4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
4MCDA 4YQGA 3O7BA 4CNGA 4L69A 2YY8A 3BBHA 4JAKA 1TO0A 3OIIA 1VHKA 1ZJRA 2HA8A 4YPWA 1MXIA 5CO4A 2V3KA 5FAIA 4YPYA 4KGNA 1VH0A 1UALA 1UAJA 3E5YA 3ILKA 1NS5A 4YQ1A 4YQ6A 4YQLA 4YQQA 5GM8A 4YVHA 4KDZA 4YQNA 2EGWA 4YQRA 3BBEA 2CX8A 2EGVA 3L8UA 4YQ5A 4YVJA 3QUVA 1J85A 4YQAA 4YQJA 2Z0YA 4JALA 3IEFA 4YPXA 2O3AA 4CNFA 4E8BA 1V2XA 1IPAA 4FAKA 1P9PA 3AXZA 4YQ2A 4YQOA 1UAKA 4CNEA 4YPZA 4YQPA 4X3MA 4MCBA 4YQ3A 3IC6A 1X7OA 2V3JA 4YQ8A 3BBDA 3KY7A 4YQIA 3KTYA 4YQSA 4YVGA 3N4JA 5GMCA 4J3CA 3KW2A 4YVIA 4YVKA 2QWVA 4YQBA 4YQCA 1V6ZA 4CNDA 3OINA 4YQTA 1OY5A 3KNUA 3AI9X 4H3YA 3NK7A 2QMMA 4PZKA 5GMBA 1VHYA 4IG6A 3N4KA 1Z85A 5D9FA 3NK6A 3AIAA 1K3RA 4X3LA 3GYQA 4RG1A 1NXZA 4YQ9A 1UAMA 4YQKA 2I6DA 4YQDA 4XBOA 4YQ0A 1O6DA 3OIJA 1GZ0A 4YQ4A 3DCMX 3ONPA 4YQ7A 1X7PA 4H3ZA 4MCCA
chains in the Genus database with same CATH superfamily
4MCDA 4IBBA 4L69A 2Z7JA 3GPXA 1HT2E 4JAKA 3SATA 3OIIA 1IBKM 1QQWA 3NWLA 4YPWA 2QP9X 4PDGA 3QAUA 1HNWM 2V3KA 4X66M 4ANRA 4QNRA 3FTEA 1XXHE 3Q8XA 1UALA 3A42A 3T15A 4D81A 4LG2A 2KRUA 2UXCM 1X7OA 1E9SA 4DR3M 1GL6A 3ILKA 2R0IA 1NS5A 3K9PA 4R3DA 3GQ4A 1TH3A 1T43A 4S12A 3SYKA 3GLFE 5GKNA 5GM8A 3MK6A 5ITXE 4GEWA 1XNQM 2X8AA 4I8OA 3GLIB 4KDZA 4YQNA 4DV4M 2DWLA 2WSFF 1IY1A 1MJGM 3JAMS 1SXJB 5ITRA 1PJJA 3GLGE 1EIJA 4JWHA 1FNNA 4XGIA 4OX9M 3D8BA 1FJGM 1GJTA 2RKOA 4I81A 3TE6A 3A46A 1TH2A 1L1ZA 1IXRC 3U6OA 5KQDA 1G71A 1Q39A 2DHRA 2JXNA 2LVOC 4GHAA 4YQJA 3B74A 2I7NA 4LJAA 3U6EA 1E94E 2BJWA 5BR8M 3U5ZB 4DR5M 4L78A 5FTLA 5KPRA 4QHTA 2O3AA 4E8BA 3LCUA 1WIVA 3U6QA 3R9XB 4AI6A 4JWJA 3QYEA 1P9PA 4GKJM 1A5TA 3LVVA 4LF7M 2DAIA 2MJ5B 2BWBA 2BWEA 2WZJA 4IBGA 3VDPA 1PRBA 3A45A 3GRRA 4F2LA 1NJFA 3VK8A 1QAQA 3KP0E 3SAVA 1K3XA 3CGWA 1GO5A 4P16A 4LJ6A 4X3MA 3UK6A 2DZLA 4JV5M 1XNRM 2K0BX 1Z5CA 2V3JA 4B3SM 4YQ8A 4Z6YA 4FWHA 4M9ZA 3KSXA 3E46A 4DV5M 2QPAA 1PJIA 3KY7A 4YQIA 2X4AA 3UZUA 4G4QA 3ZQJA 2KNVA 3FKEA 1HQCA 4MGZE 4AZFA 3SC3A 3I01M 1KSFX 3SARA 3KOYE 4PD2A 4JWGA 2FE8A 3FRHA 1G3IA 2XSZD 3KP1E 1OJLA 4L6V6 3GQ5A 2L4EA 1F4IA 3OINA 2KRKA 3LW5F 3KOWE 7CATA 4B3MM 3KOXE 1DO2A 4JI1M 2QHOB 3D8LA 3B7ZA 5GMBA 3FTDA 2KXEA 2KA6B 3F92A 2XLJA 2MH8A 4B7GA 5LMNM 2UXBM 3K92A 3NK6A 2ZM6M 4QOZC 3SMSA 3L28A 2CV2A 3HHYA 1K3RA 2CP8A 3HGIA 5ITUA 3A98B 1J7KA 3Q8GA 4I4LA 1UAMA 3K2LA 2LVQD 4YQDA 3GQ3A 1TR8A 2X49A 1T6OA 3OIJA 4IBKA 3GRUA 3AOEA 3EIHA 4NXNM 4CIZA 5ITQA 5EXTA 2C9CA 2YFQA 2M60A 1SXJD 4FCVA 4D82A 2JA2A 3GRYA 3U6MA 3ONPA 3CTWB 2XH9A 3SFZA 2QCUA 2FOIC 1OTRA 3JR5A 3HHXA 1GABA 2UUAM 1EE8A 5FTJA 1P3QQ 4BB9A 4YQGA 3DA1A 2CRUA 1XWIA 4LGMA 4OVZB 2HWJA 2DENA 3GRVA 2I7PA 2LVAA 2EO2A 4M9XA 4DV7M 2VQEM 2L2DA 4LJ4A 1K82A 4OW0A 1KFVA 5CO4A 2DAKA 2XFTA 3AFHA 1YE9A 2FS1A 3C9PA 3SYLA 5FAIA 2QSFX 2M5ZA 3VK7A 4KGNA 4LF8M 2UU9M 1XXHA 4L8RC 3ZH9B 2ZANA 2XZFA 2JZ1A 1SG9A 3MHVC 1PJQA 4IBDA 1GL7A 3AKZA 3E5YA 3GO8A 1V34A 4TUWA 3GLHB 4JI6M 4LFAM 4YQ6A 3GLFA 2JY7A 2Y0TA 4YQLA 1H6UA 1PGYA 2KDLA 1IXSA 1TGUA 5ITXA 1G4AE 4KODA 1MX0A 4BBAA 4YVHA 5ITYA 3CF0A 2Q2EB 3K9OA 2D7GA 2JY5A 2LNHC 3FTCA 4LF5M 1QANA 2W82A 3GLGA 2CFOA 3LMMA 3C58A 3U6LA 2DXIA 3SAUA 3M7GA 3L8UA 2O25A 4FVMA 2VDBB 3RGSA 2OQ4A 3U60B 4L4UA 2LVNC 4NSOB 4B08A 1DGGA 2C98A 4LJ7A 4JI4M 3AV0A 5F3WA 2L09A 2QZ4A 3VFDA 3HJ8A 1IN5A 1Z6TA 2VIIA 3GLIE 1X37A 1MN3A 5A2QS 1Z5BA 3I4YA 2OPFA 1QVRA 4LY6A 2FH0A 1SXJE 1DV0A 1IN8A 1UFZA 3U61A 2V1CA 1IBLM 3AXZA 4CJ6A 4LJ9A 4QNMA 1Y8GA 2DHYA 2R4JA 4YQPA 1WHCA 4CNEA 1D2NA 4MCBA 1Z5AA 4NRVA 1QUSA 3J80S 3IC6A 3BXWA 2DWMA 5IWAM 2ZAOA 4Y28F 2QQ8A 4JI0M 2LBCA 4HL4A 3HJSA 1YUBA 1IQPA 4YVGA 3N4JA 4GHLA 1Q02A 4P17A 2OOBA 5FTKA 1JR3D 3SBJA 