4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
3NK7A 4YQ0A 4CNFA 1ZJRA 4YPZA 2I6DA 4YQSA 4YQDA 1VHKA 4YQRA 1TO0A 4X3MA 5CO4A 1VHYA 3KW2A 4YPXA 4YQLA 2O3AA 2CX8A 2Z0YA 3E5YA 4MCCA 3N4JA 2HA8A 4YQTA 4YQIA 3KY7A 4CNDA 4H3ZA 2QMMA 2YY8A 3L8UA 1UAJA 4X3LA 3QUVA 3BBEA 4L69A 1VH0A 3BBHA 4H3YA 1P9PA 5GMBA 3OIIA 4YPWA 4YQ6A 4YVHA 5FAIA 4MCBA 4PZKA 4YQ8A 4YQNA 1UALA 1K3RA 2V3JA 1X7PA 4IG6A 3AXZA 3BBDA 3IC6A 4YQAA 4YQKA 1UAMA 1NS5A 5GM8A 3DCMX 3NK6A 4J3CA 3AI9X 5D9FA 4YVJA 4E8BA 4YQGA 4JALA 1X7OA 4YVGA 4YQ4A 1O6DA 4YQOA 1OY5A 4YVKA 4YPYA 3N4KA 4YQJA 3KNUA 3O7BA 4CNEA 2V3KA 4YQ9A 4YQ2A 4XBOA 4YQQA 4FAKA 1MXIA 3OIJA 1V6ZA 4JAKA 4YQCA 2QWVA 4YQ5A 4YQ7A 1IPAA 4YQ3A 4CNGA 4KGNA 3GYQA 3KTYA 4YQ1A 1Z85A 1NXZA 1J85A 4RG1A 4YQPA 2EGWA 4YVIA 4MCDA 3ONPA 2EGVA 5GMCA 3AIAA 1V2XA 4YQBA 3IEFA 3ILKA 1GZ0A 3OINA 4KDZA 1UAKA
chains in the Genus database with same CATH superfamily
3JAMS 2CV2A 3NK7A 1T6OA 1TDHA 1IY2A 1E9RA 2B3TA 2RRUA 2LVQD 5F3WA 1ZJRA 4CNFA 1VEGA 1V34A 4UN2B 3U61B 1FNNA 4ITQA 3L26A 2G3QA 1S3SA 2EUCA 2HAKA 4LF7M 1L1ZA 3GRVA 2G5GX 2HWJA 5FTKA 1QZEA 1TO0A 2LBCA 2JNHA 4L8RC 1A5TA 1G41A 2D7HA 1NNJA 1OIPA 1C1KA 3EIEA 4MH0E 1YUBA 2RGOA 3GLGA 2O3AA 3UZUA 3J7BA 4FWDA 3GPXA 3GQ5A 1NNUC 5EQTA 2CE7A 4YY3M 3U61A 4H3ZA 4BB9A 2KW0A 4LG2A 3LQQA 2UUBM 4KO8A 3GQ4A 1GVNA 1OQYA 2CFOA 4GRIA 4A3VB 1Z5CA 3RGSA 1NO1A 4XGIA 1N78A 3J27B 2QMMA 2DHYA 4HEOA 4DV0M 4FW9A 2UXDM 2X4AA 3MJ5A 5KPRA 2YY8A 1GLNA 3QUVA 4LZZA 1R2YA 2FE8A 3NBIA 2JA2A 4NRWA 3EIHA 5GMBA 1QUSA 4LJAA 4QOZC 1ZQ9A 5LMNM 1P3QQ 3U5ZA 2DWLA 1SXJE 2WZJA 2Y20A 4YPWA 4YQ2A 4FCTA 4Y28F 2N35A 5ITXE 4MCBA 3BBZA 4LJ9A 5EXSA 1G4AE 2JY7A 1GKIA 1OFHA 4L4UA 2JY5A 5EP1A 5C1BA 1QQWA 4B08A 2H1RA 5FTNA 3TWMA 3DOAA 3U6EA 3L25A 1X7PA 1XXHE 3AOEC 4II7A 5JI2E 3J2PB 3GPPA 2L7IA 2OQ4A 2ZANA 4DUZM 4GHAA 3BBDA 2QNJA 2JZ1A 3L27A 4FWGA 1Z6TA 4TUWA 4FCWA 4LCBA 4FMWA 1UAMA 3SAVA 4IBIA 1W5TA 4PT5A 3C9PA 4LY6A 3U6OA 2J5YA 3VKGA 1HNWM 3AI9X 3B7ZA 2Y0QA 5KO3A 3MK6A 3U6PA 3HJSA 3GLFA 4LJ5A 3E46A 4LJ8A 1DO2A 3RFWA 1IM2A 3T1YM 4JI6M 2R65A 2O01F 3IECA 3FUTA 3HWSA 5DFLA 1OY5A 1OAOC 1IBLM 2QBYA 3O7BA 2KA6B 4IBKA 2J7OA 1FJGM 1VQ1A 1UFZA 3B7NA 3C3DA 4XBOA 2KRKA 4YQQA 3HZJA 2LXEA 4B3SM 1MXIA 4FAKA 2XSZA 2FOIC 2YFQA 1V6ZA 1ZMWA 2OPFA 4NXMM 2QWVA 4AKGA 3WHLA 1NY6A 1EE8A 2CUZA 2J7NA 4JWJA 4AQYM 1QDRA 1ZMUA 3R9XB 1TH4A 1TH3A 3RE8A 3K1JA 1HQCA 3KS4A 4JXJA 4GKKM 3KTYA 2F5QA 1Z85A 1IY0A 3KOZE 1J85A 2UU9M 2Z8YM 3IHPA 1KSFX 1IN5A 1GJSA 4LFBM 2DZOB 3HJQA 5ITTA 4QHSA 1V2XA 4YQBA 2K47A 3AOEA 3ILKA 4DV1M 5KQDA 4LFAM 2DAMA 3OINA 1IXSA 2EJSA 4ANRA 4DV6M 2DAGA 3FTCA 2HHHM 4D81A 3B74A 4I81A 4YQ0A 2DZLA 2DHRA 3FD9A 1YLAA 4LF9M 1JB0F 3FUUA 5KPTA 4YPZA 2L2DA 2LVPC 2Y21A 2WSEF 4G6ZA 5KPZA 4AKIA 1VHKA 2W82A 3FRHA 5ITXA 2R62A 2NQ8C 1JQJC 4X3MA 1ZV1A 4YPXA 4HLQA 3KW2A 2XH9A 4YQLA 1OIZA 2I7NA 4FD2A 3SAUA 4PCZA 3BOSA 4X66M 1SXJA 1IXSB 1NY5A 4Q7JA 5IREB 1Z5BA 3ZQJA 1T43A 3DA1A 1PGYA 4QNRA 1HT2E 3HHYA 3SFZA 3GO8A 4DR3M 3R8FA 4AG6A 3U6LA 4B3RM 2C96A 3GLIB 4S12A 2ZBKB 4WURA 3GRRA 3LMMA 2UUCM 4B3MM 4LF8M 1DO0A 2EKKA 3KP1E 4IBJA 2QSFX 4IJFA 2R46A 1WHCA 2MJ5B 4KLNA 4QOSA 1OJLA 1XC8A 1NHWC 1MN3A 3U6SA 2X8AA 4CGYB 2QCUA 4I5SA 1PJIA 1KFVA 4FCVA 2R0IA 3K2LA 2CRUA 4L69A 2F5NA 1SXJD 2QHOB 4GIPA 4AW4A 1N33M 4G4RA 2ZM6M 2CWBA 1HQYE 1P9PA 1JR3A 2CV1A 1TH2A 1BVSA 2V6ZM 4NOOB 3U6CA 1PJSA 4LZJA 4Z8XA 4YQ6A 5FAIA 1XB2B 2L4FA 3UMMA 3W0LB 3I04M 4AKHA 4PZKA 3A45A 4IBGA 2D7GA 4FVMA 3HU3A 4REZA 3QYBA 4OVZB 2BJWA 1X37A 2CHVA 3GPUA 2JY6B 1UALA 3W67A 2DAEA 2DAIA 1K82A 1VDDA 4CIZA 3C58A 4OX9M 4JI3M 4IBFA 4IG6A 1WIVA 4G3OA 5FSWA 2LHCA 1L2CA 3AXZA 4YQAA 1IN8A 1AIPC 1G71A 2LVOC 2CHQA 3VK7A 2A5YB 3PFIA 1V33A 5IZ7D 1DGHA 2R45A 3E4RA 1YE9A 3TWKA 2QZ4A 3VLFB 3NK6A 4J3CA 4YVJA 3CF2A 3TE6A 4JALA 1L2BA 4NSOB 1GJTA 4M9SA 4Z6YA 5FLXS 4YQOA 2BNKA 2LH0A 2DNAA 1E94E 3KOWE 3LCUA 3FRIA 1I4WA 3PNYA 3HHWA 4GITA 3KSXA 1LTMA 2FH0A 1IQPA 4CJ6A 2XFSA 5EXXA 1HR0M 2JP7A 4JYAM 4YQ9A 2XLJA 1R2ZA 3GLHE 3IG5A 1HT1E 3JR4A 2L09A 3K9PA 3U6DA 4YQ5A 4LRSA 4YQ7A 2CP8A 4YQ3A 4CNGA 2XF3A 4KGNA 4DV3M 1MU5A 3KXEC 3KSJA 1XNQM 4KT0F 5EJCA 3T15A 3F92A 1NXZA 1IY1A 4RG1A 1ZMVA 1N32M 4IBEA 2EGWA 4MCDA 2BWBA 1D0LA 4F1IA 2EGVA 1WGNA 3QWLA 3PNVA 4B7FA 3VDUA 3AIAA 5GMCA 4DUYM 1SXJB 1D0MA 