4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
3ILKA 1ZJRA 4YQRA 1TO0A 1OY5A 5CO4A 4YVGA 1VH0A 2QWVA 3AIAA 4JAKA 1NXZA 2EGWA 1UAJA 3IEFA 4YQ5A 1VHYA 3AI9X 3L8UA 4YQ8A 3BBHA 4MCCA 4KDZA 4L69A 4YQPA 1O6DA 1VHKA 1V2XA 1MXIA 5FAIA 4CNFA 4KGNA 4YQ6A 1UAKA 4IG6A 3OIJA 2QMMA 4YQJA 1GZ0A 3O7BA 4YQ9A 4YQOA 4YVKA 4YQ7A 4CNGA 4X3MA 4YQ0A 4CNDA 3BBDA 5D9FA 2EGVA 1X7OA 4RG1A 4YQSA 5GMCA 3KNUA 1Z85A 5GMBA 4YVIA 3IC6A 1J85A 4YPXA 4YQ3A 1IPAA 1V6ZA 4YQBA 4E8BA 2HA8A 4YQDA 4YVJA 3N4KA 4YPWA 4FAKA 4YQ1A 2O3AA 3GYQA 3KTYA 3NK6A 4YQQA 3QUVA 4YQ4A 4YQIA 2Z0YA 4YQCA 2CX8A 4MCBA 4MCDA 3ONPA 4H3ZA 3OIIA 3E5YA 4YPZA 1P9PA 2I6DA 3BBEA 1X7PA 5GM8A 4CNEA 3KY7A 3OINA 3NK7A 4J3CA 4XBOA 4YQNA 1K3RA 4X3LA 4PZKA 4JALA 4YQLA 1NS5A 4YQGA 3N4JA 4YQAA 3KW2A 1UALA 4YQKA 4YQTA 3DCMX 2V3KA 4H3YA 4YPYA 3AXZA 4YVHA 1UAMA 4YQ2A 2YY8A 2V3JA
chains in the Genus database with same CATH superfamily
3U6MA 4MGYE 4LGYA 3U6EA 4M9XA 3HJ8A 3HJQA 4P16A 3IG5A 4X62M 2JP7A 3FUVA 4NRVA 5ITXA 5IWAM 1PM5A 5EXTA 4LF5M 1NV8A 1L1TA 1VH0A 1D2NA 3GLHE 3CTWB 2UXCM 3AIAA 3B89A 4M9ZA 3NBXX 4AQYM 4LJ5A 3GLFB 1F4IA 2UUAM 4JWJA 1UAJA 1T3TA 3M7GA 3CF6E 3IEFA 2MROB 1VHYA 3AI9X 1J5EM 1GO5A 3L8UA 1G3IA 2QBYB 1H6UA 3SHFA 4OX9M 3GLIE 4KDZA 1PJSA 4IJEA 3ZC7B 4DV2M 1W5SA 1FNNA 2ZTDA 4GMQA 4BLCA 1VHKA 3T1YM 2RKOA 1MXIA 2F5QA 1TH3A 5EJCA 1C7YA 4KGNA 4IBIA 1XXHA 3KW6A 4W5WA 2Y20A 1QVRA 3VDPA 4Y28F 2UUBM 3IHPA 4NC6A 3KOYE 1NNJA 5KPTA 4LGMA 3AV0A 4YQJA 3FD9A 3HU1A 1NJGA 4YQ9A 2KZUA 1G71A 2Q2EB 4YQOA 1Z5AA 3FUWA 4ITQA 2DWLA 4WP2A 3SC3A 1R5LA 1WGNA 4DUZM 1Q3BA 5D9FA 5KO3A 4YQSA 4RG1A 3U6QA 1N78A 5GMBA 2P5TA 5JI2E 1JQJC 2EO2A 2V6ZM 5FSWA 3GQ3A 4YVIA 1N32M 2EJSA 4HL4A 1G59A 4LF7M 2BWEA 5DNYA 4YPXA 1MU5A 1XWIA 4QHSA 4DV4M 1EIJA 1DGBA 4YQBA 2DAEA 3GLHB 2HA8A 4RF0A 3L26A 3Q8GA 1MN3A 2FOIC 2KNAA 4JI2M 4YPWA 4FAKA 1GLNA 2R4EA 1LV7A 1OJLA 4JWHA 3ZCBB 3IG8A 2MH8A 2JZ1A 3KVWA 3QUVA 1Z6TA 4YQQA 2CWBA 2ZANA 4XGIA 2CHVA 4BB9A 1SG9A 3GLIB 2JY7A 4AG6A 4IIWA 1R2YA 3I51A 1QUTA 1HT1E 4NXNM 4YQCA 5EQTA 4DV6M 2CRUA 1V92A 2K6BA 2QZ4A 1NO1A 2EUCA 3K92A 1YE9A 3MJ5A 3PFIA 4GEWA 4MGIE 3F92A 3OIIA 2C96A 1QAMA 1X37A 4WURA 4G3OA 5FLXS 1ZAEA 4NL4H 1ORYB 5EP2A 1OIZA 2DAMA 3T1HM 2QBYA 3GPUA 4LJ4A 4ANRA 1L1ZA 1HJPA 2CUZA 3FRIA 3KS4A 1X7PA 3JR4A 3L2AA 2UXBM 3OINA 3NK7A 4Q7JA 1IXSA 5EXSA 4D80A 3U61B 1K3RA 2JUJA 3EIEA 3A98B 1BVSA 1KFVA 4X3LA 2FFJA 1N34M 4OVZA 2H1RA 4PZKA 1D0LA 4YQLA 4DR5M 2BJVA 5L8RF 3HWSA 4M9SA 1NS5A 2LHCA 4JI5M 1IN4A 3D8BA 4MGKE 5EXXA 1IBLM 1NY5A 4YQAA 4ZPXA 3E4RA 2UU9M 4LJ6A 1TR8A 3DCMX 2R4JA 1QUSA 3BOSA 2DI0A 3PVSA 3PNVA 3H4JA 2L4FA 1OAIA 2LNHC 3Q8XA 3DZDA 3QAUA 4GITA 3SHGB 2KXEA 2JA2A 2UUCM 2DWNA 2MJ5B 3VFDA 3K8ZA 2L09A 3LQRA 4M0WA 5LMNM 2R65A 3I04M 4FWDA 2CV2A 5KPRA 2NQ8C 3IECA 3WHKA 4DUYM 3R8FA 1HNZM 1VQ1A 1VEJA 4F1IA 1NY6A 1KSFX 2F5NA 1ZJRA 4L78A 2R45A 3HY5A 2XEPA 3FE3A 2CV0A 1AIPC 4YVGA 3FUUA 4JXJA 3T38A 4M0DA 1IBMM 4HEOA 1OFHA 3UGJA 3AJIB 3D8LA 3LVWA 1VDDA 1GKIA 1GL7A 4PDIA 1NXZA 3AOGA 2HAKA 3BBZA 3GLGE 4JAKA 4QOZC 1XNRM 1E9RA 2FE8A 3DA1A 4LY6A 1DGHA 2X49A 3W0LB 3VKGA 4RNAA 1WXQA 2HCBA 4L69A 2HKJA 3BXWA 1HQYE 3GLIA 4YQPA 2L7IA 2QQ8A 3L29A 3VLFB 1V2XA 1E9SA 1PRBA 1Q39A 2L2DA 1HR0M 4B3TM 3U6PA 1R6BX 3FTEA 2W82A 3U60A 1L2DA 4DR4M 4WW0A 3GQ5A 3U6SA 2I7NA 4IG6A 3OIJA 4X66M 3J2PB 2JY5A 1K3XA 3HHZA 4AW4A 2Y0TA 4JI1M 1WJ7A 2FH0A 3GRYA 2VF7A 3NWLA 4X64M 3FRHA 3U5ZA 1HNWM 2LWXA 4YQ0A 4L6V6 2QCUA 3LVVA 1XB2B 1QZMA 2H5XA 2CEAA 3U61A 1QDRA 3BBDA 2EGVA 3J7AS 2DAGA 3QYEA 5GMCA 2Z4SA 4B3RM 1Z85A 3FKEA 4GRIA 4RKUF 2I7PA 3DFZA 1J85A 2G3QA 4RF1A 1IPAA 1WGLA 1V6ZA 3GRVA 3K2LA 3SYLA 2DWMA 3EIHA 3HHWA 3MMPA 4IBCA 4MH0E 3SMPA 4R71A 5BR8M 3E21A 4II7A 1AUAA 3HGIA 1VG5A 3J7BA 2QP9X 1J7KA 1L8QA 3QWLA 4I8OA 4IBKA 4X65M 3GLGB 4LJ8A 2E5LM 1G8PA 3UMMA 4FW9A 3KTYA 2DZLA 3NK6A 1DGGA 1IN5A 2Z4RA 1WHCA 4YHHM 4FCWA 1G41A 1R2ZA 2GQFA 2Z0YA 3KSXA 2AHMA 2KHHA 5FTMA 4FMWA 4GHAA 3MK6A 4MCBA 1I94M 2YNMD 2WZJA 4MCDA 1MJGM 4Z6YA 2QENA 2X4AA 1K82A 2CE7A 2N35A 3W67A 4DBGB 3A46A 4KODA 4NXMM 4LJ7A 2KZSA 2DNAA 1YUBA 5GKNA 3KOWE 1IN7A 1L2CA 3U6LA 3BBEA 4LRTA 3HU2A 2XFTA 3KP0E 3THGA 1SXJC 4Z8XA 2O25A 5ITXE 2HWJA 5A2QS 4CNEA 2R6FA 4G4QA 4CNFA 2LH0A 4XBOA 3L27A 4DR3M 4UN2B 4L15A 2G5GX 2RGHA 4I81A 3TWKA 4AZFA 4MM3B 