4FMWA

Crystal structure of methyltransferase domain of human rna (guanine-9-) methyltransferase domain containing protein 2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
182
structure length
178
Chain Sequence
RDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVRKVLAVNHVFEIILEYLETRDWQEAFFTILPQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA (guanine-9-)-methyltransferase domain-containing protein
publication title Crystal structure of methyltransferase domain of human RNA (guanine-9-) methyltransferase domain containing protein 2
rcsb
source organism Homo sapiens
total genus 58
structure length 178
sequence length 182
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4fmwA00
4JWJA 4JWGA 4JWHA 4JWFA 4FMWA
chains in the Genus database with same CATH superfamily
1X7PA 1NS5A 4YPXA 4CNEA 1VH0A 4YQ3A 4YQAA 4L69A 4YQKA 4FAKA 3AIAA 4YQCA 3KNUA 1NXZA 1TO0A 3E5YA 4YQPA 4JWJA 1UAKA 2Z0YA 2EGVA 1J85A 4YQQA 4YQGA 3OIIA 4YQ1A 1P9PA 3ONPA 4YQ7A 4MCDA 3IEFA 3IC6A 4YQ8A 3BBEA 4E8BA 1V6ZA 2HA8A 4CNFA 2I6DA 1K3RA 4YVHA 2EGWA 4JWGA 4YQBA 4X3MA 2V3KA 3BBDA 2YY8A 1GZ0A 4XBOA 4YPYA 4H3YA 3AXZA 4H3ZA 4YQ5A 4YVJA 3KTYA 4YQ9A 4IG6A 4CNDA 1IPAA 4MCCA 4YQRA 1MXIA 4YQJA 4YQOA 4YQLA 4YVIA 4YQIA 1VHYA 3OIJA 2V3JA 1ZJRA 2CX8A 1UAMA 4YQ0A 4JWFA 4J3CA 1X7OA 3L8UA 4KGNA 3QUVA 4YQTA 1OY5A 3NK7A 4JALA 4YVKA 1Z85A 4KDZA 3ILKA 4YQ6A 4YQSA 3O7BA 3GYQA 3NK6A 2O3AA 1UALA 1V2XA 4RG1A 2QMMA 3N4JA 4YPZA 4YQDA 4JAKA 1O6DA 3BBHA 4YQNA 1UAJA 4X3LA 4YPWA 3KW2A 5CO4A 3AI9X 4YQ4A 2QWVA 5D9FA 4MCBA 5GMBA 4PZKA 4YQ2A 4JWHA 3DCMX 5FAIA 1VHKA 4YVGA 5GM8A 4CNGA 3N4KA 5GMCA 3OINA 3KY7A 4FMWA
chains in the Genus database with same CATH topology
1X7PA 1NS5A 4YPXA 4CNEA 1VH0A 4YQ3A 4YQAA 4L69A 4YQKA 4FAKA 3AIAA 4YQCA 3KNUA 1NXZA 1TO0A 3E5YA 4YQPA 4JWJA 1UAKA 2Z0YA 2EGVA 1J85A 4YQQA 4YQGA 3OIIA 4YQ1A 1P9PA 3ONPA 4YQ7A 4MCDA 3IEFA 3IC6A 4YQ8A 3BBEA 4E8BA 1V6ZA 2HA8A 4CNFA 2I6DA 1K3RA 4YVHA 2EGWA 4JWGA 4YQBA 4X3MA 2V3KA 3BBDA 2YY8A 1GZ0A 4XBOA 4YPYA 4H3YA 3AXZA 4H3ZA 4YQ5A 4YVJA 3KTYA 4YQ9A 4IG6A 4CNDA 1IPAA 4MCCA 4YQRA 1MXIA 4YQJA 4YQOA 4YQLA 4YVIA 4YQIA 1VHYA 3OIJA 2V3JA 1ZJRA 2CX8A 1UAMA 4YQ0A 4JWFA 4J3CA 1X7OA 3L8UA 4KGNA 3QUVA 4YQTA 1OY5A 3NK7A 4JALA 4YVKA 1Z85A 4KDZA 3ILKA 4YQ6A 4YQSA 3O7BA 3GYQA 3NK6A 2O3AA 1UALA 1V2XA 4RG1A 2QMMA 3N4JA 4YPZA 4YQDA 4JAKA 1O6DA 3BBHA 4YQNA 1UAJA 4X3LA 4YPWA 3KW2A 5CO4A 3AI9X 4YQ4A 2QWVA 5D9FA 4MCBA 5GMBA 4PZKA 4YQ2A 4JWHA 3DCMX 5FAIA 1VHKA 4YVGA 5GM8A 4CNGA 3N4KA 5GMCA 3OINA 3KY7A 4FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWJ A;  4JWG A;  4JWH A;  4JWF A;  4FMW A; 