3SYKA 1XNRM 4K0KM 3AOGA 1NVMA 1QDTA 3LVVA 5C18A 3FTFA 3SHGB 1GO5A 2GNOA 2Z3XA 4KDZA 1Z59A 1UAKA 1IXRC 2ZAOA 3FUXA 2DWZB 2DZNB 4NSRA 4G4NA 3NBXX 1F4IA 4LJ4A 4AI6A 1DGBA 1QZMA 3Q8XA 1VG5A 3SHFA 2KZSA 4HL4A 4XK8F 2R44A 3H4JA 4LGMA 3UK6A 5DNYA 1N36M 3CF0A 2Z7JA 2E5LM 2YNMD 3KW6A 1PJQA 1PJJA 1ORYB 4YQRA 2UXCM 4GC5A 4NXNM 1VHYA 1DGFA 3GRUA 2ZAMA 1PJTA 5GKNA 4ZPXA 2VDBB 5H37D 3CGWA 1EIJA 2CX8A 2Z0YA 3E5YA 3N4JA 1TR8A 1N34M 4MGYE 4YHHM 4FWHA 4G4OA 4YQTA 4JI8M 2DKLA 1J5EM 2LVNC 2EKFA 1Q39A 2FS1A 2VQEM 4CHTB 2JXNA 3GLHA 3AFHA 2ZTCA 3NWLA 3FUVA 4M9ZA 1K3XA 4LRTA 4RKUF 1WXQA 3FUWA 1HNXM 2MGWA 4L6V6 4D80A 3L8UA 3K8ZA 3FTEA 2BJVA 2VQFM 3U6MA 1SXJC 1YSYA 3HKPA 1VH0A 3L28A 3I4VA 2HL7A 4BBAA 1LV7A 2L4EA 1L1TA 3SC3A 2R18A 2BWEA 4B7HA 5ITYA 4B7GA 1G59A 1E9SA 2VF8A 4WW0A 3U5ZB 2XZFA 1TTEA 2JWSA 4JI5M 2EO2A 3J7AS 1HJPA 1TDZA 2XSZD 5FTJA 2F5OA 3TPZA 4MB7A 5JI3E 3CTWB 1WR1B 1D2NA 2EA0A 4JN6A 2V3JA 3M0EA 1HNZM 4L15A 1IBKM 3GLFE 3IC6A 2JUJA 4P17A 3UJNA 4YQKA 1QVRA 3HJ8A 4LGYA 4RNAA 1L8QA 1NS5A 5GM8A 1Q3BA 3GLIA 3KP0E 3FYDA 4DR6M 3DCMX 3LVWA 4GHLA 5L8RF 5D9FA 4I4LA 3Q8GA 3WHKA 2MROB 4IBCA 3ZC7B 3GLGE 3GLFB 3A98B 4E8BA 1OKSA 4YVGA 1GL6A 1IXZA 3K92A 2C98A 1OAIA 2Z4RA 4R7GA 4CISA 4YPYA 1TF0B 1JR3D 2JZ0A 2XFTA 5EP4A 2OOBA 3PVSA 4M0DA 2KXEA 2M5ZA 2WSFF 4PD2A 3UGJA 2QBYB 3I01M 3VDPA 2V3KA 1JR3E 3D8BA 4IBBA 5FTLA 3GLIE 5LMUM 2QQ8A 2KNZA 1EFUB 1SG9A 1IN6A 1UM8A 4P16A 5IWAM 1R6BX 2KNVA 3T1HM 3VK8A 2DENA 1IFYA 2JY8A 3SASA 3OIJA 3K9OA 4D82A 3B89A 4YQCA 1CUKA 2APLA 3JR5A 1XHBA 3IG8A 1N77A 3HU2A 1MJGM 1IPAA 3B7QA 3U60B 3GYQA 4DR7M 4NL4H 1J7KA 1VEJA 3B9PA 3T6PA 4QNMA 1OTRA 1QAMA 1W5SA 4YQ1A 2Q2EB 1G8PA 1N75A 4DR2M 4GEWA 2CHGA 4B3TM 3QYEA 4MGIE 2QPAA 3E9SA 3I51A 3SBJA 3ONPA 1G3IA 2V1UA 1PRBA 3PXGA 1QANA 2C99A 4L78A 2C9OA 3D8LA 3J81S 4DV7M 1DV0A 3HHZA 4JWGA 1XWIA 3SARA 3MHVC 3M7GA 4PDGA 1L2DA 5DYGA 1DGHB 1XXHB 2QP9X 3LW5F 5FTMA 4LJ6A 3L29A 4M0WA 2LTUA 4AG5A 2V1CA 3U60A 2KDLA 2GQFA 2Z4SA 2FFJA 2OOAA 3KOXE 1DGGA 4DV5M 1AUAA 2I6DA 4YQSA 4MGKE 4YQDA 4OU7A 1NJGA 1XMOM 1GL7A 2C9CA 4DV2M 1R7RA 1XMQM 5CO4A 4W5WA 2RGHA 2KRUA 4MM3B 2F4VM 8CATA 1TGUA 2UUAM 1Q3CA 4JV5M 2HCBA 2VIIA 3QAUA 2ERCA 3GPYA 3SAWA 3KFUG 1XXHA 4MCCA 3CF6E 1MX0A 1GABA 3H4MA 2L7HA 2HA8A 1NHGC 4NC6A 4DR5M 4LJ7A 5BR8M 3KY7A 4JWHA 4YQIA 4MGZE 3TQSA 2Y0TA 4CNDA 3LCVB 4LF4M 2KHHA 3MMPA 1E32A 3U6QA 1H6UA 1RU3A 1Y8GA 2HKJA 3SYLA 7CATA 4X64M 1D0KA 4JI4M 1UAJA 4X3LA 2VF7A 3AKZA 2AHMA 3AL0C 2XZUA 3BBEA 3I4YA 3HY5A 2CEAA 2D7EA 3C3EA 4R71A 4DV4M 4GKJM 3A42A 3KOYE 3BBHA 2QENA 4H3YA 4QHTA 5E6JA 3OTOM 4GMQA 3VKHA 3RGPA 1ZAEA 3TL4X 3OIIA 1NJFA 4YVHA 2F5SA 1NV9A 5EXPA 2XEPA 3AV0A 2LVAA 5DYIA 3W68A 2DAKA 1QUTA 2ZTDA 4JI0M 3SMSA 3GQ3A 1PM5A 2DWMA 3AJIB 4OW0A 2DWNA 4YQ8A 4YQNA 2OO9A 2YQZA 3GRYA 2UXBM 2I7PA 4OVZA 4EIWA 1VDLA 5IT9S 1Z5AA 4RF0A 1K3RA 4R3DA 4JI2M 2P5TA 5KQ8A 1WJ7A 3LQRA 4IIWA 1QYRA 2DI0A 2R4EA 1IN4A 2G8LA 2K0BX 4PDIA 4WP2A 4DR1M 1V92A 4X65M 1OFIA 3BXWA 1C7YA 4IJEA 4DR4M 1T3TA 1QAQA 2RKOA 5EP3A 5ITQA 2CV0A 2DXIA 2DVWB 1R4GA 2K6BA 3HGIA 1QAOA 1NV8A 2LNHC 3J80S 2F5PA 4YQGA 1X7OA 3M6AA 3FYCA 4YQ4A 3GLHB 3E21A 3A46A 1I94M 1O6DA 1WGLA 4NRVA 5BPVA 4YVKA 3DFZA 4GH9A 3T38A 2XGNA 2L6OA 5EP2A 4BLCA 2MH8A 4I8OA 4LF5M 3N4KA 4YQJA 3KNUA 4CNEA 3GP1A 3TWLA 3HHXA 2LHGA 3L2AA 5ITRA 3THGA 3VFDA 3W0FA 1VEKA 2R4JA 3V76A 3SATA 3FKEA 1IN7A 5ITUA 3KDSE 5EXTA 4JI1M 3HU1A 4KODA 4L16A 3KS8A 4MGHA 4JAKA 1K3WA 2WSCF 5E26A 3FTDA 2YR0A 3HX3A 2KZUA 3DZDA 4M9XA 2KEBA 4AZFA 2K9DA 1KYIA 2X49A 4X62M 4IBDA 3FE3A 4JWFA 4YQPA 1Q02A 4RF1A 4YVIA 1J09A 4G4QA 2MR9A 4JI7M 2O25A 4DBGB 1IBMM 1NSFA 2O5RA 3ZH9B 2C5RA 2LWXA 3KVWA 2M60A 2R6FA 3IEFA 2FNAA 4F2LA 4KHPM 5A2QS 4GC9A 1GZ0A 3GLGB 4LF6M 2KNAA 3ZCBB 3SMPA 4LFCM 1R5LA 2H5XA
chains in the Genus database with same CATH topology