2R0IA 3SASA 5EP1A 2LBCA 2LVQD 1Z5CA 4YQGA 3DOAA 4B7FA 3GPXA 4B7HA 2QNJA 1NHWC 3LQQA 2DENA 3W0FA 1UALA 1IY1A 2EA0A 4H3YA 3KDSE 2XSZD 2V3KA 2JNHA 1ZMUA 3K9OA 4YPYA 1TH4A 4IJFA 4YQ2A 3I01M 2K0BX 3HHYA 5ITTA 1EE8A 3GLFA 1XXHE 4QOSA 4G4RA 4LJAA 4LG2A 1IY2A 4AKGA 1XMQM 4MGZE 2JXNA 2QSFX 5H37D 1JR3D 5E6JA 4LF9M 1NJFA 4JWFA 3K9PA 1RU3A 2CP8A 3L25A 2VF8A 3UK6A 3UJNA 1OY5A 3A42A 5KPZA 2EKKA 3B74A 2BNKA 3RGPA 2DZNB 3KFUG 3ZH9B 2LVAA 3SFZA 2QWVA 4DR1M 1IQPA 4L4UA 5ITUA 3FTDA 4NOOB 3VDUA 2DHYA 4DV0M 3LCUA 1C1KA 4FVMA 2Z3XA 2DWZB 4YQ8A 1QAOA 2XFSA 3CF2A 1UFZA 4LFBM 3T6PA 4L8RC 1QYRA 2KRUA 3GRUA 3GPPA 4JWGA 1O6DA 2DZOB 1IXRC 1PJQA 4JYAM 5FTKA 2ZM6M 1GL6A 1J09A 4LFCM 5FAIA 1SXJD 3HU3A 2LXEA 2ZAOA 4GH9A 4LFAM 3C9PA 5ITYA 4AG5A 2RRUA 1GJTA 2WSCF 2ERCA 3TL4X 1CUKA 2K47A 5JI3E 5LMUM 1QDTA 3TQSA 3KOXE 4G4OA 1L2BA 2R46A 3LW5F 2D7HA 1ZMVA 2ZAMA 5ITRA 2BJWA 1TTEA 1UM8A 1YLAA 1XNQM 3O7BA 1XC8A 2KW0A 1IN8A 4K0KM 2VDBB 4YVKA 3GLHA 4YQ7A 2QHOB 2LHGA 4GC9A 1OIPA 3I4VA 2MR9A 3A45A 2OPFA 4GC5A 4CNGA 4X3MA 2LTUA 4GIPA 4A3VB 4PD2A 3MHVC 3AFHA 4R3DA 1HNXM 4LJ9A 1XXHB 2MGWA 2X8AA 3C3EA 1ZQ9A 1X7OA 1MX0A 1S3SA 3NBIA 4HLQA 3KXEC 4JI4M 3KNUA 3IC6A 3AKZA 4QHTA 2HL7A 3HX3A 1FJGM 2QPAA 4B3SM 3J81S 2L6OA 2APLA 4CGYB 2UXDM 4DR6M 4PCZA 4GHLA 3GPYA 2Y21A 3KP1E 1Z5BA 1IBKM 2R18A 2L4EA 3N4KA 1T6OA 1TGUA 3RE8A 1OAOC 3GYQA 4IBDA 2CHGA 2D7GA 4B3MM 1D0KA 2Z8YM 1VEGA 2DAKA 1NV9A 2G8LA 2F5SA 4KLNA 3AL0C 1N33M 3KOZE 2CHQA 4MB7A 3J80S 2CX8A 1DGFA 4DR2M 2WSEF 5DYGA 2KEBA 4JI6M 3J27B 4JI8M 1JR3E 3TPZA 1OQYA 2C9OA 4NRWA 4KHPM 3HHXA 4DV3M 2KA6B 3SYKA 2OOBA 4I4LA 5EP3A 1HT2E 1N36M 3U6DA 1P9PA 3LMMA 1OFIA 1PJTA 4NSOB 5EP4A 5F3WA 1OTRA 2XH9A 1WR1B 4LCBA 4FCTA 4LZZA 3KY7A 2VQFM 4J3CA 2LVPC 4YQNA 3I4YA 2F4VM 2C99A 3TWLA 2F5OA 4JI7M 4JALA 3FYCA 1PJJA 3VKHA 4FWGA 1XHBA 1IXZA 4BBAA 3AOEA 5C18A 3B9PA 1Q02A 4CJ6A 4MGHA 4PDGA 3JR5A 2DXIA 1QZEA 1SXJE 3KW2A 3FTCA 4YQKA 4G6ZA 2KNZA 3CGWA 4OW0A 1IM2A 3SAUA 1UAMA 4YVHA 1IXSB 4I5SA 3VK8A 1OKSA 2DKLA 7CATA 1IN6A 3UZUA 4OVZB 2XZFA 3V76A 3ILKA 5FTJA 1LTMA 4G4NA 3M0EA 3HZJA 4P17A 1TO0A 4REZA 4YQRA 1QAQA 5CO4A 3WHLA 1GVNA 4R7GA 1PGYA 3HKPA 1KYIA 1HQCA 3K1JA 1E32A 3LCVB 1Y8GA 2LVNC 3TE6A 1NNUC 1EFUB 1Q3CA 2YQZA 4B08A 4IBEA 3JAMS 8CATA 5ITQA 4AKIA 3FYDA 1IY0A 3PNYA 4DV5M 2EGWA 4FWHA 4YQ5A 5E26A 1T43A 1E94E 3BBHA 1DO2A 2KRKA 4MCCA 3QYBA 1N77A 3KS8A 4OU7A 3FUTA 2FS1A 4YQ6A 4CISA 3GRRA 3SAVA 4GKJM 2C98A 2ZTCA 3E9SA 5KQDA 2OQ4A 4QNRA 3SATA 2LVOC 1UAKA 2QMMA 3SAWA 2Y0QA 1DGHB 2JY8A 4KO8A 4KT0F 1GJSA 4IBGA 3FUXA 3R9XB 1GZ0A 3SBJA 4AKHA 3B7ZA 4JI3M 4DV7M 1TDHA 1DV0A 1SXJB 1GABA 3GQ4A 4IBBA 3FTFA 1G4AE 2GNOA 1W5TA 2V1CA 4FD2A 1WIVA 4CNDA 3GLGA 3M6AA 4LZJA 4XK8F 5DFLA 3U60B 3SARA 1I4WA 3PXGA 1K3WA 2M5ZA 1N75A 1A5TA 1IFYA 1VDLA 3GO8A 3B7QA 3AOEC 4YQ3A 2KNVA 1V33A 5IT9S 1NVMA 3VK7A 4E8BA 4YQDA 2B3TA 4YVJA 3U5ZB 2XZUA 4LF4M 5C1BA 2YR0A 2DAIA 4YQ1A 2O3AA 3U6OA 1R4GA 1ZV1A 1D0MA 4FCVA 1QANA 2CFOA 2Z7JA 4D81A 4YQ4A 3C3DA 3W68A 5EXPA 1NHGC 3HJSA 1TDZA 4YQIA 2XSZA 3T15A 2JWSA 4QNMA 2C9CA 3ONPA 4IBFA 4DV1M 4H3ZA 3B7NA 4AI6A 1QQWA 1V34A 2J7NA 2XLJA 1JB0F 2R62A 1YSYA 3GLFE 3E5YA 1JR3A 2D7EA 2OO9A 2YFQA 3ZQJA 4CIZA 4JV5M 4CHTB 1NSFA 2JZ0A 2OOAA 2VQEM 3RGSA 2ZBKB 4F2LA 3OTOM 4YPZA 2BWBA 2I6DA 5FTLA 2EKFA 1TH2A 1P3QQ 2WSFF 2C5RA 2F5PA 4IBJA 1DO0A 1VEKA 2J7OA 4JN6A 1ZMWA 1PJIA 4GKKM 5IREB 4D82A 3GP1A 5GM8A 3E46A 3U6CA 4TUWA 2R44A 1R7RA 4PT5A 4LRSA 4B7GA 4YY3M 4S12A 2M60A 1XMOM 3KSJA 5DYIA 2VIIA 3TWMA 4DR7M 2HHHM 2DHRA 2L7HA 2J5YA 5FTNA 3RFWA 3C58A 2K9DA 2XF3A 2YY8A 2O01F 5BPVA 4JI0M 2FNAA 2A5YB 3CF0A 4L16A 5KQ8A 4LF8M 3H4MA 2DVWB 3N4JA 2O5RA 4NSRA 1SXJA 1Z59A 2XGNA 4EIWA 2RGOA 3L28A 2JY6B 3SMSA 2CV1A 4LF6M 4YQTA 1TF0B 3AXZA 2V1UA 2KDLA 5IZ7D 2V3JA
chains in the Genus database with same CATH topology