#chains in the Genus database with same CATH topology
 1X7P A;  1NS5 A;  4YPX A;  4CNE A;  1VH0 A;  4YQ3 A;  4YQA A;  4L69 A;  4YQK A;  4FAK A;  3AIA A;  4YQC A;  3KNU A;  1NXZ A;  1TO0 A;  3E5Y A;  4YQP A;  4JWJ A;  1UAK A;  2Z0Y A;  2EGV A;  1J85 A;  4YQQ A;  4YQG A;  3OII A;  4YQ1 A;  1P9P A;  3ONP A;  4YQ7 A;  4MCD A;  3IEF A;  3IC6 A;  4YQ8 A;  3BBE A;  4E8B A;  1V6Z A;  2HA8 A;  4CNF A;  2I6D A;  1K3R A;  4YVH A;  2EGW A;  4JWG A;  4YQB A;  4X3M A;  2V3K A;  3BBD A;  2YY8 A;  1GZ0 A;  4XBO A;  4YPY A;  4H3Y A;  3AXZ A;  4H3Z A;  4YQ5 A;  4YVJ A;  3KTY A;  4YQ9 A;  4IG6 A;  4CND A;  1IPA A;  4MCC A;  4YQR A;  1MXI A;  4YQJ A;  4YQO A;  4YQL A;  4YVI A;  4YQI A;  1VHY A;  3OIJ A;  2V3J A;  1ZJR A;  2CX8 A;  1UAM A;  4YQ0 A;  4JWF A;  4J3C A;  1X7O A;  3L8U A;  4KGN A;  3QUV A;  4YQT A;  1OY5 A;  3NK7 A;  4JAL A;  4YVK A;  1Z85 A;  4KDZ A;  3ILK A;  4YQ6 A;  4YQS A;  3O7B A;  3GYQ A;  3NK6 A;  2O3A A;  1UAL A;  1V2X A;  4RG1 A;  2QMM A;  3N4J A;  4YPZ A;  4YQD A;  4JAK A;  1O6D A;  3BBH A;  4YQN A;  1UAJ A;  4X3L A;  4YPW A;  3KW2 A;  5CO4 A;  3AI9 X;  4YQ4 A;  2QWV A;  5D9F A;  4MCB A;  5GMB A;  4PZK A;  4YQ2 A;  4JWH A;  3DCM X;  5FAI A;  1VHK A;  4YVG A;  5GM8 A;  4CNG A;  3N4K A;  5GMC A;  3OIN A;  3KY7 A;  4FMW A; 
#chains in the Genus database with same CATH homology
 1X7P A;  1NS5 A;  4YPX A;  4CNE A;  1VH0 A;  4YQ3 A;  4YQA A;  4L69 A;  4YQK A;  4FAK A;  3AIA A;  4YQC A;  3KNU A;  1NXZ A;  1TO0 A;  3E5Y A;  4YQP A;  4JWJ A;  1UAK A;  2Z0Y A;  2EGV A;  1J85 A;  4YQQ A;  4YQG A;  3OII A;  4YQ1 A;  1P9P A;  3ONP A;  4YQ7 A;  4MCD A;  3IEF A;  3IC6 A;  4YQ8 A;  3BBE A;  4E8B A;  1V6Z A;  2HA8 A;  4CNF A;  2I6D A;  1K3R A;  4YVH A;  2EGW A;  4JWG A;  4YQB A;  4X3M A;  2V3K A;  3BBD A;  2YY8 A;  1GZ0 A;  4XBO A;  4YPY A;  4H3Y A;  3AXZ A;  4H3Z A;  4YQ5 A;  4YVJ A;  3KTY A;  4YQ9 A;  4IG6 A;  4CND A;  1IPA A;  4MCC A;  4YQR A;  1MXI A;  4YQJ A;  4YQO A;  4YQL A;  4YVI A;  4YQI A;  1VHY A;  3OIJ A;  2V3J A;  1ZJR A;  2CX8 A;  1UAM A;  4YQ0 A;  4JWF A;  4J3C A;  1X7O A;  3L8U A;  4KGN A;  3QUV A;  4YQT A;  1OY5 A;  3NK7 A;  4JAL A;  4YVK A;  1Z85 A;  4KDZ A;  3ILK A;  4YQ6 A;  4YQS A;  3O7B A;  3GYQ A;  3NK6 A;  2O3A A;  1UAL A;  1V2X A;  4RG1 A;  2QMM A;  3N4J A;  4YPZ A;  4YQD A;  4JAK A;  1O6D A;  3BBH A;  4YQN A;  1UAJ A;  4X3L A;  4YPW A;  3KW2 A;  5CO4 A;  3AI9 X;  4YQ4 A;  2QWV A;  5D9F A;  4MCB A;  5GMB A;  4PZK A;  4YQ2 A;  4JWH A;  3DCM X;  5FAI A;  1VHK A;  4YVG A;  5GM8 A;  4CNG A;  3N4K A;  5GMC A;  3OIN A;  3KY7 A;  4FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...