3JAMS 2CV2A 3NK7A 1TDHA 1IY2A 1E9RA 5F3WA 4CNFA 1ZJRA 3U61B 1FNNA 4ITQA 3L26A 1S3SA 2EUCA 4LF7M 1L1ZA 3GRVA 2G5GX 5FTKA 1TO0A 4L8RC 1G41A 2D7HA 1NNJA 1C1KA 3EIEA 4MH0E 1YUBA 2RGOA 3GLGA 2O3AA 3UZUA 3J7BA 4FWDA 3GPXA 3GQ5A 1NNUC 5EQTA 2CE7A 4YY3M 3U61A 4H3ZA 4BB9A 2KW0A 4LG2A 3LQQA 2UUBM 4KO8A 3GQ4A 1GVNA 4GRIA 2CFOA 4A3VB 1Z5CA 3RGSA 4XGIA 1N78A 3J27B 2QMMA 4DV0M 4FW9A 2X4AA 3MJ5A 5KPRA 2YY8A 1GLNA 3QUVA 4LZZA 1R2YA 2FE8A 3NBIA 2JA2A 4NRWA 3EIHA 5GMBA 4LJAA 4QOZC 1ZQ9A 5LMNM 3U5ZA 2DWLA 4YPWA 1SXJE 2Y20A 4FCTA 5ITXE 4MCBA 4LJ9A 5EXSA 1G4AE 1GKIA 1OFHA 4L4UA 5EP1A 5C1BA 1QQWA 4B08A 2H1RA 5FTNA 3TWMA 3DOAA 3U6EA 3L25A 1X7PA 3AOEC 4II7A 5JI2E 3J2PB 3GPPA 2L7IA 2OQ4A 2ZANA 4DUZM 4GHAA 3BBDA 4FWGA 3L27A 4TUWA 1Z6TA 4FMWA 4FCWA 4LCBA 1UAMA 3SAVA 4IBIA 1W5TA 4PT5A 4LY6A 3U6OA 3VKGA 1HNWM 3AI9X 5KO3A 2Y0QA 3MK6A 3U6PA 3HJSA 3GLFA 4LJ5A 4LJ8A 1DO2A 3RFWA 1IM2A 3T1YM 4JI6M 2R65A 1OY5A 3FUTA 3HWSA 1IBLM 2QBYA 3O7BA 2KA6B 4IBKA 2J7OA 1FJGM 4XBOA 4YQQA 2KRKA 4FAKA 2LXEA 4B3SM 1MXIA 2XSZA 2FOIC 2YFQA 1V6ZA 2OPFA 4NXMM 2QWVA 4AKGA 3WHLA 1NY6A 1EE8A 2CUZA 2J7NA 4JWJA 4AQYM 3R9XB 1TH4A 1TH3A 3RE8A 3K1JA 1HQCA 3KS4A 4JXJA 4GKKM 3KTYA 2F5QA 1Z85A 1IY0A 3KOZE 1J85A 2UU9M 1KSFX 1IN5A 4LFBM 2DZOB 3HJQA 5ITTA 4QHSA 1V2XA 4YQBA 2K47A 3AOEA 3ILKA 4DV1M 5KQDA 4LFAM 3OINA 4DV6M 3FTCA 2HHHM 4D81A 4I81A 4YQ0A 2DHRA 3FD9A 4LF9M 3FUUA 5KPTA 4YPZA 2Y21A 4G6ZA 5KPZA 4AKIA 1VHKA 2W82A 5ITXA 2R62A 2NQ8C 1JQJC 4X3MA 4YPXA 4HLQA 3KW2A 2XH9A 4YQLA 2I7NA 4FD2A 3SAUA 4PCZA 3BOSA 4X66M 1SXJA 1IXSB 1NY5A 5IREB 1Z5BA 3HHYA 3DA1A 4QNRA 3SFZA 1HT2E 3GO8A 4DR3M 3R8FA 4B3RM 4AG6A 3U6LA 2C96A 3GLIB 4S12A 2ZBKB 4WURA 3GRRA 3LMMA 2UUCM 4B3MM 4LF8M 1DO0A 3KP1E 4IBJA 4IJFA 2R46A 4KLNA 4QOSA 1OJLA 1XC8A 1NHWC 3U6SA 2X8AA 4CGYB 2QCUA 4I5SA 1PJIA 1KFVA 4FCVA 3K2LA 4L69A 2F5NA 1SXJD 4GIPA 4AW4A 1N33M 4G4RA 2ZM6M 1HQYE 1P9PA 1JR3A 2CV1A 1TH2A 2V6ZM 4NOOB 3U6CA 4LZJA 4Z8XA 4YQ6A 5FAIA 3UMMA 3W0LB 4AKHA 4PZKA 3A45A 4IBGA 2D7GA 4FVMA 3HU3A 4REZA 4OVZB 2BJWA 1X37A 2CHVA 3GPUA 1UALA 1K82A 1VDDA 4OX9M 3C58A 4JI3M 4IBFA 4IG6A 5FSWA 1L2CA 3AXZA 4YQAA 1IN8A 3VK7A 2CHQA 2A5YB 3PFIA 5IZ7D 1DGHA 2R45A 3E4RA 1YE9A 3TWKA 2QZ4A 3VLFB 3NK6A 4J3CA 4YVJA 3CF2A 3TE6A 4JALA 1L2BA 4NSOB 4M9SA 4Z6YA 5FLXS 4YQOA 2BNKA 2LH0A 3KOWE 1E94E 1I4WA 3PNYA 3HHWA 4GITA 3KSXA 1IQPA 2XFSA 5EXXA 1HR0M 4JYAM 4YQ9A 2XLJA 1R2ZA 3IG5A 1HT1E 3JR4A 2L09A 3U6DA 4YQ5A 4LRSA 4YQ7A 4YQ3A 4CNGA 2XF3A 4KGNA 4DV3M 1MU5A 3KXEC 3KSJA 1XNQM 5EJCA 3T15A 1NXZA 1IY1A 4RG1A 1N32M 4IBEA 2EGWA 4MCDA 2EGVA 3QWLA 3AIAA 3PNVA 4B7FA 3VDUA 5GMCA 4DUYM 1SXJB 3SYKA 1XNRM 4K0KM 3AOGA 1NVMA 3LVVA 3FTFA 5C18A 3SHGB 2Z3XA 4KDZA 1Z59A 1UAKA 1IXRC 2ZAOA 3FUXA 2DWZB 2DZNB 4NSRA 4G4NA 4AI6A 4LJ4A 1DGBA 1QZMA 3Q8XA 3SHFA 2KZSA 4HL4A 3UK6A 4LGMA 5DNYA 1N36M 3CF0A 2Z7JA 2E5LM 2YNMD 3KW6A 1PJJA 1ORYB 4YQRA 2UXCM 4GC5A 4NXNM 1VHYA 1DGFA 3GRUA 2ZAMA 5GKNA 4ZPXA 5H37D 2CX8A 2Z0YA 3E5YA 3N4JA 1N34M 4MGYE 4YHHM 4FWHA 4G4OA 4YQTA 4JI8M 1J5EM 1Q39A 2VQEM 4CHTB 3GLHA 3AFHA 3NWLA 3FUVA 4M9ZA 1K3XA 4LRTA 1WXQA 3FUWA 1HNXM 4D80A 3L8UA 3K8ZA 3FTEA 2BJVA 2VQFM 3U6MA 1SXJC 1YSYA 3HKPA 1VH0A 3L28A 3I4VA 2HL7A 4BBAA 1LV7A 1L1TA 3SC3A 2R18A 4B7HA 5ITYA 4B7GA 1G59A 1E9SA 4WW0A 3U5ZB 2XZFA 4JI5M 2EO2A 3J7AS 1TDZA 2XSZD 5FTJA 2F5OA 3TPZA 4MB7A 5JI3E 3CTWB 1D2NA 2EA0A 4JN6A 2V3JA 3M0EA 1HNZM 4L15A 1IBKM 3IC6A 3UJNA 4YQKA 1QVRA 3HJ8A 4LGYA 4RNAA 1L8QA 1NS5A 5GM8A 1Q3BA 3GLIA 3KP0E 3FYDA 4DR6M 3DCMX 3LVWA 4GHLA 5D9FA 4I4LA 3WHKA 3ZC7B 4IBCA 4E8BA 3GLFB 3A98B 4YVGA 1GL6A 1IXZA 3K92A 2C98A 2Z4RA 4R7GA 4CISA 4YPYA 1JR3D 2XFTA 5EP4A 4M0DA 3PVSA 3UGJA 2KXEA 2M5ZA 4PD2A 2QBYB 2V3KA 3VDPA 3D8BA 4IBBA 5FTLA 5LMUM 4YQ2A 2UXDM 4P16A 1UM8A 1IN6A 5IWAM 3T1HM 1R6BX 3VK8A 3SASA 3OIJA 4D82A 4YQCA 3JR5A 1XHBA 3IG8A 1N77A 3HU2A 1IPAA 3U60B 3GYQA 4DR7M 4NL4H 1J7KA 3B9PA 4YQ1A 4QNMA 1QAMA 1W5SA 1G8PA 1N75A 2Q2EB 4DR2M 2CHGA 4B3TM 4MGIE 2QPAA 3E9SA 3I51A 3SBJA 3ONPA 1G3IA 2V1UA 3PXGA 1QANA 2C99A 4L78A 2C9OA 3D8LA 3J81S 4DV7M 3HHZA 1XWIA 3SARA 3MHVC 3M7GA 4PDGA 1L2DA 5DYGA 1DGHB 2QP9X 1XXHB 5FTMA 3U60A 4LJ6A 3L29A 4M0WA 4AG5A 2V1CA 2Z4SA 2FFJA 3KOXE 1DGGA 4DV5M 2I6DA 4YQSA 4MGKE 4YQDA 4OU7A 1NJGA 1XMOM 1GL7A 2C9CA 4DV2M 1R7RA 1XMQM 5CO4A 4W5WA 2RGHA 2KRUA 4MM3B 2F4VM 8CATA 1TGUA 2UUAM 1Q3CA 4JV5M 2HCBA 2VIIA 3QAUA 2ERCA 3GPYA 3SAWA 3KFUG 1XXHA 4MCCA 3CF6E 1MX0A 3H4MA 2L7HA 2HA8A 1NHGC 4JWHA 4DR5M 4LJ7A 5BR8M 3KY7A 4YQIA 4MGZE 3TQSA 2Y0TA 4CNDA 4LF4M 1E32A 3U6QA 1H6UA 7CATA 3SYLA 2HKJA 4X64M 4X3LA 4JI4M 1UAJA 3BBEA 3AKZA 2AHMA 3AL0C 2XZUA 3I4YA 2CEAA 2D7EA 4GKJM 4DV4M 3A42A 3KOYE 3BBHA 2QENA 4H3YA 4QHTA 5E6JA 3OTOM 4GMQA 3VKHA 3RGPA 1ZAEA 3TL4X 3OIIA 1NJFA 4YVHA 2F5SA 5EXPA 2XEPA 