3U6MA 4MGYE 4LGYA 3U6EA 4M9XA 3HJ8A 3HJQA 4P16A 3IG5A 4X62M 4NRVA 3FUVA 1PM5A 5ITXA 5IWAM 5EXTA 4LF5M 1VH0A 1D2NA 3CTWB 2UXCM 3AIAA 4M9ZA 4AQYM 4LJ5A 3GLFB 2UUAM 4JWJA 1UAJA 1T3TA 3M7GA 3CF6E 3IEFA 1VHYA 3AI9X 1J5EM 3L8UA 1G3IA 2QBYB 1H6UA 3SHFA 4OX9M 4KDZA 4IJEA 3ZC7B 4DV2M 1W5SA 1FNNA 4GMQA 1VHKA 4BLCA 3T1YM 2RKOA 1MXIA 2F5QA 1TH3A 5EJCA 4KGNA 4IBIA 1XXHA 3KW6A 4W5WA 2Y20A 1QVRA 3VDPA 2UUBM 3KOYE 1NNJA 5KPTA 4LGMA 3AV0A 4YQJA 3FD9A 3HU1A 1NJGA 4YQ9A 2KZUA 2Q2EB 4YQOA 1Z5AA 3FUWA 4ITQA 2DWLA 3SC3A 4DUZM 1Q3BA 5D9FA 5KO3A 4YQSA 4RG1A 3U6QA 1N78A 5GMBA 2P5TA 5JI2E 1JQJC 2EO2A 2V6ZM 5FSWA 3GQ3A 4YVIA 1N32M 4HL4A 1G59A 4LF7M 5DNYA 4YPXA 1MU5A 1XWIA 4QHSA 4DV4M 1DGBA 4YQBA 3GLHB 2HA8A 4RF0A 3L26A 2FOIC 4JI2M 4YPWA 4FAKA 1GLNA 2R4EA 1LV7A 1OJLA 4JWHA 3ZCBB 3IG8A 3KVWA 4YQQA 3QUVA 1Z6TA 2ZANA 4BB9A 4XGIA 2CHVA 3GLIB 4AG6A 1R2YA 4IIWA 3I51A 1HT1E 4NXNM 4YQCA 5EQTA 4DV6M 2QZ4A 2EUCA 3K92A 3MJ5A 1YE9A 3PFIA 4MGIE 3OIIA 2C96A 1QAMA 1X37A 4WURA 5FLXS 1ZAEA 4NL4H 1ORYB 5EP2A 3T1HM 2QBYA 3GPUA 4LJ4A 1L1ZA 2CUZA 3KS4A 1X7PA 3JR4A 3L2AA 2UXBM 3OINA 3NK7A 5EXSA 4D80A 3U61B 1K3RA 3EIEA 3A98B 1KFVA 4X3LA 2FFJA 1N34M 4OVZA 2H1RA 4PZKA 4YQLA 4DR5M 2BJVA 3HWSA 4M9SA 1NS5A 4JI5M 1IN4A 3D8BA 4MGKE 5EXXA 1IBLM 1NY5A 4YQAA 4ZPXA 3E4RA 2UU9M 4LJ6A 3DCMX 2R4JA 3BOSA 3PVSA 3PNVA 3Q8XA 2LNHC 4GITA 3SHGB 2UUCM 3DZDA 3QAUA 2KXEA 2JA2A 2DWNA 3VFDA 3K8ZA 2L09A 3LQRA 4M0WA 5LMNM 2R65A 2CV2A 4FWDA 5KPRA 2NQ8C 3WHKA 3R8FA 4DUYM 1HNZM 1NY6A 1KSFX 2F5NA 1ZJRA 4L78A 2R45A 2XEPA 2CV0A 4YVGA 3FUUA 4JXJA 3T38A 4M0DA 1IBMM 1OFHA 3UGJA 3AJIB 3D8LA 3LVWA 1VDDA 1GKIA 1GL7A 4PDIA 1NXZA 3AOGA 4JAKA 4QOZC 1XNRM 1E9RA 2FE8A 3DA1A 4LY6A 1DGHA 2X49A 3W0LB 3VKGA 4RNAA 1WXQA 2HCBA 4L69A 2HKJA 3GLIA 1HQYE 4YQPA 2L7IA 3VLFB 3L29A 1V2XA 1E9SA 1Q39A 1HR0M 4B3TM 3U6PA 1R6BX 3FTEA 2W82A 3U60A 1L2DA 4DR4M 4WW0A 3GQ5A 3U6SA 2I7NA 4IG6A 3OIJA 4X66M 3J2PB 1K3XA 3HHZA 4AW4A 2Y0TA 4JI1M 3GRYA 3NWLA 4X64M 1HNWM 3U5ZA 2LWXA 4YQ0A 2QCUA 3LVVA 3BBDA 1QZMA 2CEAA 3U61A 2EGVA 3J7AS 5GMCA 2Z4SA 4B3RM 1Z85A 3FKEA 4GRIA 2I7PA 3DFZA 1J85A 4RF1A 1IPAA 1V6ZA 3GRVA 3K2LA 3SYLA 2DWMA 3EIHA 3HHWA 4IBCA 4MH0E 3SMPA 5BR8M 4II7A 3QWLA 3HGIA 3J7BA 2HHHM 2QP9X 1J7KA 1L8QA 4X65M 4I8OA 4IBKA 3GLGB 2E5LM 4LJ8A 3GYQA 1G8PA 3UMMA 4FW9A 3KTYA 3NK6A 1DGGA 1IN5A 2Z4RA 4YHHM 4FCWA 1G41A 1R2ZA 2Z0YA 3KSXA 2AHMA 5FTMA 4FMWA 4GHAA 3MK6A 4MCBA 1I94M 2YNMD 4MCDA 4Z6YA 2QENA 2X4AA 1K82A 2CE7A 3A46A 4KODA 4NXMM 4LJ7A 2KZSA 1YUBA 5GKNA 3KOWE 1IN7A 1L2CA 3U6LA 3BBEA 4LRTA 3HU2A 2XFTA 3KP0E 3THGA 1SXJC 4Z8XA 5ITXE 5A2QS 4CNEA 4G4QA 4CNFA 2LH0A 4XBOA 3L27A 4DR3M 4L15A 2G5GX 2RGHA 4I81A 3TWKA 4AZFA 4MM3B 3SASA 5EP1A 4YQGA 1Z5CA 3DOAA 4B7FA 3GPXA 4B7HA 1NHWC 3LQQA 1UALA 3W0FA 1IY1A 2EA0A 4H3YA 3KDSE 2XSZD 2V3KA 4YPYA 1TH4A 4IJFA 4YQ2A 3HHYA 3GLFA 4G4RA 5ITTA 1EE8A 4AKGA 4QOSA 2YY8A 4LJAA 4LG2A 1IY2A 1XMQM 4MGZE 5H37D 1JR3D 5E6JA 4LF9M 1NJFA 4JWFA 3L25A 3UK6A 3UJNA 1OY5A 3A42A 5KPZA 2BNKA 3RGPA 2DZNB 3ZH9B 3SFZA 2QWVA 4DR1M 1IQPA 4L4UA 5ITUA 3FTDA 4NOOB 3VDUA 4DV0M 4FVMA 1C1KA 2Z3XA 2DWZB 4YQ8A 1QAOA 2XFSA 3CF2A 4LFBM 4L8RC 1QYRA 2KRUA 3GRUA 3GPPA 4JWGA 1O6DA 2DZOB 1IXRC 4JYAM 5FTKA 2ZM6M 1GL6A 1J09A 4LFCM 5FAIA 1SXJD 3HU3A 2LXEA 2ZAOA 4GH9A 4LFAM 5ITYA 4AG5A 5JI3E 3TL4X 1L1TA 2ERCA 3KFUG 2K47A 5LMUM 3TQSA 3KOXE 4G4OA 1L2BA 2R46A 2D7HA 2ZAMA 5ITRA 2BJWA 1UM8A 1XNQM 3O7BA 1XC8A 2KW0A 1IN8A 4K0KM 4YVKA 3GLHA 4YQ7A 4GC9A 3I4VA 2OPFA 3A45A 4CNGA 4GC5A 4X3MA 4GIPA 4A3VB 4PD2A 3MHVC 3AFHA 4R3DA 1HNXM 4LJ9A 1XXHB 2X8AA 1ZQ9A 1X7OA 1MX0A 1S3SA 3NBIA 4HLQA 3KXEC 4JI4M 3KNUA 3IC6A 3AKZA 4QHTA 2HL7A 1FJGM 2QPAA 4B3SM 3J81S 2L6OA 4CGYB 2UXDM 4DR6M 4PCZA 4GHLA 3GPYA 2Y21A 3KP1E 1Z5BA 1IBKM 2R18A 3N4KA 1TGUA 3RE8A 4IBDA 2CHGA 2D7GA 4B3MM 1N33M 2G8LA 2F5SA 4KLNA 3AL0C 3KOZE 2CHQA 4MB7A 3J80S 2CX8A 1DGFA 4DR2M 5DYGA 2KEBA 4JI6M 3J27B 4JI8M 3TPZA 2C9OA 4NRWA 4KHPM 3HHXA 4DV3M 2KA6B 3SYKA 5EP3A 4I4LA 1N36M 1HT2E 1P9PA 3U6DA 3LMMA 1OFIA 4NSOB 5EP4A 5F3WA 2XH9A 4LCBA 4FCTA 4LZZA 3KY7A 2VQFM 4J3CA 4YQNA 3I4YA 2F4VM 2C99A 3TWLA 2F5OA 4JI7M 4JALA 3FYCA 1PJJA 3VKHA 4FWGA 1XHBA 1IXZA 4BBAA 3AOEA 5C18A 3B9PA 4PDGA 4MGHA 3JR5A 2DXIA 1SXJE 3KW2A 3FTCA 4YQKA 4G6ZA 4OW0A 1IM2A 3SAUA 1UAMA 4YVHA 1IXSB 4I5SA 3VK8A 7CATA 1IN6A 3UZUA 4OVZB 2XZFA 3ILKA 5FTJA 4G4NA 3M0EA 4YQRA 1TO0A 4REZA 1QAQA 5CO4A 3WHLA 1GVNA 4R7GA 3HKPA 1KYIA 1HQCA 3K1JA 1E32A 3TE6A 1NNUC 2YQZA 1Q3CA 4B08A 4IBEA 3JAMS 8CATA 5ITQA 4AKIA 3FYDA 1IY0A 3PNYA 4DV5M 2EGWA 4FWHA 4YQ5A 5E26A 1E94E 3BBHA 1DO2A 2KRKA 4MCCA 1N77A 3KS8A 4OU7A 3FUTA 4YQ6A 4CISA 3GRRA 3SAVA 4GKJM 2C98A 3E9SA 5KQDA 2OQ4A 4QNRA 3SATA 1UAKA 2QMMA 3SAWA 2Y0QA 1DGHB 1GZ0A 4KO8A 4IBGA 3FUXA 3R9XB 3SBJA 4AKHA 4JI3M 