2WSCF 3PNYA 4YVKA 2F5QA 1V6ZA 4HEOA 4NSRA 4X64M 1TH4A 1XMQM 1R2YA 4CNDA 4KLNA 4YHHM 5L8RF 4LZZA 1AIPC 4A3VB 4LJ5A 2F4VM 2KNAA 4YQTA 5FLXS 4DR6M 2KHHA 2O01F 2ZAMA 5KO3A 4G4RA 1HR0M 3FYDA 2D7HA 4IBCA 4R7GA 2DWZB 4QOSA 2O5RA 2LHCA 3I04M 4G4NA 2HL7A 3N4KA 4GH9A 1DGHB 2DZNB 1N32M 5C18A 2FNAA 4NXMM 2CUZA 4MGKE 2CHQA 1VDLA 4JXJA 1NV9A 1ORYB 3HJQA 4DUZM 4YQKA 2I6DA 2ZTDA 3HY5A 2Z3XA 4FCWA 4XBOA 4JI8M 1V92A 2EUCA 2RRUA 3FUUA 1R7RA 3AL0C 4GKKM 3J27B 1XC8A 2CV1A 4F1IA 3FUWA 4JI5M 3LVWA 2QBYA 2KNZA 4GC5A 1OFIA 2L7HA 1IN7A 4MCCA 4DV2M 1VG5A 3SMPA 3AOEC 3W68A 1OIZA 3O7BA 4CNGA 3DOAA 3CF2A 2K6BA 1L2CA 2YY8A 2JUJA 1C1KA 2DWNA 4JN6A 1TO0A 4NL4H 2HA8A 1OAOC 2Z8YM 3J2PB 1MXIA 1IN4A 2EKFA 5EQTA 2MR9A 2JY8A 2C99A 3UMMA 4IJEA 1OFHA 4WP2A 1VEKA 3TWMA 1LV7A 1N34M 2ZBKB 3B7NA 2BJVA 1JR3E 3HX3A 2DAEA 2UUBM 1UAJA 4MGIE 1EFUB 1N36M 2C5RA 4YQ1A 3TQSA 2HKJA 1UAKA 1JQJC 1TDHA 2XSZA 3PXGA 4DR2M 3U6DA 2CEAA 1ZMUA 3RE8A 5JI2E 4YQQA 1IBMM 5EXPA 5EP2A 2QNJA 4NRWA 4LFBM 4MM3B 1UM8A 2N35A 4IBJA 1VEGA 5EP1A 1S3SA 1IXZA 1QDRA 3I51A 3LQRA 3TWKA 2EGWA 5DYIA 5H37D 4YQRA 5EP3A 3PVSA 3HU3A 2F5OA 3BBZA 3KDSE 1VEJA 2EGVA 1G41A 4XK8F 4YQ5A 4NOOB 1NV8A 2J7NA 4DR7M 3QUVA 2JZ0A 3AOGA 3FYCA 2DNAA 3HU2A 1QUTA 2WSEF 3GLHE 4WW0A 4DR1M 1W5TA 5IT9S 1OQYA 4FW9A 4AG5A 3FUTA 3GPUA 4R71A 4FCTA 1K3WA 3GLIA 4Q7JA 1QZEA 3LCVB 4NC6A 1DO0A 4YPXA 3FUVA 1N33M 1V2XA 1G8PA 1SXJA 2AHMA 5DYGA 4FAKA 3SHGB 4AW4A 2NQ8C 3T38A 4DBGB 2MGWA 4WURA 3VLFB 1WXQA 4AQYM 4YQOA 2RGOA 3J7BA 1KYIA 2LXEA 4YY3M 5IZ7D 4RNAA 4AG6A 3E4RA 3HWSA 1Z59A 3BOSA 1V33A 4LRSA 2J7OA 2CHGA 2YQZA 1HJPA 4IBIA 2APLA 5DNYA 3U6SA 3KXEC 4FWDA 3U5ZA 2R46A 3TPZA 4LGYA 4G3OA 4MGYE 3KTYA 4YQSA 4Z8XA 4X65M 1NHWC 4M0WA 3M0EA 1MU5A 1NSFA 2QENA 4FWGA 3WHKA 4J3CA 3FUXA 3KW2A 3K8ZA 3TL4X 4YVIA 2QWVA 4YQCA 3FTFA 4FD2A 1RU3A 1N78A 3CF6E 5EJCA 3IECA 2P5TA 1W5SA 1OY5A 3V76A 3KNUA 1R5LA 3H4JA 4KO8A 4LZJA 3EIEA 1G59A 2B3TA 4KHPM 1IN6A 3L27A 4REZA 5FTNA 5JI3E 2QMMA 3SHFA 4PDIA 1I94M 1VHYA 1HQYE 3NK7A 3IHPA 4IG6A 2CV0A 1IM2A 1VQ1A 2JNHA 5D9FA 4DV3M 1NY5A 2EJSA 2EKKA 3WHLA 3UGJA 4LFCM 5KPZA 3B7QA 3HKPA 2R45A 4LJ8A 1NNJA 4D80A 4RF1A 2VF7A 2CWBA 2DZOB 4MGHA 4YQ9A 2JY6B 2G3QA 3W0LB 3LQQA 5BPVA 4FMWA 1YLAA 2JWSA 3T1YM 2OO9A 4L16A 1O6DA 4JWFA 4AKGA 4MH0E 4YQ4A 1OIPA 5EXXA 2Y21A 1WGLA 3KSJA 4LF4M 2D7EA 5C1BA 1XXHB 1NHGC 2KW0A 2R62A 3DCMX 1J09A 4IIWA 3RGPA 1TDZA 1X7PA 1QAOA 1Q3CA 2GQFA 4G4OA 2A5YB 2CE7A 4EIWA 2VQFM 4B7FA 3VKHA 2XFSA 5E26A 4AKHA 1PM5A 3QWLA 3I4VA 3BBHA 2ERCA 4CHTB 1IY2A 3GLFB 3KVWA 3JR4A 3KS4A 3NBIA 3OTOM 1ZJRA 1VHKA 1IXSB 3VDUA 1C7YA 1XHBA 2K9DA 4CISA 3TWLA 4YPYA 5EXSA 2HHHM 4JI2M 1BVSA 5EP4A 1NO1A 1DGFA 3GLGB 1VH0A 1JR3A 2C96A 1R4GA 4JYAM 2LWXA 2DI0A 3T6PA 4GITA 3PNVA 2F5NA 1L8QA 4GC9A 1DGBA 3E21A 3E9SA 3HU1A 3B9PA 2LHGA 4OVZA 4PT5A 1N75A 4KT0F 1QYRA 1WGNA 1ZMWA 2EA0A 4B3TM 2CHVA 2XEPA 5IREB 1WR1B 4BLCA 4I5SA 2UXDM 3L2AA 1L2DA 2C9OA 3FD9A 4M0DA 4PCZA 3GP1A 1L1TA 2CX8A 4L15A 4RF0A 3U61B 3BBEA 4G6ZA 1N77A 1IY0A 4LF9M 4YVJA 1HNZM 3KS8A 3KFUG 1J85A 1D0MA 1XB2B 2G5GX 4YQAA 2BNKA 1AUAA 4B3RM 3GLHA 2H1RA 1QDTA 2YNMD 2MROB 1JB0F 1TF0B 2R4EA 2Z0YA 3C3DA 4UN2B 5KQ8A 1PJSA 1E32A 3SASA 1WJ7A 5FSWA 4X62M 2KEBA 3IG8A 2Y0QA 1E9RA 5KPTA 3B89A 3R8FA 3IEFA 4JALA 4CNFA 4ITQA 3GPYA 1GVNA 1IPAA 2KZSA 3GPPA 2DKLA 5FTMA 1R2ZA 2HAKA 1GJSA 2XGNA 1ZQ9A 2XZUA 4YQ2A 2J5YA 3RFWA 3DFZA 3U60A 1NJGA 1OAIA 2LTUA 4DUYM 3L29A 4DV0M 1T3TA 2DAGA 4DR4M 4YPZA 4YQ3A 2L7IA 1SXJC 3MMPA 3UJNA 4AKIA 2GNOA 3FRIA 3MJ5A 3PFIA 3K1JA 3H4MA 1I4WA 2VF8A 2ZTCA 1J5EM 4LRTA 3HHZA 1NVMA 2Z4RA 1Q3BA 3FE3A 3M6AA 4QHSA 3BBDA 1D0LA 1GLNA 2R18A 4IBEA 1VDDA 2YR0A 1OKSA 5GMCA 2KZUA 