3AV0A 5DYIA 1PM5A 2DWNA 4JI0M 3SMSA 3GQ3A 2DWMA 3AJIB 4OW0A 4YQ8A 4YQNA 2YQZA 3GRYA 2UXBM 2I7PA 4OVZA 4EIWA 5IT9S 1Z5AA 4RF0A 1K3RA 4R3DA 4JI2M 2P5TA 5KQ8A 3LQRA 4IIWA 1QYRA 2R4EA 1IN4A 2G8LA 4PDIA 4DR1M 4X65M 1OFIA 4DR4M 4IJEA 1T3TA 1QAQA 2RKOA 5EP3A 5ITQA 2CV0A 2DXIA 2DVWB 3HGIA 4YQGA 1QAOA 2LNHC 3J80S 2F5PA 1X7OA 3M6AA 3FYCA 4YQ4A 3GLHB 3A46A 1I94M 1O6DA 4NRVA 5BPVA 4YVKA 4GH9A 3DFZA 3T38A 2XGNA 2L6OA 5EP2A 4BLCA 4LF5M 4I8OA 3N4KA 4YQJA 3KNUA 4CNEA 3GP1A 3TWLA 3HHXA 5ITRA 3L2AA 3THGA 3VFDA 3W0FA 2R4JA 3SATA 3FKEA 1IN7A 5ITUA 3KDSE 5EXTA 4JI1M 3HU1A 4KODA 4L16A 3KS8A 4MGHA 4JAKA 1K3WA 5E26A 3FTDA 2YR0A 2KZUA 3DZDA 4M9XA 2KEBA 4AZFA 4X62M 1KYIA 2X49A 4IBDA 4JWFA 4YQPA 4RF1A 4YVIA 1J09A 4G4QA 4JI7M 1IBMM 1NSFA 2O5RA 3ZH9B 2C5RA 2LWXA 3KVWA 2M60A 3IEFA 2FNAA 4KHPM 5A2QS 4GC9A 1GZ0A 3GLGB 4LF6M 4LFCM 3ZCBB 3SMPA 4JWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK7 A;  4YQ0 A;  4CNF A;  1ZJR A;  4YPZ A;  2I6D A;  4YQS A;  4YQD A;  1VHK A;  4YQR A;  1TO0 A;  4X3M A;  5CO4 A;  1VHY A;  3KW2 A;  4YPX A;  4YQL A;  2O3A A;  2CX8 A;  2Z0Y A;  3E5Y A;  4MCC A;  3N4J A;  2HA8 A;  4YQT A;  4YQI A;  3KY7 A;  4CND A;  4H3Z A;  2QMM A;  2YY8 A;  3L8U A;  1UAJ A;  4X3L A;  3QUV A;  3BBE A;  4L69 A;  1VH0 A;  3BBH A;  4H3Y A;  1P9P A;  5GMB A;  3OII A;  4YPW A;  4YQ6 A;  4YVH A;  5FAI A;  4MCB A;  4PZK A;  4YQ8 A;  4YQN A;  1UAL A;  1K3R A;  2V3J A;  1X7P A;  4IG6 A;  3AXZ A;  3BBD A;  3IC6 A;  4YQA A;  4YQK A;  1UAM A;  1NS5 A;  5GM8 A;  3DCM X;  3NK6 A;  4J3C A;  3AI9 X;  5D9F A;  4YVJ A;  4E8B A;  4YQG A;  4JAL A;  1X7O A;  4YVG A;  4YQ4 A;  1O6D A;  4YQO A;  1OY5 A;  4YVK A;  4YPY A;  3N4K A;  4YQJ A;  3KNU A;  3O7B A;  4CNE A;  2V3K A;  4YQ9 A;  4YQ2 A;  4XBO A;  4YQQ A;  4FAK A;  1MXI A;  3OIJ A;  1V6Z A;  4JAK A;  4YQC A;  2QWV A;  4YQ5 A;  4YQ7 A;  1IPA A;  4YQ3 A;  4CNG A;  4KGN A;  3GYQ A;  3KTY A;  4YQ1 A;  1Z85 A;  1NXZ A;  1J85 A;  4RG1 A;  4YQP A;  2EGW A;  4YVI A;  4MCD A;  3ONP A;  2EGV A;  5GMC A;  3AIA A;  1V2X A;  4YQB A;  3IEF A;  3ILK A;  1GZ0 A;  3OIN A;  4KDZ A;  1UAK A; 
#chains in the Genus database with same CATH topology
 3JAM S;  2CV2 A;  3NK7 A;  1T6O A;  1TDH A;  1IY2 A;  1E9R A;  2B3T A;  2RRU A;  2LVQ D;  5F3W A;  1ZJR A;  4CNF A;  1VEG A;  1V34 A;  4UN2 B;  3U61 B;  1FNN A;  4ITQ A;  3L26 A;  2G3Q A;  1S3S A;  2EUC A;  2HAK A;  4LF7 M;  1L1Z A;  3GRV A;  2G5G X;  2HWJ A;  5FTK A;  1QZE A;  1TO0 A;  2LBC A;  2JNH A;  4L8R C;  1A5T A;  1G41 A;  2D7H A;  1NNJ A;  1OIP A;  1C1K A;  3EIE A;  4MH0 E;  1YUB A;  2RGO A;  3GLG A;  2O3A A;  3UZU A;  3J7B A;  4FWD A;  3GPX A;  3GQ5 A;  1NNU C;  5EQT A;  2CE7 A;  4YY3 M;  3U61 A;  4H3Z A;  4BB9 A;  2KW0 A;  4LG2 A;  3LQQ A;  2UUB M;  4KO8 A;  3GQ4 A;  1GVN A;  1OQY A;  2CFO A;  4GRI A;  4A3V B;  1Z5C A;  3RGS A;  1NO1 A;  4XGI A;  1N78 A;  3J27 B;  2QMM A;  2DHY A;  4HEO A;  4DV0 M;  4FW9 A;  2UXD M;  2X4A A;  3MJ5 A;  5KPR A;  2YY8 A;  1GLN A;  3QUV A;  4LZZ A;  1R2Y A;  2FE8 A;  3NBI A;  2JA2 A;  4NRW A;  3EIH A;  5GMB A;  1QUS A;  4LJA A;  4QOZ C;  1ZQ9 A;  5LMN M;  1P3Q Q;  3U5Z A;  2DWL A;  1SXJ E;  2WZJ A;  2Y20 A;  4YPW A;  4YQ2 A;  4FCT A;  4Y28 F;  2N35 A;  5ITX E;  4MCB A;  3BBZ A;  4LJ9 A;  5EXS A;  1G4A E;  2JY7 A;  1GKI A;  1OFH A;  4L4U A;  2JY5 A;  5EP1 A;  5C1B A;  1QQW A;  4B08 A;  2H1R A;  5FTN A;  3TWM A;  3DOA A;  3U6E A;  3L25 A;  1X7P A;  1XXH E;  3AOE C;  4II7 A;  5JI2 E;  3J2P B;  3GPP A;  2L7I A;  2OQ4 A;  2ZAN A;  4DUZ M;  4GHA A;  3BBD A;  2QNJ A;  2JZ1 A;  3L27 A;  4FWG A;  1Z6T A;  4TUW A;  4FCW A;  4LCB A;  4FMW A;  1UAM A;  3SAV A;  4IBI A;  1W5T A;  4PT5 A;  3C9P A;  4LY6 A;  3U6O A;  2J5Y A;  3VKG A;  1HNW M;  3AI9 X;  3B7Z A;  2Y0Q A;  5KO3 A;  3MK6 A;  3U6P A;  3HJS A;  3GLF A;  4LJ5 A;  3E46 A;  4LJ8 A;  1DO2 A;  3RFW A;  1IM2 A;  3T1Y M;  4JI6 M;  2R65 A;  2O01 F;  3IEC A;  3FUT A;  3HWS A;  5DFL A;  1OY5 A;  1OAO C;  1IBL M;  2QBY A;  3O7B A;  2KA6 B;  4IBK A;  2J7O A;  1FJG M;  1VQ1 A;  1UFZ A;  3B7N A;  3C3D A;  4XBO A;  2KRK A;  4YQQ A;  3HZJ A;  2LXE A;  4B3S M;  1MXI A;  4FAK A;  2XSZ A;  2FOI C;  2YFQ A;  1V6Z A;  1ZMW A;  2OPF A;  4NXM M;  2QWV A;  4AKG A;  3WHL A;  1NY6 A;  