4DV7M 1TDHA 1SXJB 3GQ4A 4IBBA 3FTFA 1G4AE 1W5TA 2V1CA 4FD2A 4CNDA 3GLGA 3M6AA 4LZJA 3U60B 3SARA 1I4WA 3PXGA 1K3WA 2M5ZA 1N75A 3GO8A 3AOEC 4YQ3A 5IT9S 1NVMA 3VK7A 4E8BA 4YQDA 4YVJA 3U5ZB 2XZUA 4LF4M 5C1BA 2YR0A 4YQ1A 2O3AA 3U6OA 4FCVA 1QANA 2CFOA 2Z7JA 4D81A 4YQ4A 5EXPA 1NHGC 3HJSA 1TDZA 4YQIA 2XSZA 3T15A 4QNMA 2C9CA 3ONPA 4IBFA 4DV1M 4H3ZA 4AI6A 1QQWA 2J7NA 2XLJA 2R62A 1YSYA 3E5YA 1JR3A 2D7EA 4JV5M 2YFQA 4CHTB 1NSFA 2VQEM 3RGSA 2ZBKB 3OTOM 4YPZA 2I6DA 5FTLA 1TH2A 2F5PA 2C5RA 4IBJA 1DO0A 2J7OA 4JN6A 1PJIA 4GKKM 5IREB 4D82A 3GP1A 5GM8A 3U6CA 4TUWA 1R7RA 4PT5A 4LRSA 4B7GA 4YY3M 4S12A 2M60A 1XMOM 3KSJA 5DYIA 2VIIA 3TWMA 4DR7M 2DHRA 2L7HA 5FTNA 3RFWA 3C58A 2XF3A 5BPVA 4JI0M 2FNAA 2A5YB 3CF0A 4L16A 5KQ8A 4LF8M 3H4MA 2DVWB 3N4JA 2O5RA 4NSRA 1SXJA 1Z59A 2XGNA 4EIWA 2RGOA 3L28A 3SMSA 2CV1A 4LF6M 4YQTA 3AXZA 2V1UA 5IZ7D 2V3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ILK A;  1ZJR A;  4YQR A;  1TO0 A;  1OY5 A;  5CO4 A;  4YVG A;  1VH0 A;  2QWV A;  3AIA A;  4JAK A;  1NXZ A;  2EGW A;  1UAJ A;  3IEF A;  4YQ5 A;  1VHY A;  3AI9 X;  3L8U A;  4YQ8 A;  3BBH A;  4MCC A;  4KDZ A;  4L69 A;  4YQP A;  1O6D A;  1VHK A;  1V2X A;  1MXI A;  5FAI A;  4CNF A;  4KGN A;  4YQ6 A;  1UAK A;  4IG6 A;  3OIJ A;  2QMM A;  4YQJ A;  1GZ0 A;  3O7B A;  4YQ9 A;  4YQO A;  4YVK A;  4YQ7 A;  4CNG A;  4X3M A;  4YQ0 A;  4CND A;  3BBD A;  5D9F A;  2EGV A;  1X7O A;  4RG1 A;  4YQS A;  5GMC A;  3KNU A;  1Z85 A;  5GMB A;  4YVI A;  3IC6 A;  1J85 A;  4YPX A;  4YQ3 A;  1IPA A;  1V6Z A;  4YQB A;  4E8B A;  2HA8 A;  4YQD A;  4YVJ A;  3N4K A;  4YPW A;  4FAK A;  4YQ1 A;  2O3A A;  3GYQ A;  3KTY A;  3NK6 A;  4YQQ A;  3QUV A;  4YQ4 A;  4YQI A;  2Z0Y A;  4YQC A;  2CX8 A;  4MCB A;  4MCD A;  3ONP A;  4H3Z A;  3OII A;  3E5Y A;  4YPZ A;  1P9P A;  2I6D A;  3BBE A;  1X7P A;  5GM8 A;  4CNE A;  3KY7 A;  3OIN A;  3NK7 A;  4J3C A;  4XBO A;  4YQN A;  1K3R A;  4X3L A;  4PZK A;  4JAL A;  4YQL A;  1NS5 A;  4YQG A;  3N4J A;  4YQA A;  3KW2 A;  1UAL A;  4YQK A;  4YQT A;  3DCM X;  2V3K A;  4H3Y A;  4YPY A;  3AXZ A;  4YVH A;  1UAM A;  4YQ2 A;  2YY8 A;  2V3J A; 
#chains in the Genus database with same CATH topology
 3U6M A;  4MGY E;  4LGY A;  3U6E A;  4M9X A;  3HJ8 A;  3HJQ A;  4P16 A;  3IG5 A;  4X62 M;  2JP7 A;  3FUV A;  4NRV A;  5ITX A;  5IWA M;  1PM5 A;  5EXT A;  4LF5 M;  1NV8 A;  1L1T A;  1VH0 A;  1D2N A;  3GLH E;  3CTW B;  2UXC M;  3AIA A;  3B89 A;  4M9Z A;  3NBX X;  4AQY M;  4LJ5 A;  3GLF B;  1F4I A;  2UUA M;  4JWJ A;  1UAJ A;  1T3T A;  3M7G A;  3CF6 E;  3IEF A;  2MRO B;  1VHY A;  3AI9 X;  1J5E M;  1GO5 A;  3L8U A;  1G3I A;  2QBY B;  1H6U A;  3SHF A;  4OX9 M;  3GLI E;  4KDZ A;  1PJS A;  4IJE A;  3ZC7 B;  4DV2 M;  1W5S A;  1FNN A;  2ZTD A;  4GMQ A;  4BLC A;  1VHK A;  3T1Y M;  2RKO A;  1MXI A;  2F5Q A;  1TH3 A;  5EJC A;  1C7Y A;  4KGN A;  4IBI A;  1XXH A;  3KW6 A;  4W5W A;  2Y20 A;  1QVR A;  3VDP A;  4Y28 F;  2UUB M;  3IHP A;  4NC6 A;  3KOY E;  1NNJ A;  5KPT A;  4LGM A;  3AV0 A;  4YQJ A;  3FD9 A;  3HU1 A;  1NJG A;  4YQ9 A;  2KZU A;  1G71 A;  2Q2E B;  4YQO A;  1Z5A A;  3FUW A;  4ITQ A;  2DWL A;  4WP2 A;  3SC3 A;  1R5L A;  1WGN A;  4DUZ M;  1Q3B A;  5D9F A;  5KO3 A;  4YQS A;  4RG1 A;  3U6Q A;  1N78 A;  5GMB A;  2P5T A;  5JI2 E;  1JQJ C;  2EO2 A;  2V6Z M;  5FSW A;  3GQ3 A;  4YVI A;  1N32 M;  2EJS A;  4HL4 A;  1G59 A;  4LF7 M;  2BWE A;  5DNY A;  4YPX A;  1MU5 A;  1XWI A;  4QHS A;  4DV4 M;  1EIJ A;  1DGB A;  4YQB A;  2DAE A;  3GLH B;  2HA8 A;  4RF0 A;  3L26 A;  3Q8G A;  1MN3 A;  2FOI C;  2KNA A;  4JI2 M;  4YPW A;  4FAK A;  1GLN A;  2R4E A;  1LV7 A;  1OJL A;  4JWH A;  3ZCB B;  3IG8 A;  2MH8 A;  2JZ1 A;  3KVW A;  3QUV A;  1Z6T A;  4YQQ A;  2CWB A;  2ZAN A;  4XGI A;  2CHV A;  4BB9 A;  1SG9 A;  3GLI B;  2JY7 A;  4AG6 A;  4IIW A;  1R2Y A;  3I51 A;  1QUT A;  1HT1 E;  4NXN M;  4YQC A;  5EQT A;  4DV6 M;  2CRU A;  1V92 A;  2K6B A;  2QZ4 A;  1NO1 A;  2EUC A;  3K92 A;  1YE9 A;  3MJ5 A;  3PFI A;  4GEW A;  4MGI E;  3F92 A;  3OII A;  2C96 A;  1QAM A;  1X37 A;  4WUR A;  4G3O A;  5FLX S;  1ZAE A;  4NL4 H;  1ORY B;  5EP2 A;  1OIZ A;  2DAM A;  3T1H M;  2QBY A;  3GPU A;  4LJ4 A;  4ANR A;  1L1Z A;  1HJP A;  2CUZ A;  3FRI A;  3KS4 A;  1X7P A;  3JR4 A;  3L2A A;  2UXB M;  3OIN A;  