4M9SA 3L26A 1GKIA 2L4FA 3AJIB 3QYBA 2F5PA 1HNXM 4W5WA 4YQBA 4K0KM 1ZV1A 1XMOM 2H5XA 4JI3M 2FFJA 3J81S 4RKUF 5DFLA 3W67A 2DVWB 1D0KA 3AI9X 3ZC7B 1R6BX 2Z4SA 2UUCM 4H3YA 3IG5A 2LVPC 3HZJA 4PZKA 1PJTA 4JI7M 1NY6A 1LTMA 2Y20A 2R65A 1ZMVA 1Z85A 2QBYB 3AIAA 4LCBA 5ITTA 4MB7A 1HT1E 3C3EA 2DAMA 3SAWA 2R44A 2V6ZM 2XF3A 2E5LM 2F5SA 1IFYA 4X3LA 1NNUC 2LH0A 3GYQA 4ZPXA 4RG1A 1NXZA 3J7AS 3HHWA 4IJFA 3THGA 3W0FA 1TTEA 8CATA 4OU7A 5LMUM 4LF6M 2RGHA 2K47A 3U6CA 4YQ0A 4CGYB 2G8LA 1GZ0A 3VKGA 2JP7A 3U6PA 5E6JA 1L2BA 3NBXX 3T1HM 2V1UA 3L25A 4HLQA 4DV6M 4DV1M 2R6FA 1QAMA 2HCBA 1ZAEA 2OOAA 3ZCBB 4YQ7A 1DGHA 1YSYA 3KOZE 1QZMA 4GIPA 4II7A 4GRIA 2L6OA 3DZDA 4IBFA 3KW6A 4B7HA 4GMQA 1CUKA 4H3ZA
chains in the Genus database with same CATH topology
4MCDA 4IBBA 4L69A 2Z7JA 3GPXA 1HT2E 4JAKA 3SATA 3OIIA 1IBKM 1QQWA 3NWLA 4YPWA 2QP9X 4PDGA 3QAUA 1HNWM 2V3KA 4X66M 4QNRA 3FTEA 3Q8XA 1UALA 3A42A 3T15A 4D81A 4LG2A 2KRUA 2UXCM 1E9SA 4DR3M 1GL6A 3ILKA 1NS5A 4R3DA 3GQ4A 1TH3A 4S12A 3SYKA 5GKNA 5GM8A 3MK6A 5ITXE 1XNQM 2X8AA 4I8OA 3GLIB 4KDZA 4YQNA 4DV4M 2DWLA 1IY1A 5ITRA 3JAMS 1SXJB 1PJJA 4JWHA 1FNNA 4XGIA 4OX9M 3D8BA 1FJGM 2RKOA 4I81A 3TE6A 3A46A 1TH2A 1L1ZA 1IXRC 3U6OA 5KQDA 2DHRA 1Q39A 4GHAA 4YQJA 2I7NA 4LJAA 3U6EA 1E94E 2BJWA 5BR8M 3U5ZB 4DR5M 4L78A 5FTLA 5KPRA 4QHTA 2O3AA 4E8BA 3U6QA 3R9XB 4JWJA 4AI6A 1P9PA 4GKJM 3LVVA 4LF7M 3VDPA 1UAKA 4IBGA 3VK8A 3A45A 3GRRA 1NJFA 1K3XA 1QAQA 3KP0E 3SAVA 4P16A 4LJ6A 4X3MA 3UK6A 4JV5M 1XNRM 1Z5CA 2V3JA 4B3SM 4YQ8A 4Z6YA 4FWHA 4M9ZA 3KSXA 4DV5M 1PJIA 2QPAA 3KY7A 4YQIA 2X4AA 3UZUA 4G4QA 3FKEA 1HQCA 4MGZE 4AZFA 3SC3A 1KSFX 3SARA 3KOYE 4PD2A 4JWGA 2FE8A 1G3IA 2XSZD 3KP1E 1OJLA 3GQ5A 3OINA 2KRKA 3KOWE 7CATA 4B3MM 3KOXE 1DO2A 4JI1M 5GMBA 3D8LA 3FTDA 2KXEA 2KA6B 2XLJA 4B7GA 5LMNM 2UXBM 3K92A 3NK6A 2ZM6M 4QOZC 3SMSA 3L28A 2CV2A 3HHYA 1K3RA 3HGIA 5ITUA 3A98B 1J7KA 4I4LA 1UAMA 3K2LA 4YQDA 3GQ3A 2X49A 3OIJA 4IBKA 3GRUA 3AOEA 3EIHA 4NXNM 5ITQA 5EXTA 2C9CA 2YFQA 2M60A 1SXJD 4FCVA 4D82A 3GRYA 2JA2A 3U6MA 3ONPA 3CTWB 2XH9A 3SFZA 2QCUA 2FOIC 3JR5A 3HHXA 2UUAM 1EE8A 5FTJA 4BB9A 4YQGA 3DA1A 4LGMA 1XWIA 4OVZB 3GRVA 2I7PA 2EO2A 4M9XA 4DV7M 2VQEM 4LJ4A 1K82A 4OW0A 1KFVA 5CO4A 2XFTA 3AFHA 1YE9A 3SYLA 5FAIA 2M5ZA 3VK7A 4KGNA 4LF8M 2UU9M 1XXHA 4L8RC 3ZH9B 2ZANA 2XZFA 4IBDA 3MHVC 3E5YA 1GL7A 3AKZA 3GO8A 4TUWA 3GLHB 4JI6M 4LFAM 4YQ6A 3GLFA 4YQLA 2Y0TA 1H6UA 1TGUA 5ITXA 4BBAA 1G4AE 4KODA 1MX0A 4YVHA 5ITYA 3CF0A 2Q2EB 2D7GA 2LNHC 3FTCA 4LF5M 1QANA 2W82A 3GLGA 2CFOA 3LMMA 3C58A 3U6LA 2DXIA 3SAUA 3M7GA 3L8UA 4FVMA 3RGSA 2OQ4A 3U60B 4L4UA 4NSOB 4B08A 1DGGA 2C98A 4LJ7A 4JI4M 3AV0A 5F3WA 2L09A 2QZ4A 3VFDA 3HJ8A 1IN5A 1Z6TA 2VIIA 1X37A 5A2QS 1Z5BA 3I4YA 2OPFA 1QVRA 4LY6A 1SXJE 1IN8A 3U61A 2V1CA 1IBLM 3AXZA 4LJ9A 4QNMA 4CNEA 2R4JA 4YQPA 1D2NA 4MCBA 1Z5AA 4NRVA 3J80S 3IC6A 2DWMA 5IWAM 2ZAOA 4JI0M 4HL4A 3HJSA 1YUBA 1IQPA 4YVGA 3N4JA 4GHLA 5FTKA 1JR3D 3SBJA 3PNYA 4YVKA 2F5QA 1V6ZA 4NSRA 4X64M 1TH4A 1XMQM 1R2YA 4CNDA 4KLNA 4YHHM 4LZZA 4A3VB 4LJ5A 2F4VM 4YQTA 5FLXS 4DR6M 2ZAMA 5KO3A 4G4RA 1HR0M 3FYDA 2D7HA 4IBCA 4R7GA 2DWZB 4QOSA 2O5RA 4G4NA 2HL7A 3N4KA 4GH9A 1DGHB 2DZNB 1N32M 5C18A 2FNAA 4NXMM 2CUZA 4MGKE 2CHQA 4JXJA 1ORYB 3HJQA 4DUZM 4YQKA 2I6DA 2Z3XA 4FCWA 4XBOA 4JI8M 4GKKM 2EUCA 3FUUA 3AL0C 1R7RA 3J27B 1XC8A 2CV1A 3FUWA 4JI5M 3LVWA 2QBYA 4GC5A 1OFIA 2L7HA 1IN7A 4MCCA 4DV2M 3SMPA 3AOEC 3O7BA 4CNGA 3DOAA 3CF2A 1L2CA 2YY8A 1C1KA 2DWNA 4JN6A 1TO0A 4NL4H 2HA8A 3J2PB 1MXIA 1IN4A 5EQTA 2C99A 3UMMA 4IJEA 1OFHA 1N34M 3TWMA 1LV7A 2ZBKB 2BJVA 1UAJA 2UUBM 4MGIE 1N36M 2C5RA 4YQ1A 3TQSA 2HKJA 1JQJC 1TDHA 2XSZA 3PXGA 4DR2M 3U6DA 2CEAA 3RE8A 5JI2E 