1EE8 A;  2CUZ A;  2J7N A;  4JWJ A;  4AQY M;  1QDR A;  1ZMU A;  3R9X B;  1TH4 A;  1TH3 A;  3RE8 A;  3K1J A;  1HQC A;  3KS4 A;  4JXJ A;  4GKK M;  3KTY A;  2F5Q A;  1Z85 A;  1IY0 A;  3KOZ E;  1J85 A;  2UU9 M;  2Z8Y M;  3IHP A;  1KSF X;  1IN5 A;  1GJS A;  4LFB M;  2DZO B;  3HJQ A;  5ITT A;  4QHS A;  1V2X A;  4YQB A;  2K47 A;  3AOE A;  3ILK A;  4DV1 M;  5KQD A;  4LFA M;  2DAM A;  3OIN A;  1IXS A;  2EJS A;  4ANR A;  4DV6 M;  2DAG A;  3FTC A;  2HHH M;  4D81 A;  3B74 A;  4I81 A;  4YQ0 A;  2DZL A;  2DHR A;  3FD9 A;  1YLA A;  4LF9 M;  1JB0 F;  3FUU A;  5KPT A;  4YPZ A;  2L2D A;  2LVP C;  2Y21 A;  2WSE F;  4G6Z A;  5KPZ A;  4AKI A;  1VHK A;  2W82 A;  3FRH A;  5ITX A;  2R62 A;  2NQ8 C;  1JQJ C;  4X3M A;  1ZV1 A;  4YPX A;  4HLQ A;  3KW2 A;  2XH9 A;  4YQL A;  1OIZ A;  2I7N A;  4FD2 A;  3SAU A;  4PCZ A;  3BOS A;  4X66 M;  1SXJ A;  1IXS B;  1NY5 A;  4Q7J A;  5IRE B;  1Z5B A;  3ZQJ A;  1T43 A;  3DA1 A;  1PGY A;  4QNR A;  1HT2 E;  3HHY A;  3SFZ A;  3GO8 A;  4DR3 M;  3R8F A;  4AG6 A;  3U6L A;  4B3R M;  2C96 A;  3GLI B;  4S12 A;  2ZBK B;  4WUR A;  3GRR A;  3LMM A;  2UUC M;  4B3M M;  4LF8 M;  1DO0 A;  2EKK A;  3KP1 E;  4IBJ A;  2QSF X;  4IJF A;  2R46 A;  1WHC A;  2MJ5 B;  4KLN A;  4QOS A;  1OJL A;  1XC8 A;  1NHW C;  1MN3 A;  3U6S A;  2X8A A;  4CGY B;  2QCU A;  4I5S A;  1PJI A;  1KFV A;  4FCV A;  2R0I A;  3K2L A;  2CRU A;  4L69 A;  2F5N A;  1SXJ D;  2QHO B;  4GIP A;  4AW4 A;  1N33 M;  4G4R A;  2ZM6 M;  2CWB A;  1HQY E;  1P9P A;  1JR3 A;  2CV1 A;  1TH2 A;  1BVS A;  2V6Z M;  4NOO B;  3U6C A;  1PJS A;  4LZJ A;  4Z8X A;  4YQ6 A;  5FAI A;  1XB2 B;  2L4F A;  3UMM A;  3W0L B;  3I04 M;  4AKH A;  4PZK A;  3A45 A;  4IBG A;  2D7G A;  4FVM A;  3HU3 A;  4REZ A;  3QYB A;  4OVZ B;  2BJW A;  1X37 A;  2CHV A;  3GPU A;  2JY6 B;  1UAL A;  3W67 A;  2DAE A;  2DAI A;  1K82 A;  1VDD A;  4CIZ A;  3C58 A;  4OX9 M;  4JI3 M;  4IBF A;  4IG6 A;  1WIV A;  4G3O A;  5FSW A;  2LHC A;  1L2C A;  3AXZ A;  4YQA A;  1IN8 A;  1AIP C;  1G71 A;  2LVO C;  2CHQ A;  3VK7 A;  2A5Y B;  3PFI A;  1V33 A;  5IZ7 D;  1DGH A;  2R45 A;  3E4R A;  1YE9 A;  3TWK A;  2QZ4 A;  3VLF B;  3NK6 A;  4J3C A;  4YVJ A;  3CF2 A;  3TE6 A;  4JAL A;  1L2B A;  4NSO B;  1GJT A;  4M9S A;  4Z6Y A;  5FLX S;  4YQO A;  2BNK A;  2LH0 A;  2DNA A;  1E94 E;  3KOW E;  3LCU A;  3FRI A;  1I4W A;  3PNY A;  3HHW A;  4GIT A;  3KSX A;  1LTM A;  2FH0 A;  1IQP A;  4CJ6 A;  2XFS A;  5EXX A;  1HR0 M;  2JP7 A;  4JYA M;  4YQ9 A;  2XLJ A;  1R2Z A;  3GLH E;  3IG5 A;  1HT1 E;  3JR4 A;  2L09 A;  3K9P A;  3U6D A;  4YQ5 A;  4LRS A;  4YQ7 A;  2CP8 A;  4YQ3 A;  4CNG A;  2XF3 A;  4KGN A;  4DV3 M;  1MU5 A;  3KXE C;  3KSJ A;  1XNQ M;  4KT0 F;  5EJC A;  3T15 A;  3F92 A;  1NXZ A;  1IY1 A;  4RG1 A;  1ZMV A;  1N32 M;  4IBE A;  2EGW A;  4MCD A;  2BWB A;  1D0L A;  4F1I A;  2EGV A;  1WGN A;  3QWL A;  3PNV A;  4B7F A;  3VDU A;  3AIA A;  5GMC A;  4DUY M;  1SXJ B;  1D0M A;  3SYK A;  1XNR M;  4K0K M;  3AOG A;  1NVM A;  1QDT A;  3LVV A;  5C18 A;  3FTF A;  3SHG B;  1GO5 A;  2GNO A;  2Z3X A;  4KDZ A;  1Z59 A;  1UAK A;  1IXR C;  2ZAO A;  3FUX A;  2DWZ B;  2DZN B;  4NSR A;  4G4N A;  3NBX X;  1F4I A;  4LJ4 A;  4AI6 A;  1DGB A;  1QZM A;  3Q8X A;  1VG5 A;  3SHF A;  2KZS A;  4HL4 A;  4XK8 F;  2R44 A;  3H4J A;  4LGM A;  3UK6 A;  5DNY A;  1N36 M;  3CF0 A;  2Z7J A;  2E5L M;  2YNM D;  3KW6 A;  1PJQ A;  1PJJ A;  1ORY B;  4YQR A;  2UXC M;  4GC5 A;  4NXN M;  1VHY A;  1DGF A;  3GRU A;  2ZAM A;  1PJT A;  5GKN A;  4ZPX A;  2VDB B;  5H37 D;  3CGW A;  1EIJ A;  2CX8 A;  2Z0Y A;  3E5Y A;  3N4J A;  1TR8 A;  1N34 M;  4MGY E;  4YHH M;  4FWH A;  4G4O A;  4YQT A;  4JI8 M;  2DKL A;  1J5E M;  2LVN C;  2EKF A;  1Q39 A;  2FS1 A;  2VQE M;  4CHT B;  2JXN A;  3GLH A;  3AFH A;  2ZTC A;  3NWL A;  3FUV A;  4M9Z A;  1K3X A;  4LRT A;  4RKU F;  1WXQ A;  3FUW A;  1HNX M;  2MGW A;  4L6V 6;  4D80 A;  3L8U A;  3K8Z A;  3FTE A;  2BJV A;  2VQF M;  3U6M A;  1SXJ C;  1YSY A;  3HKP A;  1VH0 A;  3L28 A;  3I4V A;  2HL7 A;  4BBA A;  1LV7 A;  2L4E A;  1L1T A;  3SC3 A;  2R18 A;  2BWE A;  4B7H A;  5ITY A;  4B7G A;  1G59 A;  1E9S A;  2VF8 A;  4WW0 A;  3U5Z B;  2XZF A;  1TTE A;  2JWS A;  4JI5 M;  2EO2 A;  3J7A S;  1HJP A;  1TDZ A;  2XSZ D;  5FTJ A;  2F5O A;  3TPZ A;  