3NK7 A;  4Q7J A;  1IXS A;  5EXS A;  4D80 A;  3U61 B;  1K3R A;  2JUJ A;  3EIE A;  3A98 B;  1BVS A;  1KFV A;  4X3L A;  2FFJ A;  1N34 M;  4OVZ A;  2H1R A;  4PZK A;  1D0L A;  4YQL A;  4DR5 M;  2BJV A;  5L8R F;  3HWS A;  4M9S A;  1NS5 A;  2LHC A;  4JI5 M;  1IN4 A;  3D8B A;  4MGK E;  5EXX A;  1IBL M;  1NY5 A;  4YQA A;  4ZPX A;  3E4R A;  2UU9 M;  4LJ6 A;  1TR8 A;  3DCM X;  2R4J A;  1QUS A;  3BOS A;  2DI0 A;  3PVS A;  3PNV A;  3H4J A;  2L4F A;  1OAI A;  2LNH C;  3Q8X A;  3DZD A;  3QAU A;  4GIT A;  3SHG B;  2KXE A;  2JA2 A;  2UUC M;  2DWN A;  2MJ5 B;  3VFD A;  3K8Z A;  2L09 A;  3LQR A;  4M0W A;  5LMN M;  2R65 A;  3I04 M;  4FWD A;  2CV2 A;  5KPR A;  2NQ8 C;  3IEC A;  3WHK A;  4DUY M;  3R8F A;  1HNZ M;  1VQ1 A;  1VEJ A;  4F1I A;  1NY6 A;  1KSF X;  2F5N A;  1ZJR A;  4L78 A;  2R45 A;  3HY5 A;  2XEP A;  3FE3 A;  2CV0 A;  1AIP C;  4YVG A;  3FUU A;  4JXJ A;  3T38 A;  4M0D A;  1IBM M;  4HEO A;  1OFH A;  3UGJ A;  3AJI B;  3D8L A;  3LVW A;  1VDD A;  1GKI A;  1GL7 A;  4PDI A;  1NXZ A;  3AOG A;  2HAK A;  3BBZ A;  3GLG E;  4JAK A;  4QOZ C;  1XNR M;  1E9R A;  2FE8 A;  3DA1 A;  4LY6 A;  1DGH A;  2X49 A;  3W0L B;  3VKG A;  4RNA A;  1WXQ A;  2HCB A;  4L69 A;  2HKJ A;  3BXW A;  1HQY E;  3GLI A;  4YQP A;  2L7I A;  2QQ8 A;  3L29 A;  3VLF B;  1V2X A;  1E9S A;  1PRB A;  1Q39 A;  2L2D A;  1HR0 M;  4B3T M;  3U6P A;  1R6B X;  3FTE A;  2W82 A;  3U60 A;  1L2D A;  4DR4 M;  4WW0 A;  3GQ5 A;  3U6S A;  2I7N A;  4IG6 A;  3OIJ A;  4X66 M;  3J2P B;  2JY5 A;  1K3X A;  3HHZ A;  4AW4 A;  2Y0T A;  4JI1 M;  1WJ7 A;  2FH0 A;  3GRY A;  2VF7 A;  3NWL A;  4X64 M;  3FRH A;  3U5Z A;  1HNW M;  2LWX A;  4YQ0 A;  4L6V 6;  2QCU A;  3LVV A;  1XB2 B;  1QZM A;  2H5X A;  2CEA A;  3U61 A;  1QDR A;  3BBD A;  2EGV A;  3J7A S;  2DAG A;  3QYE A;  5GMC A;  2Z4S A;  4B3R M;  1Z85 A;  3FKE A;  4GRI A;  4RKU F;  2I7P A;  3DFZ A;  1J85 A;  2G3Q A;  4RF1 A;  1IPA A;  1WGL A;  1V6Z A;  3GRV A;  3K2L A;  3SYL A;  2DWM A;  3EIH A;  3HHW A;  3MMP A;  4IBC A;  4MH0 E;  3SMP A;  4R71 A;  5BR8 M;  3E21 A;  4II7 A;  1AUA A;  3HGI A;  1VG5 A;  3J7B A;  2QP9 X;  1J7K A;  1L8Q A;  3QWL A;  4I8O A;  4IBK A;  4X65 M;  3GLG B;  4LJ8 A;  2E5L M;  1G8P A;  3UMM A;  4FW9 A;  3KTY A;  2DZL A;  3NK6 A;  1DGG A;  1IN5 A;  2Z4R A;  1WHC A;  4YHH M;  4FCW A;  1G41 A;  1R2Z A;  2GQF A;  2Z0Y A;  3KSX A;  2AHM A;  2KHH A;  5FTM A;  4FMW A;  4GHA A;  3MK6 A;  4MCB A;  1I94 M;  2YNM D;  2WZJ A;  4MCD A;  1MJG M;  4Z6Y A;  2QEN A;  2X4A A;  1K82 A;  2CE7 A;  2N35 A;  3W67 A;  4DBG B;  3A46 A;  4KOD A;  4NXM M;  4LJ7 A;  2KZS A;  2DNA A;  1YUB A;  5GKN A;  3KOW E;  1IN7 A;  1L2C A;  3U6L A;  3BBE A;  4LRT A;  3HU2 A;  2XFT A;  3KP0 E;  3THG A;  1SXJ C;  4Z8X A;  2O25 A;  5ITX E;  2HWJ A;  5A2Q S;  4CNE A;  2R6F A;  4G4Q A;  4CNF A;  2LH0 A;  4XBO A;  3L27 A;  4DR3 M;  4UN2 B;  4L15 A;  2G5G X;  2RGH A;  4I81 A;  3TWK A;  4AZF A;  4MM3 B;  2R0I A;  3SAS A;  5EP1 A;  2LBC A;  2LVQ D;  1Z5C A;  4YQG A;  3DOA A;  4B7F A;  3GPX A;  4B7H A;  2QNJ A;  1NHW C;  3LQQ A;  2DEN A;  3W0F A;  1UAL A;  1IY1 A;  2EA0 A;  4H3Y A;  3KDS E;  2XSZ D;  2V3K A;  2JNH A;  1ZMU A;  3K9O A;  4YPY A;  1TH4 A;  4IJF A;  4YQ2 A;  3I01 M;  2K0B X;  3HHY A;  5ITT A;  1EE8 A;  3GLF A;  1XXH E;  4QOS A;  4G4R A;  4LJA A;  4LG2 A;  1IY2 A;  4AKG A;  1XMQ M;  4MGZ E;  2JXN A;  2QSF X;  5H37 D;  1JR3 D;  5E6J A;  4LF9 M;  1NJF A;  4JWF A;  3K9P A;  1RU3 A;  2CP8 A;  3L25 A;  2VF8 A;  3UK6 A;  3UJN A;  1OY5 A;  3A42 A;  5KPZ A;  2EKK A;  3B74 A;  2BNK A;  3RGP A;  2DZN B;  3KFU G;  3ZH9 B;  2LVA A;  3SFZ A;  2QWV A;  4DR1 M;  1IQP A;  4L4U A;  5ITU A;  3FTD A;  4NOO B;  3VDU A;  2DHY A;  4DV0 M;  3LCU A;  1C1K A;  4FVM A;  2Z3X A;  2DWZ B;  4YQ8 A;  1QAO A;  2XFS A;  3CF2 A;  1UFZ A;  4LFB M;  3T6P A;  4L8R C;  1QYR A;  2KRU A;  3GRU A;  3GPP A;  4JWG A;  1O6D A;  2DZO B;  1IXR C;  1PJQ A;  4JYA M;  5FTK A;  2ZM6 M;  1GL6 A;  1J09 A;  4LFC M;  5FAI A;  1SXJ D;  3HU3 A;  2LXE A;  2ZAO A;  4GH9 A;  4LFA M;  3C9P A;  5ITY A;  4AG5 A;  2RRU A;  1GJT A;  2WSC F;  2ERC A;  3TL4 X;  1CUK A;  2K47 A;  5JI3 E;  5LMU M;  1QDT A;  3TQS A;  3KOX E;  4G4O A;  1L2B A;  2R46 A;  3LW5 F;  2D7H A;  1ZMV A;  2ZAM A;  5ITR A;  