4YQQA 1IBMM 5EXPA 5EP2A 4NRWA 4LFBM 4MM3B 1UM8A 5EP1A 4IBJA 1S3SA 1IXZA 3I51A 3LQRA 3TWKA 2EGWA 5DYIA 5H37D 4YQRA 5EP3A 3PVSA 3HU3A 2F5OA 3KDSE 2EGVA 1G41A 4YQ5A 4NOOB 3QUVA 2J7NA 4DR7M 3AOGA 3FYCA 3HU2A 4DR1M 4WW0A 5IT9S 1W5TA 4FW9A 4AG5A 3FUTA 3GPUA 4FCTA 1K3WA 3GLIA 1DO0A 4YPXA 3FUVA 1N33M 1V2XA 1G8PA 1SXJA 2AHMA 5DYGA 4FAKA 3SHGB 4AW4A 2NQ8C 3T38A 4WURA 3VLFB 1WXQA 4AQYM 4YQOA 2RGOA 3J7BA 1KYIA 2LXEA 4YY3M 5IZ7D 4RNAA 4AG6A 3E4RA 3HWSA 1Z59A 3BOSA 4LRSA 2J7OA 2CHGA 2YQZA 4IBIA 5DNYA 3U6SA 3KXEC 4FWDA 3U5ZA 2R46A 3TPZA 4LGYA 3KTYA 4MGYE 4YQSA 4Z8XA 4X65M 1NHWC 4M0WA 3M0EA 1MU5A 1NSFA 2QENA 4FWGA 3WHKA 4J3CA 3FUXA 3KW2A 3K8ZA 3TL4X 4YVIA 2QWVA 4YQCA 3FTFA 4FD2A 1N78A 3CF6E 5EJCA 2P5TA 1W5SA 1OY5A 3KNUA 4KO8A 4LZJA 3EIEA 1G59A 4KHPM 1IN6A 3L27A 4REZA 5FTNA 5JI3E 2QMMA 3SHFA 4PDIA 1I94M 1VHYA 1HQYE 3NK7A 4IG6A 2CV0A 1IM2A 5D9FA 4DV3M 1NY5A 3UGJA 3WHLA 4LFCM 5KPZA 3HKPA 2R45A 4LJ8A 1NNJA 4D80A 4RF1A 4MGHA 2DZOB 4YQ9A 3W0LB 3LQQA 5BPVA 4FMWA 3T1YM 1O6DA 4L16A 4JWFA 4AKGA 4MH0E 4YQ4A 5EXXA 2Y21A 3KSJA 4LF4M 2D7EA 5C1BA 1XXHB 1NHGC 2KW0A 2R62A 3DCMX 1J09A 4IIWA 3RGPA 1TDZA 1X7PA 1QAOA 1Q3CA 4G4OA 2A5YB 2CE7A 4EIWA 2VQFM 4B7FA 3VKHA 2XFSA 5E26A 4AKHA 1PM5A 3QWLA 3I4VA 3BBHA 2ERCA 4CHTB 1IY2A 3GLFB 3KVWA 3JR4A 3KS4A 3NBIA 3OTOM 1ZJRA 1VHKA 1IXSB 3VDUA 1XHBA 4CISA 3TWLA 4YPYA 5EXSA 2HHHM 4JI2M 3GLGB 5EP4A 1VH0A 1DGFA 1JR3A 2C96A 4JYAM 2LWXA 4GITA 3PNVA 2F5NA 1L8QA 4GC9A 1DGBA 3HU1A 3E9SA 3B9PA 4OVZA 4PT5A 1N75A 1QYRA 2EA0A 4B3TM 2CHVA 2XEPA 5IREB 4BLCA 4I5SA 2UXDM 3L2AA 1L2DA 2C9OA 3FD9A 4M0DA 4PCZA 3GP1A 1L1TA 2CX8A 4L15A 4RF0A 3U61B 3BBEA 4G6ZA 1N77A 1IY0A 4LF9M 4YVJA 1HNZM 3KS8A 3KFUG 1J85A 2G5GX 4YQAA 2BNKA 4B3RM 3GLHA 2H1RA 2YNMD 2R4EA 2Z0YA 5KQ8A 1E32A 3SASA 4X62M 5FSWA 2KEBA 3IG8A 2Y0QA 1E9RA 5KPTA 4JALA 3R8FA 3IEFA 4CNFA 4ITQA 3GPYA 1GVNA 1IPAA 2KZSA 3GPPA 5FTMA 1R2ZA 2XGNA 1ZQ9A 2XZUA 4YQ2A 3RFWA 3DFZA 3U60A 1NJGA 4YPZA 4DV0M 4DUYM 3L29A 4DR4M 1T3TA 4YQ3A 2L7IA 1SXJC 3UJNA 4AKIA 3MJ5A 3PFIA 3K1JA 3H4MA 1I4WA 1X7OA 1J5EM 4LRTA 3HHZA 1NVMA 2Z4RA 1Q3BA 3M6AA 4QHSA 3BBDA 1GLNA 2R18A 4IBEA 1VDDA 2YR0A 5GMCA 2KZUA 4M9SA 3L26A 1GKIA 3AJIB 2F5PA 1HNXM 4W5WA 4YQBA 4K0KM 1XMOM 4JI3M 2FFJA 3J81S 2DVWB 3AI9X 3ZC7B 1R6BX 2Z4SA 2UUCM 4H3YA 3IG5A 4PZKA 4JI7M 1NY6A 2Y20A 2R65A 1Z85A 2QBYB 3AIAA 4LCBA 5ITTA 4MB7A 1HT1E 3SAWA 2E5LM 2V6ZM 2XF3A 2F5SA 4X3LA 1NNUC 2LH0A 3GYQA 4ZPXA 4RG1A 1NXZA 3J7AS 3HHWA 4IJFA 3THGA 3W0FA 4OU7A 8CATA 5LMUM 4LF6M 2RGHA 2K47A 3U6CA 4YQ0A 4CGYB 2G8LA 1GZ0A 3VKGA 3U6PA 5E6JA 1L2BA 2V1UA 3T1HM 3L25A 4HLQA 4DV6M 4DV1M 1QAMA 2HCBA 1ZAEA 3ZCBB 4YQ7A 1DGHA 1YSYA 3KOZE 1QZMA 4GIPA 4II7A 4GRIA 2L6OA 3DZDA 4IBFA 3KW6A 4B7HA 4GMQA 4H3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCD A;  4YQG A;  3O7B A;  4CNG A;  4L69 A;  2YY8 A;  3BBH A;  4JAK A;  1TO0 A;  3OII A;  1VHK A;  1ZJR A;  2HA8 A;  4YPW A;  1MXI A;  5CO4 A;  2V3K A;  5FAI A;  4YPY A;  4KGN A;  1VH0 A;  1UAL A;  1UAJ A;  3E5Y A;  3ILK A;  1NS5 A;  4YQ1 A;  4YQ6 A;  4YQL A;  4YQQ A;  5GM8 A;  4YVH A;  4KDZ A;  4YQN A;  2EGW A;  4YQR A;  3BBE A;  2CX8 A;  2EGV A;  3L8U A;  4YQ5 A;  4YVJ A;  3QUV A;  1J85 A;  4YQA A;  4YQJ A;  2Z0Y A;  4JAL A;  3IEF A;  4YPX A;  2O3A A;  4CNF A;  4E8B A;  1V2X A;  1IPA A;  4FAK A;  1P9P A;  3AXZ A;  4YQ2 A;  4YQO A;  1UAK A;  4CNE A;  4YPZ A;  4YQP A;  4X3M A;  4MCB A;  4YQ3 A;  3IC6 A;  1X7O A;  2V3J A;  4YQ8 A;  3BBD A;  3KY7 A;  4YQI A;  3KTY A;  4YQS A;  4YVG A;  3N4J A;  5GMC A;  4J3C A;  3KW2 A;  4YVI A;  4YVK A;  2QWV A;  4YQB A;  4YQC A;  1V6Z A;  4CND A;  3OIN A;  4YQT A;  1OY5 A;  3KNU A;  3AI9 X;  4H3Y A;  3NK7 A;  2QMM A;  4PZK A;  5GMB A;  1VHY A;  4IG6 A;  3N4K A;  1Z85 A;  5D9F A;  3NK6 A;  3AIA A;  1K3R A;  4X3L A;  3GYQ A;  4RG1 A;  1NXZ A;  4YQ9 A;  1UAM A;  4YQK A;  2I6D A;  4YQD A;  4XBO A;  4YQ0 A;  1O6D A;  3OIJ A;  1GZ0 A;  4YQ4 A;  3DCM X;  3ONP A;  4YQ7 A;  1X7P A;  4H3Z A;  4MCC A; 