4MB7 A;  5JI3 E;  3CTW B;  1WR1 B;  1D2N A;  2EA0 A;  4JN6 A;  2V3J A;  3M0E A;  1HNZ M;  4L15 A;  1IBK M;  3GLF E;  3IC6 A;  2JUJ A;  4P17 A;  3UJN A;  4YQK A;  1QVR A;  3HJ8 A;  4LGY A;  4RNA A;  1L8Q A;  1NS5 A;  5GM8 A;  1Q3B A;  3GLI A;  3KP0 E;  3FYD A;  4DR6 M;  3DCM X;  3LVW A;  4GHL A;  5L8R F;  5D9F A;  4I4L A;  3Q8G A;  3WHK A;  2MRO B;  4IBC A;  3ZC7 B;  3GLG E;  3GLF B;  3A98 B;  4E8B A;  1OKS A;  4YVG A;  1GL6 A;  1IXZ A;  3K92 A;  2C98 A;  1OAI A;  2Z4R A;  4R7G A;  4CIS A;  4YPY A;  1TF0 B;  1JR3 D;  2JZ0 A;  2XFT A;  5EP4 A;  2OOB A;  3PVS A;  4M0D A;  2KXE A;  2M5Z A;  2WSF F;  4PD2 A;  3UGJ A;  2QBY B;  3I01 M;  3VDP A;  2V3K A;  1JR3 E;  3D8B A;  4IBB A;  5FTL A;  3GLI E;  5LMU M;  2QQ8 A;  2KNZ A;  1EFU B;  1SG9 A;  1IN6 A;  1UM8 A;  4P16 A;  5IWA M;  1R6B X;  2KNV A;  3T1H M;  3VK8 A;  2DEN A;  1IFY A;  2JY8 A;  3SAS A;  3OIJ A;  3K9O A;  4D82 A;  3B89 A;  4YQC A;  1CUK A;  2APL A;  3JR5 A;  1XHB A;  3IG8 A;  1N77 A;  3HU2 A;  1MJG M;  1IPA A;  3B7Q A;  3U60 B;  3GYQ A;  4DR7 M;  4NL4 H;  1J7K A;  1VEJ A;  3B9P A;  3T6P A;  4QNM A;  1OTR A;  1QAM A;  1W5S A;  4YQ1 A;  2Q2E B;  1G8P A;  1N75 A;  4DR2 M;  4GEW A;  2CHG A;  4B3T M;  3QYE A;  4MGI E;  2QPA A;  3E9S A;  3I51 A;  3SBJ A;  3ONP A;  1G3I A;  2V1U A;  1PRB A;  3PXG A;  1QAN A;  2C99 A;  4L78 A;  2C9O A;  3D8L A;  3J81 S;  4DV7 M;  1DV0 A;  3HHZ A;  4JWG A;  1XWI A;  3SAR A;  3MHV C;  3M7G A;  4PDG A;  1L2D A;  5DYG A;  1DGH B;  1XXH B;  2QP9 X;  3LW5 F;  5FTM A;  4LJ6 A;  3L29 A;  4M0W A;  2LTU A;  4AG5 A;  2V1C A;  3U60 A;  2KDL A;  2GQF A;  2Z4S A;  2FFJ A;  2OOA A;  3KOX E;  1DGG A;  4DV5 M;  1AUA A;  2I6D A;  4YQS A;  4MGK E;  4YQD A;  4OU7 A;  1NJG A;  1XMO M;  1GL7 A;  2C9C A;  4DV2 M;  1R7R A;  1XMQ M;  5CO4 A;  4W5W A;  2RGH A;  2KRU A;  4MM3 B;  2F4V M;  8CAT A;  1TGU A;  2UUA M;  1Q3C A;  4JV5 M;  2HCB A;  2VII A;  3QAU A;  2ERC A;  3GPY A;  3SAW A;  3KFU G;  1XXH A;  4MCC A;  3CF6 E;  1MX0 A;  1GAB A;  3H4M A;  2L7H A;  2HA8 A;  1NHG C;  4NC6 A;  4DR5 M;  4LJ7 A;  5BR8 M;  3KY7 A;  4JWH A;  4YQI A;  4MGZ E;  3TQS A;  2Y0T A;  4CND A;  3LCV B;  4LF4 M;  2KHH A;  3MMP A;  1E32 A;  3U6Q A;  1H6U A;  1RU3 A;  1Y8G A;  2HKJ A;  3SYL A;  7CAT A;  4X64 M;  1D0K A;  4JI4 M;  1UAJ A;  4X3L A;  2VF7 A;  3AKZ A;  2AHM A;  3AL0 C;  2XZU A;  3BBE A;  3I4Y A;  3HY5 A;  2CEA A;  2D7E A;  3C3E A;  4R71 A;  4DV4 M;  4GKJ M;  3A42 A;  3KOY E;  3BBH A;  2QEN A;  4H3Y A;  4QHT A;  5E6J A;  3OTO M;  4GMQ A;  3VKH A;  3RGP A;  1ZAE A;  3TL4 X;  3OII A;  1NJF A;  4YVH A;  2F5S A;  1NV9 A;  5EXP A;  2XEP A;  3AV0 A;  2LVA A;  5DYI A;  3W68 A;  2DAK A;  1QUT A;  2ZTD A;  4JI0 M;  3SMS A;  3GQ3 A;  1PM5 A;  2DWM A;  3AJI B;  4OW0 A;  2DWN A;  4YQ8 A;  4YQN A;  2OO9 A;  2YQZ A;  3GRY A;  2UXB M;  2I7P A;  4OVZ A;  4EIW A;  1VDL A;  5IT9 S;  1Z5A A;  4RF0 A;  1K3R A;  4R3D A;  4JI2 M;  2P5T A;  5KQ8 A;  1WJ7 A;  3LQR A;  4IIW A;  1QYR A;  2DI0 A;  2R4E A;  1IN4 A;  2G8L A;  2K0B X;  4PDI A;  4WP2 A;  4DR1 M;  1V92 A;  4X65 M;  1OFI A;  3BXW A;  1C7Y A;  4IJE A;  4DR4 M;  1T3T A;  1QAQ A;  2RKO A;  5EP3 A;  5ITQ A;  2CV0 A;  2DXI A;  2DVW B;  1R4G A;  2K6B A;  3HGI A;  1QAO A;  1NV8 A;  2LNH C;  3J80 S;  2F5P A;  4YQG A;  1X7O A;  3M6A A;  3FYC A;  4YQ4 A;  3GLH B;  3E21 A;  3A46 A;  1I94 M;  1O6D A;  1WGL A;  4NRV A;  5BPV A;  4YVK A;  3DFZ A;  4GH9 A;  3T38 A;  2XGN A;  2L6O A;  5EP2 A;  4BLC A;  2MH8 A;  4I8O A;  4LF5 M;  3N4K A;  4YQJ A;  3KNU A;  4CNE A;  3GP1 A;  3TWL A;  3HHX A;  2LHG A;  3L2A A;  5ITR A;  3THG A;  3VFD A;  3W0F A;  1VEK A;  2R4J A;  3V76 A;  3SAT A;  3FKE A;  1IN7 A;  5ITU A;  3KDS E;  5EXT A;  4JI1 M;  3HU1 A;  4KOD A;  4L16 A;  3KS8 A;  4MGH A;  4JAK A;  1K3W A;  2WSC F;  5E26 A;  3FTD A;  2YR0 A;  3HX3 A;  2KZU A;  3DZD A;  4M9X A;  2KEB A;  4AZF A;  2K9D A;  1KYI A;  2X49 A;  4X62 M;  4IBD A;  3FE3 A;  4JWF A;  4YQP A;  1Q02 A;  4RF1 A;  4YVI A;  1J09 A;  4G4Q A;  2MR9 A;  4JI7 M;  2O25 A;  4DBG B;  1IBM M;  1NSF A;  2O5R A;  3ZH9 B;  2C5R A;  2LWX A;  3KVW A;  2M60 A;  2R6F A;  3IEF A;  2FNA A;  4F2L A;  4KHP M;  5A2Q S;  4GC9 A;  1GZ0 A;  3GLG B;  4LF6 M;  2KNA A;  3ZCB B;  3SMP A;  4LFC M;  1R5L A;  2H5X A; 