2BJW A;  1TTE A;  1UM8 A;  1YLA A;  1XNQ M;  3O7B A;  1XC8 A;  2KW0 A;  1IN8 A;  4K0K M;  2VDB B;  4YVK A;  3GLH A;  4YQ7 A;  2QHO B;  2LHG A;  4GC9 A;  1OIP A;  3I4V A;  2MR9 A;  3A45 A;  2OPF A;  4GC5 A;  4CNG A;  4X3M A;  2LTU A;  4GIP A;  4A3V B;  4PD2 A;  3MHV C;  3AFH A;  4R3D A;  1HNX M;  4LJ9 A;  1XXH B;  2MGW A;  2X8A A;  3C3E A;  1ZQ9 A;  1X7O A;  1MX0 A;  1S3S A;  3NBI A;  4HLQ A;  3KXE C;  4JI4 M;  3KNU A;  3IC6 A;  3AKZ A;  4QHT A;  2HL7 A;  3HX3 A;  1FJG M;  2QPA A;  4B3S M;  3J81 S;  2L6O A;  2APL A;  4CGY B;  2UXD M;  4DR6 M;  4PCZ A;  4GHL A;  3GPY A;  2Y21 A;  3KP1 E;  1Z5B A;  1IBK M;  2R18 A;  2L4E A;  3N4K A;  1T6O A;  1TGU A;  3RE8 A;  1OAO C;  3GYQ A;  4IBD A;  2CHG A;  2D7G A;  4B3M M;  1D0K A;  2Z8Y M;  1VEG A;  2DAK A;  1NV9 A;  2G8L A;  2F5S A;  4KLN A;  3AL0 C;  1N33 M;  3KOZ E;  2CHQ A;  4MB7 A;  3J80 S;  2CX8 A;  1DGF A;  4DR2 M;  2WSE F;  5DYG A;  2KEB A;  4JI6 M;  3J27 B;  4JI8 M;  1JR3 E;  3TPZ A;  1OQY A;  2C9O A;  4NRW A;  4KHP M;  3HHX A;  4DV3 M;  2KA6 B;  3SYK A;  2OOB A;  4I4L A;  5EP3 A;  1HT2 E;  1N36 M;  3U6D A;  1P9P A;  3LMM A;  1OFI A;  1PJT A;  4NSO B;  5EP4 A;  5F3W A;  1OTR A;  2XH9 A;  1WR1 B;  4LCB A;  4FCT A;  4LZZ A;  3KY7 A;  2VQF M;  4J3C A;  2LVP C;  4YQN A;  3I4Y A;  2F4V M;  2C99 A;  3TWL A;  2F5O A;  4JI7 M;  4JAL A;  3FYC A;  1PJJ A;  3VKH A;  4FWG A;  1XHB A;  1IXZ A;  4BBA A;  3AOE A;  5C18 A;  3B9P A;  1Q02 A;  4CJ6 A;  4MGH A;  4PDG A;  3JR5 A;  2DXI A;  1QZE A;  1SXJ E;  3KW2 A;  3FTC A;  4YQK A;  4G6Z A;  2KNZ A;  3CGW A;  4OW0 A;  1IM2 A;  3SAU A;  1UAM A;  4YVH A;  1IXS B;  4I5S A;  3VK8 A;  1OKS A;  2DKL A;  7CAT A;  1IN6 A;  3UZU A;  4OVZ B;  2XZF A;  3V76 A;  3ILK A;  5FTJ A;  1LTM A;  4G4N A;  3M0E A;  3HZJ A;  4P17 A;  1TO0 A;  4REZ A;  4YQR A;  1QAQ A;  5CO4 A;  3WHL A;  1GVN A;  4R7G A;  1PGY A;  3HKP A;  1KYI A;  1HQC A;  3K1J A;  1E32 A;  3LCV B;  1Y8G A;  2LVN C;  3TE6 A;  1NNU C;  1EFU B;  1Q3C A;  2YQZ A;  4B08 A;  4IBE A;  3JAM S;  8CAT A;  5ITQ A;  4AKI A;  3FYD A;  1IY0 A;  3PNY A;  4DV5 M;  2EGW A;  4FWH A;  4YQ5 A;  5E26 A;  1T43 A;  1E94 E;  3BBH A;  1DO2 A;  2KRK A;  4MCC A;  3QYB A;  1N77 A;  3KS8 A;  4OU7 A;  3FUT A;  2FS1 A;  4YQ6 A;  4CIS A;  3GRR A;  3SAV A;  4GKJ M;  2C98 A;  2ZTC A;  3E9S A;  5KQD A;  2OQ4 A;  4QNR A;  3SAT A;  2LVO C;  1UAK A;  2QMM A;  3SAW A;  2Y0Q A;  1DGH B;  2JY8 A;  4KO8 A;  4KT0 F;  1GJS A;  4IBG A;  3FUX A;  3R9X B;  1GZ0 A;  3SBJ A;  4AKH A;  3B7Z A;  4JI3 M;  4DV7 M;  1TDH A;  1DV0 A;  1SXJ B;  1GAB A;  3GQ4 A;  4IBB A;  3FTF A;  1G4A E;  2GNO A;  1W5T A;  2V1C A;  4FD2 A;  1WIV A;  4CND A;  3GLG A;  3M6A A;  4LZJ A;  4XK8 F;  5DFL A;  3U60 B;  3SAR A;  1I4W A;  3PXG A;  1K3W A;  2M5Z A;  1N75 A;  1A5T A;  1IFY A;  1VDL A;  3GO8 A;  3B7Q A;  3AOE C;  4YQ3 A;  2KNV A;  1V33 A;  5IT9 S;  1NVM A;  3VK7 A;  4E8B A;  4YQD A;  2B3T A;  4YVJ A;  3U5Z B;  2XZU A;  4LF4 M;  5C1B A;  2YR0 A;  2DAI A;  4YQ1 A;  2O3A A;  3U6O A;  1R4G A;  1ZV1 A;  1D0M A;  4FCV A;  1QAN A;  2CFO A;  2Z7J A;  4D81 A;  4YQ4 A;  3C3D A;  3W68 A;  5EXP A;  1NHG C;  3HJS A;  1TDZ A;  4YQI A;  2XSZ A;  3T15 A;  2JWS A;  4QNM A;  2C9C A;  3ONP A;  4IBF A;  4DV1 M;  4H3Z A;  3B7N A;  4AI6 A;  1QQW A;  1V34 A;  2J7N A;  2XLJ A;  1JB0 F;  2R62 A;  1YSY A;  3GLF E;  3E5Y A;  1JR3 A;  2D7E A;  2OO9 A;  2YFQ A;  3ZQJ A;  4CIZ A;  4JV5 M;  4CHT B;  1NSF A;  2JZ0 A;  2OOA A;  2VQE M;  3RGS A;  2ZBK B;  4F2L A;  3OTO M;  4YPZ A;  2BWB A;  2I6D A;  5FTL A;  2EKF A;  1TH2 A;  1P3Q Q;  2WSF F;  2C5R A;  2F5P A;  4IBJ A;  1DO0 A;  1VEK A;  2J7O A;  4JN6 A;  1ZMW A;  1PJI A;  4GKK M;  5IRE B;  4D82 A;  3GP1 A;  5GM8 A;  3E46 A;  3U6C A;  4TUW A;  2R44 A;  1R7R A;  4PT5 A;  4LRS A;  4B7G A;  4YY3 M;  4S12 A;  2M60 A;  1XMO M;  3KSJ A;  5DYI A;  2VII A;  3TWM A;  4DR7 M;  2HHH M;  2DHR A;  2L7H A;  2J5Y A;  5FTN A;  3RFW A;  3C58 A;  2K9D A;  2XF3 A;  2YY8 A;  2O01 F;  5BPV A;  4JI0 M;  2FNA A;  2A5Y B;  3CF0 A;  4L16 A;  5KQ8 A;  4LF8 M;  3H4M A;  2DVW B;  3N4J A;  2O5R A;  4NSR A;  1SXJ A;  1Z59 A;  2XGN A;  4EIW A;  2RGO A;  3L28 A;  2JY6 B;  3SMS A;  2CV1 A;  4LF6 M;  4YQT A;  1TF0 B;  3AXZ A;  2V1U A;  2KDL A;  5IZ7 D;  2V3J A; 