#chains in the Genus database with same CATH topology
 4MCD A;  4IBB A;  4L69 A;  2Z7J A;  3GPX A;  1HT2 E;  4JAK A;  3SAT A;  3OII A;  1IBK M;  1QQW A;  3NWL A;  4YPW A;  2QP9 X;  4PDG A;  3QAU A;  1HNW M;  2V3K A;  4X66 M;  4ANR A;  4QNR A;  3FTE A;  1XXH E;  3Q8X A;  1UAL A;  3A42 A;  3T15 A;  4D81 A;  4LG2 A;  2KRU A;  2UXC M;  1X7O A;  1E9S A;  4DR3 M;  1GL6 A;  3ILK A;  2R0I A;  1NS5 A;  3K9P A;  4R3D A;  3GQ4 A;  1TH3 A;  1T43 A;  4S12 A;  3SYK A;  3GLF E;  5GKN A;  5GM8 A;  3MK6 A;  5ITX E;  4GEW A;  1XNQ M;  2X8A A;  4I8O A;  3GLI B;  4KDZ A;  4YQN A;  4DV4 M;  2DWL A;  2WSF F;  1IY1 A;  1MJG M;  3JAM S;  1SXJ B;  5ITR A;  1PJJ A;  3GLG E;  1EIJ A;  4JWH A;  1FNN A;  4XGI A;  4OX9 M;  3D8B A;  1FJG M;  1GJT A;  2RKO A;  4I81 A;  3TE6 A;  3A46 A;  1TH2 A;  1L1Z A;  1IXR C;  3U6O A;  5KQD A;  1G71 A;  1Q39 A;  2DHR A;  2JXN A;  2LVO C;  4GHA A;  4YQJ A;  3B74 A;  2I7N A;  4LJA A;  3U6E A;  1E94 E;  2BJW A;  5BR8 M;  3U5Z B;  4DR5 M;  4L78 A;  5FTL A;  5KPR A;  4QHT A;  2O3A A;  4E8B A;  3LCU A;  1WIV A;  3U6Q A;  3R9X B;  4AI6 A;  4JWJ A;  3QYE A;  1P9P A;  4GKJ M;  1A5T A;  3LVV A;  4LF7 M;  2DAI A;  2MJ5 B;  2BWB A;  2BWE A;  2WZJ A;  4IBG A;  3VDP A;  1PRB A;  3A45 A;  3GRR A;  4F2L A;  1NJF A;  3VK8 A;  1QAQ A;  3KP0 E;  3SAV A;  1K3X A;  3CGW A;  1GO5 A;  4P16 A;  4LJ6 A;  4X3M A;  3UK6 A;  2DZL A;  4JV5 M;  1XNR M;  2K0B X;  1Z5C A;  2V3J A;  4B3S M;  4YQ8 A;  4Z6Y A;  4FWH A;  4M9Z A;  3KSX A;  3E46 A;  4DV5 M;  2QPA A;  1PJI A;  3KY7 A;  4YQI A;  2X4A A;  3UZU A;  4G4Q A;  3ZQJ A;  2KNV A;  3FKE A;  1HQC A;  4MGZ E;  4AZF A;  3SC3 A;  3I01 M;  1KSF X;  3SAR A;  3KOY E;  4PD2 A;  4JWG A;  2FE8 A;  3FRH A;  1G3I A;  2XSZ D;  3KP1 E;  1OJL A;  4L6V 6;  3GQ5 A;  2L4E A;  1F4I A;  3OIN A;  2KRK A;  3LW5 F;  3KOW E;  7CAT A;  4B3M M;  3KOX E;  1DO2 A;  4JI1 M;  2QHO B;  3D8L A;  3B7Z A;  5GMB A;  3FTD A;  2KXE A;  2KA6 B;  3F92 A;  2XLJ A;  2MH8 A;  4B7G A;  5LMN M;  2UXB M;  3K92 A;  3NK6 A;  2ZM6 M;  4QOZ C;  3SMS A;  3L28 A;  2CV2 A;  3HHY A;  1K3R A;  2CP8 A;  3HGI A;  5ITU A;  3A98 B;  1J7K A;  3Q8G A;  4I4L A;  1UAM A;  3K2L A;  2LVQ D;  4YQD A;  3GQ3 A;  1TR8 A;  2X49 A;  1T6O A;  3OIJ A;  4IBK A;  3GRU A;  3AOE A;  3EIH A;  4NXN M;  4CIZ A;  5ITQ A;  5EXT A;  2C9C A;  2YFQ A;  2M60 A;  1SXJ D;  4FCV A;  4D82 A;  2JA2 A;  3GRY A;  3U6M A;  3ONP A;  3CTW B;  2XH9 A;  3SFZ A;  2QCU A;  2FOI C;  1OTR A;  3JR5 A;  3HHX A;  1GAB A;  2UUA M;  1EE8 A;  5FTJ A;  1P3Q Q;  4BB9 A;  4YQG A;  3DA1 A;  2CRU A;  1XWI A;  4LGM A;  4OVZ B;  2HWJ A;  2DEN A;  3GRV A;  2I7P A;  2LVA A;  2EO2 A;  4M9X A;  4DV7 M;  2VQE M;  2L2D A;  4LJ4 A;  1K82 A;  4OW0 A;  1KFV A;  5CO4 A;  2DAK A;  2XFT A;  3AFH A;  1YE9 A;  2FS1 A;  3C9P A;  3SYL A;  5FAI A;  2QSF X;  2M5Z A;  3VK7 A;  4KGN A;  4LF8 M;  2UU9 M;  1XXH A;  4L8R C;  3ZH9 B;  2ZAN A;  2XZF A;  2JZ1 A;  1SG9 A;  3MHV C;  1PJQ A;  4IBD A;  1GL7 A;  3AKZ A;  3E5Y A;  3GO8 A;  1V34 A;  4TUW A;  3GLH B;  4JI6 M;  4LFA M;  4YQ6 A;  3GLF A;  2JY7 A;  2Y0T A;  4YQL A;  1H6U A;  1PGY A;  2KDL A;  1IXS A;  1TGU A;  5ITX A;  1G4A E;  4KOD A;  1MX0 A;  4BBA A;  4YVH A;  5ITY A;  3CF0 A;  2Q2E B;  3K9O A;  2D7G A;  2JY5 A;  2LNH C;  3FTC A;  4LF5 M;  1QAN A;  2W82 