CND A;  3SMP A;  3A45 A;  2QEN A;  3A98 B;  4FWD A;  4IJF A;  2I7P A;  3AIA A;  2X8A A;  4DV5 M;  1ZAE A;  2BJW A;  3GLF B;  2L7I A;  1DGF A;  4AG5 A;  1IBK M;  2LXE A;  3AOE C;  4CGY B;  3LMM A;  5EXT A;  1SXJ C;  3FUW A;  3FYC A;  4R7G A;  1TGU A;  4MB7 A;  4YQ9 A;  2YR0 A;  2V3J A;  3N4J A;  4FCV A;  3QUV A;  2P5T A;  4L15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...