#chains in the Genus database with same CATH homology
 3JAM S;  2CV2 A;  3NK7 A;  1TDH A;  1IY2 A;  1E9R A;  5F3W A;  4CNF A;  1ZJR A;  3U61 B;  1FNN A;  4ITQ A;  3L26 A;  1S3S A;  2EUC A;  4LF7 M;  1L1Z A;  3GRV A;  2G5G X;  5FTK A;  1TO0 A;  4L8R C;  1G41 A;  2D7H A;  1NNJ A;  1C1K A;  3EIE A;  4MH0 E;  1YUB A;  2RGO A;  3GLG A;  2O3A A;  3UZU A;  3J7B A;  4FWD A;  3GPX A;  3GQ5 A;  1NNU C;  5EQT A;  2CE7 A;  4YY3 M;  3U61 A;  4H3Z A;  4BB9 A;  2KW0 A;  4LG2 A;  3LQQ A;  2UUB M;  4KO8 A;  3GQ4 A;  1GVN A;  4GRI A;  2CFO A;  4A3V B;  1Z5C A;  3RGS A;  4XGI A;  1N78 A;  3J27 B;  2QMM A;  4DV0 M;  4FW9 A;  2X4A A;  3MJ5 A;  5KPR A;  2YY8 A;  1GLN A;  3QUV A;  4LZZ A;  1R2Y A;  2FE8 A;  3NBI A;  2JA2 A;  4NRW A;  3EIH A;  5GMB A;  4LJA A;  4QOZ C;  1ZQ9 A;  5LMN M;  3U5Z A;  2DWL A;  4YPW A;  1SXJ E;  2Y20 A;  4FCT A;  5ITX E;  4MCB A;  4LJ9 A;  5EXS A;  1G4A E;  1GKI A;  1OFH A;  4L4U A;  5EP1 A;  5C1B A;  1QQW A;  4B08 A;  2H1R A;  5FTN A;  3TWM A;  3DOA A;  3U6E A;  3L25 A;  1X7P A;  3AOE C;  4II7 A;  5JI2 E;  3J2P B;  3GPP A;  2L7I A;  2OQ4 A;  2ZAN A;  4DUZ M;  4GHA A;  3BBD A;  4FWG A;  3L27 A;  4TUW A;  1Z6T A;  4FMW A;  4FCW A;  4LCB A;  1UAM A;  3SAV A;  4IBI A;  1W5T A;  4PT5 A;  4LY6 A;  3U6O A;  3VKG A;  1HNW M;  3AI9 X;  5KO3 A;  2Y0Q A;  3MK6 A;  3U6P A;  3HJS A;  3GLF A;  4LJ5 A;  4LJ8 A;  1DO2 A;  3RFW A;  1IM2 A;  3T1Y M;  4JI6 M;  2R65 A;  1OY5 A;  3FUT A;  3HWS A;  1IBL M;  2QBY A;  3O7B A;  2KA6 B;  4IBK A;  2J7O A;  1FJG M;  4XBO A;  4YQQ A;  2KRK A;  4FAK A;  2LXE A;  4B3S M;  1MXI A;  2XSZ A;  2FOI C;  2YFQ A;  1V6Z A;  2OPF A;  4NXM M;  2QWV A;  4AKG A;  3WHL A;  1NY6 A;  1EE8 A;  2CUZ A;  2J7N A;  4JWJ A;  4AQY M;  3R9X B;  1TH4 A;  1TH3 A;  3RE8 A;  3K1J A;  1HQC A;  3KS4 A;  4JXJ A;  4GKK M;  3KTY A;  2F5Q A;  1Z85 A;  1IY0 A;  3KOZ E;  1J85 A;  2UU9 M;  1KSF X;  1IN5 A;  4LFB M;  2DZO B;  3HJQ A;  5ITT A;  4QHS A;  1V2X A;  4YQB A;  2K47 A;  3AOE A;  3ILK A;  4DV1 M;  5KQD A;  4LFA M;  3OIN A;  4DV6 M;  3FTC A;  2HHH M;  4D81 A;  4I81 A;  4YQ0 A;  2DHR A;  3FD9 A;  4LF9 M;  3FUU A;  5KPT A;  4YPZ A;  2Y21 A;  4G6Z A;  5KPZ A;  4AKI A;  1VHK A;  2W82 A;  5ITX A;  2R62 A;  2NQ8 C;  1JQJ C;  4X3M A;  4YPX A;  4HLQ A;  3KW2 A;  2XH9 A;  4YQL A;  2I7N A;  4FD2 A;  3SAU A;  4PCZ A;  3BOS A;  4X66 M;  1SXJ A;  1IXS B;  1NY5 A;  5IRE B;  1Z5B A;  3HHY A;  3DA1 A;  4QNR A;  3SFZ A;  1HT2 E;  3GO8 A;  4DR3 M;  3R8F A;  4B3R M;  4AG6 A;  3U6L A;  2C96 A;  3GLI B;  4S12 A;  2ZBK B;  4WUR A;  3GRR A;  3LMM A;  2UUC M;  4B3M M;  4LF8 M;  1DO0 A;  3KP1 E;  4IBJ A;  4IJF A;  2R46 A;  4KLN A;  4QOS A;  1OJL A;  1XC8 A;  1NHW C;  3U6S A;  2X8A A;  4CGY B;  2QCU A;  4I5S A;  1PJI A;  1KFV A;  4FCV A;  3K2L A;  4L69 A;  2F5N A;  1SXJ D;  4GIP A;  4AW4 A;  1N33 M;  4G4R A;  2ZM6 M;  1HQY E;  1P9P A;  1JR3 A;  2CV1 A;  1TH2 A;  2V6Z M;  4NOO B;  3U6C A;  4LZJ A;  4Z8X A;  4YQ6 A;  5FAI A;  3UMM A;  3W0L B;  4AKH A;  4PZK A;  3A45 A;  4IBG A;  2D7G A;  4FVM A;  3HU3 A;  4REZ A;  4OVZ B;  2BJW A;  1X37 A;  2CHV A;  3GPU A;  1UAL A;  1K82 A;  1VDD A;  4OX9 M;  3C58 A;  4JI3 M;  4IBF A;  4IG6 A;  5FSW A;  1L2C A;  3AXZ A;  4YQA A;  1IN8 A;  3VK7 A;  2CHQ A;  2A5Y B;  3PFI A;  5IZ7 D;  1DGH A;  2R45 A;  3E4R A;  1YE9 A;  3TWK A;  2QZ4 A;  3VLF B;  3NK6 A;  4J3C A;  4YVJ A;  3CF2 A;  3TE6 A;  4JAL A;  1L2B A;  4NSO B;  4M9S A;  4Z6Y A;  5FLX S;  4YQO A;  2BNK A;  2LH0 A;  3KOW E;  1E94 E;  1I4W A;  3PNY A;  3HHW A;  4GIT A;  3KSX A;  1IQP A;  2XFS A;  5EXX A;  1HR0 M;  4JYA M;  4YQ9 A;  2XLJ A;  1R2Z A;  3IG5 A;  1HT1 E;  3JR4 A;  2L09 A;  3U6D A;  4YQ5 A;  4LRS A;  4YQ7 A;  4YQ3 A;  4CNG A;  2XF3 A;  4KGN A;  4DV3 M;  1MU5 A;  3KXE C;  3KSJ A;  1XNQ M;  5EJC A;  3T15 A;  1NXZ A;  1IY1 A;  4RG1 A;  1N32 M;  4IBE A;  2EGW A;  4MCD A;  2EGV A;  3QWL A;  3AIA A;  3PNV A;  4B7F A;  3VDU A;  5GMC A;  4DUY M;  1SXJ B;  3SYK A;  1XNR M;  4K0K M;  3AOG A;  1NVM A;  3LVV A;  3FTF A;  5C18 A;  3SHG B;  2Z3X A;  4KDZ A;  1Z59 A;  1UAK A;  1IXR C;  2ZAO A;  3FUX A;  2DWZ B;  2DZN B;  4NSR A;  4G4N A;  4AI6 A;  4LJ4 A;  1DGB A;  1QZM A;  3Q8X A;  3SHF A;  2KZS A;  4HL4 