A;  3GLG A;  2CFO A;  3LMM A;  3C58 A;  3U6L A;  2DXI A;  3SAU A;  3M7G A;  3L8U A;  2O25 A;  4FVM A;  2VDB B;  3RGS A;  2OQ4 A;  3U60 B;  4L4U A;  2LVN C;  4NSO B;  4B08 A;  1DGG A;  2C98 A;  4LJ7 A;  4JI4 M;  3AV0 A;  5F3W A;  2L09 A;  2QZ4 A;  3VFD A;  3HJ8 A;  1IN5 A;  1Z6T A;  2VII A;  3GLI E;  1X37 A;  1MN3 A;  5A2Q S;  1Z5B A;  3I4Y A;  2OPF A;  1QVR A;  4LY6 A;  2FH0 A;  1SXJ E;  1DV0 A;  1IN8 A;  1UFZ A;  3U61 A;  2V1C A;  1IBL M;  3AXZ A;  4CJ6 A;  4LJ9 A;  4QNM A;  1Y8G A;  2DHY A;  2R4J A;  4YQP A;  1WHC A;  4CNE A;  1D2N A;  4MCB A;  1Z5A A;  4NRV A;  1QUS A;  3J80 S;  3IC6 A;  3BXW A;  2DWM A;  5IWA M;  2ZAO A;  4Y28 F;  2QQ8 A;  4JI0 M;  2LBC A;  4HL4 A;  3HJS A;  1YUB A;  1IQP A;  4YVG A;  3N4J A;  4GHL A;  1Q02 A;  4P17 A;  2OOB A;  5FTK A;  1JR3 D;  3SBJ A;  2WSC F;  3PNY A;  4YVK A;  2F5Q A;  1V6Z A;  4HEO A;  4NSR A;  4X64 M;  1TH4 A;  1XMQ M;  1R2Y A;  4CND A;  4KLN A;  4YHH M;  5L8R F;  4LZZ A;  1AIP C;  4A3V B;  4LJ5 A;  2F4V M;  2KNA A;  4YQT A;  5FLX S;  4DR6 M;  2KHH A;  2O01 F;  2ZAM A;  5KO3 A;  4G4R A;  1HR0 M;  3FYD A;  2D7H A;  4IBC A;  4R7G A;  2DWZ B;  4QOS A;  2O5R A;  2LHC A;  3I04 M;  4G4N A;  2HL7 A;  3N4K A;  4GH9 A;  1DGH B;  2DZN B;  1N32 M;  5C18 A;  2FNA A;  4NXM M;  2CUZ A;  4MGK E;  2CHQ A;  1VDL A;  4JXJ A;  1NV9 A;  1ORY B;  3HJQ A;  4DUZ M;  4YQK A;  2I6D A;  2ZTD A;  3HY5 A;  2Z3X A;  4FCW A;  4XBO A;  4JI8 M;  1V92 A;  2EUC A;  2RRU A;  3FUU A;  1R7R A;  3AL0 C;  4GKK M;  3J27 B;  1XC8 A;  2CV1 A;  4F1I A;  3FUW A;  4JI5 M;  3LVW A;  2QBY A;  2KNZ A;  4GC5 A;  1OFI A;  2L7H A;  1IN7 A;  4MCC A;  4DV2 M;  1VG5 A;  3SMP A;  3AOE C;  3W68 A;  1OIZ A;  3O7B A;  4CNG A;  3DOA A;  3CF2 A;  2K6B A;  1L2C A;  2YY8 A;  2JUJ A;  1C1K A;  2DWN A;  4JN6 A;  1TO0 A;  4NL4 H;  2HA8 A;  1OAO C;  2Z8Y M;  3J2P B;  1MXI A;  1IN4 A;  2EKF A;  5EQT A;  2MR9 A;  2JY8 A;  2C99 A;  3UMM A;  4IJE A;  1OFH A;  4WP2 A;  1VEK A;  3TWM A;  1LV7 A;  1N34 M;  2ZBK B;  3B7N A;  2BJV A;  1JR3 E;  3HX3 A;  2DAE A;  2UUB M;  1UAJ A;  4MGI E;  1EFU B;  1N36 M;  2C5R A;  4YQ1 A;  3TQS A;  2HKJ A;  1UAK A;  1JQJ C;  1TDH A;  2XSZ A;  3PXG A;  4DR2 M;  3U6D A;  2CEA A;  1ZMU A;  3RE8 A;  5JI2 E;  4YQQ A;  1IBM M;  5EXP A;  5EP2 A;  2QNJ A;  4NRW A;  4LFB M;  4MM3 B;  1UM8 A;  2N35 A;  4IBJ A;  1VEG A;  5EP1 A;  1S3S A;  1IXZ A;  1QDR A;  3I51 A;  3LQR A;  3TWK A;  2EGW A;  5DYI A;  5H37 D;  4YQR A;  5EP3 A;  3PVS A;  3HU3 A;  2F5O A;  3BBZ A;  3KDS E;  1VEJ A;  2EGV A;  1G41 A;  4XK8 F;  4YQ5 A;  4NOO B;  1NV8 A;  2J7N A;  4DR7 M;  3QUV A;  2JZ0 A;  3AOG A;  3FYC A;  2DNA A;  3HU2 A;  1QUT A;  2WSE F;  3GLH E;  4WW0 A;  4DR1 M;  1W5T A;  5IT9 S;  1OQY A;  4FW9 A;  4AG5 A;  3FUT A;  3GPU A;  4R71 A;  4FCT A;  1K3W A;  3GLI A;  4Q7J A;  1QZE A;  3LCV B;  4NC6 A;  1DO0 A;  4YPX A;  3FUV A;  1N33 M;  1V2X A;  1G8P A;  1SXJ A;  2AHM A;  5DYG A;  4FAK A;  3SHG B;  4AW4 A;  2NQ8 C;  3T38 A;  4DBG B;  2MGW A;  4WUR A;  3VLF B;  1WXQ A;  4AQY M;  4YQO A;  2RGO A;  3J7B A;  1KYI A;  2LXE A;  4YY3 M;  5IZ7 D;  4RNA A;  4AG6 A;  3E4R A;  3HWS A;  1Z59 A;  3BOS A;  1V33 A;  4LRS A;  2J7O A;  2CHG A;  2YQZ A;  1HJP A;  4IBI A;  2APL A;  5DNY A;  3U6S A;  3KXE C;  4FWD A;  3U5Z A;  2R46 A;  3TPZ A;  4LGY A;  4G3O A;  4MGY E;  3KTY A;  4YQS A;  4Z8X A;  4X65 M;  1NHW C;  4M0W A;  3M0E A;  1MU5 A;  1NSF A;  2QEN A;  4FWG A;  3WHK A;  4J3C A;  3FUX A;  3KW2 A;  3K8Z A;  3TL4 X;  4YVI A;  2QWV A;  4YQC A;  3FTF A;  4FD2 A;  1RU3 A;  1N78 A;  3CF6 E;  5EJC A;  3IEC A;  2P5T A;  1W5S A;  1OY5 A;  3V76 A;  3KNU