#chains in the Genus database with same CATH homology
 3U6M A;  4MGY E;  4LGY A;  3U6E A;  4M9X A;  3HJ8 A;  3HJQ A;  4P16 A;  3IG5 A;  4X62 M;  4NRV A;  3FUV A;  1PM5 A;  5ITX A;  5IWA M;  5EXT A;  4LF5 M;  1VH0 A;  1D2N A;  3CTW B;  2UXC M;  3AIA A;  4M9Z A;  4AQY M;  4LJ5 A;  3GLF B;  2UUA M;  4JWJ A;  1UAJ A;  1T3T A;  3M7G A;  3CF6 E;  3IEF A;  1VHY A;  3AI9 X;  1J5E M;  3L8U A;  1G3I A;  2QBY B;  1H6U A;  3SHF A;  4OX9 M;  4KDZ A;  4IJE A;  3ZC7 B;  4DV2 M;  1W5S A;  1FNN A;  4GMQ A;  1VHK A;  4BLC A;  3T1Y M;  2RKO A;  1MXI A;  2F5Q A;  1TH3 A;  5EJC A;  4KGN A;  4IBI A;  1XXH A;  3KW6 A;  4W5W A;  2Y20 A;  1QVR A;  3VDP A;  2UUB M;  3KOY E;  1NNJ A;  5KPT A;  4LGM A;  3AV0 A;  4YQJ A;  3FD9 A;  3HU1 A;  1NJG A;  4YQ9 A;  2KZU A;  2Q2E B;  4YQO A;  1Z5A A;  3FUW A;  4ITQ A;  2DWL A;  3SC3 A;  4DUZ M;  1Q3B A;  5D9F A;  5KO3 A;  4YQS A;  4RG1 A;  3U6Q A;  1N78 A;  5GMB A;  2P5T A;  5JI2 E;  1JQJ C;  2EO2 A;  2V6Z M;  5FSW A;  3GQ3 A;  4YVI A;  1N32 M;  4HL4 A;  1G59 A;  4LF7 M;  5DNY A;  4YPX A;  1MU5 A;  1XWI A;  4QHS A;  4DV4 M;  1DGB A;  4YQB A;  3GLH B;  2HA8 A;  4RF0 A;  3L26 A;  2FOI C;  4JI2 M;  4YPW A;  4FAK A;  1GLN A;  2R4E A;  1LV7 A;  1OJL A;  4JWH A;  3ZCB B;  3IG8 A;  3KVW A;  4YQQ A;  3QUV A;  1Z6T A;  2ZAN A;  4BB9 A;  4XGI A;  2CHV A;  3GLI B;  4AG6 A;  1R2Y A;  4IIW A;  3I51 A;  1HT1 E;  4NXN M;  4YQC A;  5EQT A;  4DV6 M;  2QZ4 A;  2EUC A;  3K92 A;  3MJ5 A;  1YE9 A;  3PFI A;  4MGI E;  3OII A;  2C96 A;  1QAM A;  1X37 A;  4WUR A;  5FLX S;  1ZAE A;  4NL4 H;  1ORY B;  5EP2 A;  3T1H M;  2QBY A;  3GPU A;  4LJ4 A;  1L1Z A;  2CUZ A;  3KS4 A;  1X7P A;  3JR4 A;  3L2A A;  2UXB M;  3OIN A;  3NK7 A;  5EXS A;  4D80 A;  3U61 B;  1K3R A;  3EIE A;  3A98 B;  1KFV A;  4X3L A;  2FFJ A;  1N34 M;  4OVZ A;  2H1R A;  4PZK A;  4YQL A;  4DR5 M;  2BJV A;  3HWS A;  4M9S A;  1NS5 A;  4JI5 M;  1IN4 A;  3D8B A;  4MGK E;  5EXX A;  1IBL M;  1NY5 A;  4YQA A;  4ZPX A;  3E4R A;  2UU9 M;  4LJ6 A;  3DCM X;  2R4J A;  3BOS A;  3PVS A;  3PNV A;  3Q8X A;  2LNH C;  4GIT A;  3SHG B;  2UUC M;  3DZD A;  3QAU A;  2KXE A;  2JA2 A;  2DWN A;  3VFD A;  3K8Z A;  2L09 A;  3LQR A;  4M0W A;  5LMN M;  2R65 A;  2CV2 A;  4FWD A;  5KPR A;  2NQ8 C;  3WHK A;  3R8F A;  4DUY M;  1HNZ M;  1NY6 A;  1KSF X;  2F5N A;  1ZJR A;  4L78 A;  2R45 A;  2XEP A;  2CV0 A;  4YVG A;  3FUU A;  4JXJ A;  3T38 A;  4M0D A;  1IBM M;  1OFH A;  3UGJ A;  3AJI B;  3D8L A;  3LVW A;  1VDD A;  1GKI A;  1GL7 A;  4PDI A;  1NXZ A;  3AOG A;  4JAK A;  4QOZ C;  1XNR M;  1E9R A;  2FE8 A;  3DA1 A;  4LY6 A;  1DGH A;  2X49 A;  3W0L B;  3VKG A;  4RNA A;  1WXQ A;  2HCB A;  4L69 A;  2HKJ A;  3GLI A;  1HQY E;  4YQP A;  2L7I A;  3VLF B;  3L29 A;  1V2X A;  1E9S A;  1Q39 A;  1HR0 M;  4B3T M;  3U6P A;  1R6B X;  3FTE A;  2W82 A;  3U60 A;  1L2D A;  4DR4 M;  4WW0 A;  3GQ5 A;  3U6S A;  2I7N A;  4IG6 A;  3OIJ A;  4X66 M;  3J2P B;  1K3X A;  3HHZ A;  4AW4 A;  2Y0T A;  4JI1 M;  3GRY A;  3NWL A;  4X64 M;  1HNW M;  3U5Z A;  2LWX A;  4YQ0 A;  2QCU A;  3LVV A;  3BBD A;  1QZM A;  2CEA A;  3U61 A;  2EGV A;  3J7A S;  5GMC A;  2Z4S A;  4B3R M;  1Z85 A;  3FKE A;  4GRI A;  2I7P A;  3DFZ A;  1J85 A;  4RF1 A;  1IPA A;  1V6Z A;  3GRV A;  3K2L A;  3SYL A;  2DWM A;  3EIH A;  3HHW A;  4IBC A;  4MH0 E;  3SMP A;  5BR8 M;  4II7 A;  3QWL A;  3HGI A;  3J7B A;  2HHH M;  2QP9 X;  1J7K A;  1L8Q A;  4X65 M;  4I8O A;  4IBK A;  3GLG B;  2E5L M;  4LJ8 A;  3GYQ A;  1G8P A;  3UMM A;  4FW9 A;  3KTY A;  3NK6 A;  1DGG A;  1IN5 A;  2Z4R A;  4YHH M;  4FCW A;  1G41 A;  1R2Z A;  2Z0Y A;  3KSX A;  2AHM A;  5FTM A;  4FMW A;  4GHA A;  3MK6 A;  4MCB A;  1I94 M;  2YNM D;  4MCD A;  4Z6Y A;  2QEN A;  2X4A A;  1K82 A;  2CE7 A;  3A46 A;  4KOD A;  4NXM M;  4LJ7 A;  2KZS A;  1YUB A;  5GKN A;  3KOW E;  1IN7 A;  1L2C A;  3U6L A;  3BBE A;  4LRT A;  3HU2 A;  2XFT A;  3KP0 E;  3THG A;  1SXJ C;  4Z8X A;  5ITX E;  5A2Q S;  4CNE A;  4G4Q A;  4CNF A;  2LH0 A;  4XBO A;  3L27 A;  4DR3 M;  4L15 A;  2G5G X;  2RGH A;  4I81 A;  3TWK A;  4AZF A;  4MM3 B;  3SAS A;  5EP1 A;  4YQG A;  1Z5C A;  3DOA A;  4B7F A;  3GPX A;  4B7H A;  1NHW C;  3LQQ A;  1UAL A;  3W0F A;  1IY1 A;  2EA0 A;  4H3Y A;  3KDS E;  2XSZ D;  2V3K