A;  3UK6 A;  4LGM A;  5DNY A;  1N36 M;  3CF0 A;  2Z7J A;  2E5L M;  2YNM D;  3KW6 A;  1PJJ A;  1ORY B;  4YQR A;  2UXC M;  4GC5 A;  4NXN M;  1VHY A;  1DGF A;  3GRU A;  2ZAM A;  5GKN A;  4ZPX A;  5H37 D;  2CX8 A;  2Z0Y A;  3E5Y A;  3N4J A;  1N34 M;  4MGY E;  4YHH M;  4FWH A;  4G4O A;  4YQT A;  4JI8 M;  1J5E M;  1Q39 A;  2VQE M;  4CHT B;  3GLH A;  3AFH A;  3NWL A;  3FUV A;  4M9Z A;  1K3X A;  4LRT A;  1WXQ A;  3FUW A;  1HNX M;  4D80 A;  3L8U A;  3K8Z A;  3FTE A;  2BJV A;  2VQF M;  3U6M A;  1SXJ C;  1YSY A;  3HKP A;  1VH0 A;  3L28 A;  3I4V A;  2HL7 A;  4BBA A;  1LV7 A;  1L1T A;  3SC3 A;  2R18 A;  4B7H A;  5ITY A;  4B7G A;  1G59 A;  1E9S A;  4WW0 A;  3U5Z B;  2XZF A;  4JI5 M;  2EO2 A;  3J7A S;  1TDZ A;  2XSZ D;  5FTJ A;  2F5O A;  3TPZ A;  4MB7 A;  5JI3 E;  3CTW B;  1D2N A;  2EA0 A;  4JN6 A;  2V3J A;  3M0E A;  1HNZ M;  4L15 A;  1IBK M;  3IC6 A;  3UJN A;  4YQK A;  1QVR A;  3HJ8 A;  4LGY A;  4RNA A;  1L8Q A;  1NS5 A;  5GM8 A;  1Q3B A;  3GLI A;  3KP0 E;  3FYD A;  4DR6 M;  3DCM X;  3LVW A;  4GHL A;  5D9F A;  4I4L A;  3WHK A;  3ZC7 B;  4IBC A;  4E8B A;  3GLF B;  3A98 B;  4YVG A;  1GL6 A;  1IXZ A;  3K92 A;  2C98 A;  2Z4R A;  4R7G A;  4CIS A;  4YPY A;  1JR3 D;  2XFT A;  5EP4 A;  4M0D A;  3PVS A;  3UGJ A;  2KXE A;  2M5Z A;  4PD2 A;  2QBY B;  2V3K A;  3VDP A;  3D8B A;  4IBB A;  5FTL A;  5LMU M;  4YQ2 A;  2UXD M;  4P16 A;  1UM8 A;  1IN6 A;  5IWA M;  3T1H M;  1R6B X;  3VK8 A;  3SAS A;  3OIJ A;  4D82 A;  4YQC A;  3JR5 A;  1XHB A;  3IG8 A;  1N77 A;  3HU2 A;  1IPA A;  3U60 B;  3GYQ A;  4DR7 M;  4NL4 H;  1J7K A;  3B9P A;  4YQ1 A;  4QNM A;  1QAM A;  1W5S A;  1G8P A;  1N75 A;  2Q2E B;  4DR2 M;  2CHG A;  4B3T M;  4MGI E;  2QPA A;  3E9S A;  3I51 A;  3SBJ A;  3ONP A;  1G3I A;  2V1U A;  3PXG A;  1QAN A;  2C99 A;  4L78 A;  2C9O A;  3D8L A;  3J81 S;  4DV7 M;  3HHZ A;  1XWI A;  3SAR A;  3MHV C;  3M7G A;  4PDG A;  1L2D A;  5DYG A;  1DGH B;  2QP9 X;  1XXH B;  5FTM A;  3U60 A;  4LJ6 A;  3L29 A;  4M0W A;  4AG5 A;  2V1C A;  2Z4S A;  2FFJ A;  3KOX E;  1DGG A;  4DV5 M;  2I6D A;  4YQS A;  4MGK E;  4YQD A;  4OU7 A;  1NJG A;  1XMO M;  1GL7 A;  2C9C A;  4DV2 M;  1R7R A;  1XMQ M;  5CO4 A;  4W5W A;  2RGH A;  2KRU A;  4MM3 B;  2F4V M;  8CAT A;  1TGU A;  2UUA M;  1Q3C A;  4JV5 M;  2HCB A;  2VII A;  3QAU A;  2ERC A;  3GPY A;  3SAW A;  3KFU G;  1XXH A;  4MCC A;  3CF6 E;  1MX0 A;  3H4M A;  2L7H A;  2HA8 A;  1NHG C;  4JWH A;  4DR5 M;  4LJ7 A;  5BR8 M;  3KY7 A;  4YQI A;  4MGZ E;  3TQS A;  2Y0T A;  4CND A;  4LF4 M;  1E32 A;  3U6Q A;  1H6U A;  7CAT A;  3SYL A;  2HKJ A;  4X64 M;  4X3L A;  4JI4 M;  1UAJ A;  3BBE A;  3AKZ A;  2AHM A;  3AL0 C;  2XZU A;  3I4Y A;  2CEA A;  2D7E A;  4GKJ M;  4DV4 M;  3A42 A;  3KOY E;  3BBH A;  2QEN A;  4H3Y A;  4QHT A;  5E6J A;  3OTO M;  4GMQ A;  3VKH A;  3RGP A;  1ZAE A;  3TL4 X;  3OII A;  1NJF A;  4YVH A;  2F5S A;  5EXP A;  2XEP A;  3AV0 A;  5DYI A;  1PM5 A;  2DWN A;  4JI0 M;  3SMS A;  3GQ3 A;  2DWM A;  3AJI B;  4OW0 A;  4YQ8 A;  4YQN A;  2YQZ A;  3GRY A;  2UXB M;  2I7P A;  4OVZ A;  4EIW A;  5IT9 S;  1Z5A A;  4RF0 A;  1K3R A;  4R3D A;  4JI2 M;  2P5T A;  5KQ8 A;  3LQR A;  4IIW A;  1QYR A;  2R4E A;  1IN4 A;  2G8L A;  4PDI A;  4DR1 M;  4X65 M;  1OFI A;  4DR4 M;  4IJE A;  1T3T A;  1QAQ A;  2RKO A;  5EP3 A;  5ITQ A;  2CV0 A;  2DXI A;  2DVW B;  3HGI A;  4YQG A;  1QAO A;  2LNH C;  3J80 S;  2F5P A;  1X7O A;  3M6A A;  3FYC A;  4YQ4 A;  3GLH B;  3A46 A;  1I94 M;  1O6D A;  4NRV A;  5BPV A;  4YVK A;  4GH9 A;  3DFZ A;  3T38 A;  2XGN A;  2L6O A;  5EP2 A;  4BLC A;  4LF5 M;  4I8O A;  3N4K A;  4YQJ A;  3KNU A;  4CNE A;  3GP1 A;  3TWL A;  3HHX A;  5ITR A;  3L2A A;  3THG A;  3VFD A;  3W0F A;  2R4J A;  3SAT A;  3FKE A;  1IN7 A;  5ITU A;  3KDS E;  5EXT A;  4JI1 M;  3HU1 A;  4KOD A;  4L16 A;  3KS8 A;  4MGH A;  4JAK A;  1K3W A;  5E26 A;  3FTD A;  2YR0 A;  2KZU A;  3DZD A;  4M9X A;  2KEB A;  4AZF A;  4X62 M;  1KYI A;  2X49 A;  4IBD A;  4JWF A;  4YQP A;  4RF1 A;  4YVI A;  1J09 A;  4G4Q A;  4JI7 M;  1IBM M;  1NSF A;  2O5R A;  3ZH9 B;  2C5R A;  2LWX A;  3KVW A;  2M60 A;  3IEF A;  2FNA A;  4KHP M;  5A2Q S;  4GC9 A;  1GZ0 A;  3GLG B;  4LF6 M;  4LFC M;  3ZCB B;  3SMP A;  4JWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...