A;  1R5L A;  3H4J A;  4KO8 A;  4LZJ A;  3EIE A;  1G59 A;  2B3T A;  4KHP M;  1IN6 A;  3L27 A;  4REZ A;  5FTN A;  5JI3 E;  2QMM A;  3SHF A;  4PDI A;  1I94 M;  1VHY A;  1HQY E;  3NK7 A;  3IHP A;  4IG6 A;  2CV0 A;  1IM2 A;  1VQ1 A;  2JNH A;  5D9F A;  4DV3 M;  1NY5 A;  2EJS A;  2EKK A;  3WHL A;  3UGJ A;  4LFC M;  5KPZ A;  3B7Q A;  3HKP A;  2R45 A;  4LJ8 A;  1NNJ A;  4D80 A;  4RF1 A;  2VF7 A;  2CWB A;  2DZO B;  4MGH A;  4YQ9 A;  2JY6 B;  2G3Q A;  3W0L B;  3LQQ A;  5BPV A;  4FMW A;  1YLA A;  2JWS A;  3T1Y M;  2OO9 A;  4L16 A;  1O6D A;  4JWF A;  4AKG A;  4MH0 E;  4YQ4 A;  1OIP A;  5EXX A;  2Y21 A;  1WGL A;  3KSJ A;  4LF4 M;  2D7E A;  5C1B A;  1XXH B;  1NHG C;  2KW0 A;  2R62 A;  3DCM X;  1J09 A;  4IIW A;  3RGP A;  1TDZ A;  1X7P A;  1QAO A;  1Q3C A;  2GQF A;  4G4O A;  2A5Y B;  2CE7 A;  4EIW A;  2VQF M;  4B7F A;  3VKH A;  2XFS A;  5E26 A;  4AKH A;  1PM5 A;  3QWL A;  3I4V A;  3BBH A;  2ERC A;  4CHT B;  1IY2 A;  3GLF B;  3KVW A;  3JR4 A;  3KS4 A;  3NBI A;  3OTO M;  1ZJR A;  1VHK A;  1IXS B;  3VDU A;  1C7Y A;  1XHB A;  2K9D A;  4CIS A;  3TWL A;  4YPY A;  5EXS A;  2HHH M;  4JI2 M;  1BVS A;  5EP4 A;  1NO1 A;  1DGF A;  3GLG B;  1VH0 A;  1JR3 A;  2C96 A;  1R4G A;  4JYA M;  2LWX A;  2DI0 A;  3T6P A;  4GIT A;  3PNV A;  2F5N A;  1L8Q A;  4GC9 A;  1DGB A;  3E21 A;  3E9S A;  3HU1 A;  3B9P A;  2LHG A;  4OVZ A;  4PT5 A;  1N75 A;  4KT0 F;  1QYR A;  1WGN A;  1ZMW A;  2EA0 A;  4B3T M;  2CHV A;  2XEP A;  5IRE B;  1WR1 B;  4BLC A;  4I5S A;  2UXD M;  3L2A A;  1L2D A;  2C9O A;  3FD9 A;  4M0D A;  4PCZ A;  3GP1 A;  1L1T A;  2CX8 A;  4L15 A;  4RF0 A;  3U61 B;  3BBE A;  4G6Z A;  1N77 A;  1IY0 A;  4LF9 M;  4YVJ A;  1HNZ M;  3KS8 A;  3KFU G;  1J85 A;  1D0M A;  1XB2 B;  2G5G X;  4YQA A;  2BNK A;  1AUA A;  4B3R M;  3GLH A;  2H1R A;  1QDT A;  2YNM D;  2MRO B;  1JB0 F;  1TF0 B;  2R4E A;  2Z0Y A;  3C3D A;  4UN2 B;  5KQ8 A;  1PJS A;  1E32 A;  3SAS A;  1WJ7 A;  5FSW A;  4X62 M;  2KEB A;  3IG8 A;  2Y0Q A;  1E9R A;  5KPT A;  3B89 A;  3R8F A;  3IEF A;  4JAL A;  4CNF A;  4ITQ A;  3GPY A;  1GVN A;  1IPA A;  2KZS A;  3GPP A;  2DKL A;  5FTM A;  1R2Z A;  2HAK A;  1GJS A;  2XGN A;  1ZQ9 A;  2XZU A;  4YQ2 A;  2J5Y A;  3RFW A;  3DFZ A;  3U60 A;  1NJG A;  1OAI A;  2LTU A;  4DUY M;  3L29 A;  4DV0 M;  1T3T A;  2DAG A;  4DR4 M;  4YPZ A;  4YQ3 A;  2L7I A;  1SXJ C;  3MMP A;  3UJN A;  4AKI A;  2GNO A;  3FRI A;  3MJ5 A;  3PFI A;  3K1J A;  3H4M A;  1I4W A;  2VF8 A;  2ZTC A;  1J5E M;  4LRT A;  3HHZ A;  1NVM A;  2Z4R A;  1Q3B A;  3FE3 A;  3M6A A;  4QHS A;  3BBD A;  1D0L A;  1GLN A;  2R18 A;  4IBE A;  1VDD A;  2YR0 A;  1OKS A;  5GMC A;  2KZU A;  4M9S A;  3L26 A;  1GKI A;  2L4F A;  3AJI B;  3QYB A;  2F5P A;  1HNX M;  4W5W A;  4YQB A;  4K0K M;  1ZV1 A;  1XMO M;  2H5X A;  4JI3 M;  2FFJ A;  3J81 S;  4RKU F;  5DFL A;  3W67 A;  2DVW B;  1D0K A;  3AI9 X;  3ZC7 B;  1R6B X;  2Z4S A;  2UUC M;  4H3Y A;  3IG5 A;  2LVP C;  3HZJ A;  4PZK A;  1PJT A;  4JI7 M;  1NY6 A;  1LTM A;  2Y20 A;  2R65 A;  1ZMV A;  1Z85 A;  2QBY B;  3AIA A;  4LCB A;  5ITT A;  4MB7 A;  1HT1 E;  3C3E A;  2DAM A;  3SAW A;  2R44 A;  2V6Z M;  2XF3 A;  2E5L M;  2F5S A;  1IFY A;  4X3L A;  1NNU C;  2LH0 A;  3GYQ A;  4ZPX A;  4RG1 A;  1NXZ A;  3J7A S;  3HHW A;  4IJF A;  3THG A;  3W0F A;  1TTE A;  8CAT A;  4OU7 A;  5LMU M;  4LF6 M;  2RGH A;  2K47 A;  3U6C A;  4YQ0 A;  4CGY B;  2G8L A;  1GZ0 A;  3VKG A;  2JP7 A;  3U6P A;  5E6J A;  1L2B A;  3NBX X;  3T1H M;  2V1U A;  3L25 A;  4HLQ A;  4DV6 M;  4DV1 M;  2R6F A;  1QAM A;  2HCB A;  1ZAE A;  2OOA A;  3ZCB B;  4YQ7 A;  1DGH A;  1YSY A;  3KOZ E;  1QZM A;  4GIP A;  4II7 A;  4GRI A;  2L6O A;  3DZD A;  4IBF A;  3KW6 A;  4B7H A;  4GMQ A;  1CUK A;  4H3Z A; 