A;  4YPY A;  1TH4 A;  4IJF A;  4YQ2 A;  3HHY A;  3GLF A;  4G4R A;  5ITT A;  1EE8 A;  4AKG A;  4QOS A;  2YY8 A;  4LJA A;  4LG2 A;  1IY2 A;  1XMQ M;  4MGZ E;  5H37 D;  1JR3 D;  5E6J A;  4LF9 M;  1NJF A;  4JWF A;  3L25 A;  3UK6 A;  3UJN A;  1OY5 A;  3A42 A;  5KPZ A;  2BNK A;  3RGP A;  2DZN B;  3ZH9 B;  3SFZ A;  2QWV A;  4DR1 M;  1IQP A;  4L4U A;  5ITU A;  3FTD A;  4NOO B;  3VDU A;  4DV0 M;  4FVM A;  1C1K A;  2Z3X A;  2DWZ B;  4YQ8 A;  1QAO A;  2XFS A;  3CF2 A;  4LFB M;  4L8R C;  1QYR A;  2KRU A;  3GRU A;  3GPP A;  4JWG A;  1O6D A;  2DZO B;  1IXR C;  4JYA M;  5FTK A;  2ZM6 M;  1GL6 A;  1J09 A;  4LFC M;  5FAI A;  1SXJ D;  3HU3 A;  2LXE A;  2ZAO A;  4GH9 A;  4LFA M;  5ITY A;  4AG5 A;  5JI3 E;  3TL4 X;  1L1T A;  2ERC A;  3KFU G;  2K47 A;  5LMU M;  3TQS A;  3KOX E;  4G4O A;  1L2B A;  2R46 A;  2D7H A;  2ZAM A;  5ITR A;  2BJW A;  1UM8 A;  1XNQ M;  3O7B A;  1XC8 A;  2KW0 A;  1IN8 A;  4K0K M;  4YVK A;  3GLH A;  4YQ7 A;  4GC9 A;  3I4V A;  2OPF A;  3A45 A;  4CNG A;  4GC5 A;  4X3M A;  4GIP A;  4A3V B;  4PD2 A;  3MHV C;  3AFH A;  4R3D A;  1HNX M;  4LJ9 A;  1XXH B;  2X8A A;  1ZQ9 A;  1X7O A;  1MX0 A;  1S3S A;  3NBI A;  4HLQ A;  3KXE C;  4JI4 M;  3KNU A;  3IC6 A;  3AKZ A;  4QHT A;  2HL7 A;  1FJG M;  2QPA A;  4B3S M;  3J81 S;  2L6O A;  4CGY B;  2UXD M;  4DR6 M;  4PCZ A;  4GHL A;  3GPY A;  2Y21 A;  3KP1 E;  1Z5B A;  1IBK M;  2R18 A;  3N4K A;  1TGU A;  3RE8 A;  4IBD A;  2CHG A;  2D7G A;  4B3M M;  1N33 M;  2G8L A;  2F5S A;  4KLN A;  3AL0 C;  3KOZ E;  2CHQ A;  4MB7 A;  3J80 S;  2CX8 A;  1DGF A;  4DR2 M;  5DYG A;  2KEB A;  4JI6 M;  3J27 B;  4JI8 M;  3TPZ A;  2C9O A;  4NRW A;  4KHP M;  3HHX A;  4DV3 M;  2KA6 B;  3SYK A;  5EP3 A;  4I4L A;  1N36 M;  1HT2 E;  1P9P A;  3U6D A;  3LMM A;  1OFI A;  4NSO B;  5EP4 A;  5F3W A;  2XH9 A;  4LCB A;  4FCT A;  4LZZ A;  3KY7 A;  2VQF M;  4J3C A;  4YQN A;  3I4Y A;  2F4V M;  2C99 A;  3TWL A;  2F5O A;  4JI7 M;  4JAL A;  3FYC A;  1PJJ A;  3VKH A;  4FWG A;  1XHB A;  1IXZ A;  4BBA A;  3AOE A;  5C18 A;  3B9P A;  4PDG A;  4MGH A;  3JR5 A;  2DXI A;  1SXJ E;  3KW2 A;  3FTC A;  4YQK A;  4G6Z A;  4OW0 A;  1IM2 A;  3SAU A;  1UAM A;  4YVH A;  1IXS B;  4I5S A;  3VK8 A;  7CAT A;  1IN6 A;  3UZU A;  4OVZ B;  2XZF A;  3ILK A;  5FTJ A;  4G4N A;  3M0E A;  4YQR A;  1TO0 A;  4REZ A;  1QAQ A;  5CO4 A;  3WHL A;  1GVN A;  4R7G A;  3HKP A;  1KYI A;  1HQC A;  3K1J A;  1E32 A;  3TE6 A;  1NNU C;  2YQZ A;  1Q3C A;  4B08 A;  4IBE A;  3JAM S;  8CAT A;  5ITQ A;  4AKI A;  3FYD A;  1IY0 A;  3PNY A;  4DV5 M;  2EGW A;  4FWH A;  4YQ5 A;  5E26 A;  1E94 E;  3BBH A;  1DO2 A;  2KRK A;  4MCC A;  1N77 A;  3KS8 A;  4OU7 A;  3FUT A;  4YQ6 A;  4CIS A;  3GRR A;  3SAV A;  4GKJ M;  2C98 A;  3E9S A;  5KQD A;  2OQ4 A;  4QNR A;  3SAT A;  1UAK A;  2QMM A;  3SAW A;  2Y0Q A;  1DGH B;  1GZ0 A;  4KO8 A;  4IBG A;  3FUX A;  3R9X B;  3SBJ A;  4AKH A;  4JI3 M;  4DV7 M;  1TDH A;  1SXJ B;  3GQ4 A;  4IBB A;  3FTF A;  1G4A E;  1W5T A;  2V1C A;  4FD2 A;  4CND A;  3GLG A;  3M6A A;  4LZJ A;  3U60 B;  3SAR A;  1I4W A;  3PXG A;  1K3W A;  2M5Z A;  1N75 A;  3GO8 A;  3AOE C;  4YQ3 A;  5IT9 S;  1NVM A;  3VK7 A;  4E8B A;  4YQD A;  4YVJ A;  3U5Z B;  2XZU A;  4LF4 M;  5C1B A;  2YR0 A;  4YQ1 A;  2O3A A;  3U6O A;  4FCV A;  1QAN A;  2CFO A;  2Z7J A;  4D81 A;  4YQ4 A;  5EXP A;  1NHG C;  3HJS A;  1TDZ A;  4YQI A;  2XSZ A;  3T15 A;  4QNM A;  2C9C A;  3ONP A;  4IBF A;  4DV1 M;  4H3Z A;  4AI6 A;  1QQW A;  2J7N A;  2XLJ A;  2R62 A;  1YSY A;  3E5Y A;  1JR3 A;  2D7E A;  4JV5 M;  2YFQ A;  4CHT B;  1NSF A;  2VQE M;  3RGS A;  2ZBK B;  3OTO M;  4YPZ A;  2I6D A;  5FTL A;  1TH2 A;  2F5P A;  2C5R A;  4IBJ A;  1DO0 A;  2J7O A;  4JN6 A;  1PJI A;  4GKK M;  5IRE B;  4D82 A;  3GP1 A;  5GM8 A;  3U6C A;  4TUW A;  1R7R A;  4PT5 A;  4LRS A;  4B7G A;  4YY3 M;  4S12 A;  2M60 A;  1XMO M;  3KSJ A;  5DYI A;  2VII A;  3TWM A;  4DR7 M;  2DHR A;  2L7H A;  5FTN A;  3RFW A;  3C58 A;  2XF3 A;  5BPV A;  4JI0 M;  2FNA A;  2A5Y B;  3CF0 A;  4L16 A;  5KQ8 A;  4LF8 M;  3H4M A;  2DVW B;  3N4J A;  2O5R A;  4NSR A;  1SXJ A;  1Z59 A;  2XGN A;  4EIW A;  2RGO A;  3L28 A;  3SMS A;  2CV1 A;  4LF6 M;  4YQT A;  3AXZ A;  2V1U A;  5IZ7 D;  2V3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...