#chains in the Genus database with same CATH homology
 4MCD A;  4IBB A;  4L69 A;  2Z7J A;  3GPX A;  1HT2 E;  4JAK A;  3SAT A;  3OII A;  1IBK M;  1QQW A;  3NWL A;  4YPW A;  2QP9 X;  4PDG A;  3QAU A;  1HNW M;  2V3K A;  4X66 M;  4QNR A;  3FTE A;  3Q8X A;  1UAL A;  3A42 A;  3T15 A;  4D81 A;  4LG2 A;  2KRU A;  2UXC M;  1E9S A;  4DR3 M;  1GL6 A;  3ILK A;  1NS5 A;  4R3D A;  3GQ4 A;  1TH3 A;  4S12 A;  3SYK A;  5GKN A;  5GM8 A;  3MK6 A;  5ITX E;  1XNQ M;  2X8A A;  4I8O A;  3GLI B;  4KDZ A;  4YQN A;  4DV4 M;  2DWL A;  1IY1 A;  5ITR A;  3JAM S;  1SXJ B;  1PJJ A;  4JWH A;  1FNN A;  4XGI A;  4OX9 M;  3D8B A;  1FJG M;  2RKO A;  4I81 A;  3TE6 A;  3A46 A;  1TH2 A;  1L1Z A;  1IXR C;  3U6O A;  5KQD A;  2DHR A;  1Q39 A;  4GHA A;  4YQJ A;  2I7N A;  4LJA A;  3U6E A;  1E94 E;  2BJW A;  5BR8 M;  3U5Z B;  4DR5 M;  4L78 A;  5FTL A;  5KPR A;  4QHT A;  2O3A A;  4E8B A;  3U6Q A;  3R9X B;  4JWJ A;  4AI6 A;  1P9P A;  4GKJ M;  3LVV A;  4LF7 M;  3VDP A;  1UAK A;  4IBG A;  3VK8 A;  3A45 A;  3GRR A;  1NJF A;  1K3X A;  1QAQ A;  3KP0 E;  3SAV A;  4P16 A;  4LJ6 A;  4X3M A;  3UK6 A;  4JV5 M;  1XNR M;  1Z5C A;  2V3J A;  4B3S M;  4YQ8 A;  4Z6Y A;  4FWH A;  4M9Z A;  3KSX A;  4DV5 M;  1PJI A;  2QPA A;  3KY7 A;  4YQI A;  2X4A A;  3UZU A;  4G4Q A;  3FKE A;  1HQC A;  4MGZ E;  4AZF A;  3SC3 A;  1KSF X;  3SAR A;  3KOY E;  4PD2 A;  4JWG A;  2FE8 A;  1G3I A;  2XSZ D;  3KP1 E;  1OJL A;  3GQ5 A;  3OIN A;  2KRK A;  3KOW E;  7CAT A;  4B3M M;  3KOX E;  1DO2 A;  4JI1 M;  5GMB A;  3D8L A;  3FTD A;  2KXE A;  2KA6 B;  2XLJ A;  4B7G A;  5LMN M;  2UXB M;  3K92 A;  3NK6 A;  2ZM6 M;  4QOZ C;  3SMS A;  3L28 A;  2CV2 A;  3HHY A;  1K3R A;  3HGI A;  5ITU A;  3A98 B;  1J7K A;  4I4L A;  1UAM A;  3K2L A;  4YQD A;  3GQ3 A;  2X49 A;  3OIJ A;  4IBK A;  3GRU A;  3AOE A;  3EIH A;  4NXN M;  5ITQ A;  5EXT A;  2C9C A;  2YFQ A;  2M60 A;  1SXJ D;  4FCV A;  4D82 A;  3GRY A;  2JA2 A;  3U6M A;  3ONP A;  3CTW B;  2XH9 A;  3SFZ A;  2QCU A;  2FOI C;  3JR5 A;  3HHX A;  2UUA M;  1EE8 A;  5FTJ A;  4BB9 A;  4YQG A;  3DA1 A;  4LGM A;  1XWI A;  4OVZ B;  3GRV A;  2I7P A;  2EO2 A;  4M9X A;  4DV7 M;  2VQE M;  4LJ4 A;  1K82 A;  4OW0 A;  1KFV A;  5CO4 A;  2XFT A;  3AFH A;  1YE9 A;  3SYL A;  5FAI A;  2M5Z A;  3VK7 A;  4KGN A;  4LF8 M;  2UU9 M;  1XXH A;  4L8R C;  3ZH9 B;  2ZAN A;  2XZF A;  4IBD A;  3MHV C;  3E5Y A;  1GL7 A;  3AKZ A;  3GO8 A;  4TUW A;  3GLH B;  4JI6 M;  4LFA M;  4YQ6 A;  3GLF A;  4YQL A;  2Y0T A;  1H6U A;  1TGU A;  5ITX A;  4BBA A;  1G4A E;  4KOD A;  1MX0 A;  4YVH A;  5ITY A;  3CF0 A;  2Q2E B;  2D7G A;  2LNH C;  3FTC A;  4LF5 M;  1QAN A;  2W82 A;  3GLG A;  2CFO A;  3LMM A;  3C58 A;  3U6L A;  2DXI A;  3SAU A;  3M7G A;  3L8U A;  4FVM A;  3RGS A;  2OQ4 A;  3U60 B;  4L4U A;  4NSO B;  4B08 A;  1DGG A;  2C98 A;  4LJ7 A;  4JI4 M;  3AV0 A;  5F3W A;  2L09 A;  2QZ4 A;  3VFD A;  3HJ8 A;  1IN5 A;  1Z6T A;  2VII A;  1X37 A;  5A2Q S;  1Z5B A;  3I4Y A;  2OPF A;  1QVR A;  4LY6 A;  1SXJ E;  1IN8 A;  3U61 A;  2V1C A;  1IBL M;  3AXZ A;  4LJ9 A;  4QNM A;  4CNE A;  2R4J A;  4YQP A;  1D2N A;  4MCB A;  1Z5A A;  4NRV A;  3J80 S;  3IC6 A;  2DWM A;  5IWA M;  2ZAO A;  4JI0 M;  4HL4 A;  3HJS A;  1YUB A;  1IQP A;  4YVG A;  3N4J A;  4GHL A;  5FTK A;  1JR3 D;  3SBJ A;  3PNY A;  4YVK A;  2F5Q A;  1V6Z A;  4NSR A;  4X64 M;  1TH4 A;  1XMQ M;  1R2Y A;  4CND A;  4KLN A;  4YHH M;  4LZZ A;  4A3V B;  4LJ5 A;  2F4V M;  4YQT A;  5FLX S;  4DR6 M;  2ZAM A;  5KO3 A;  4G4R A;  1HR0 M;  3FYD A;  2D7H A;  4IBC A;  4R7G A;  2DWZ B;  4QOS A;  2O5R A;  4G4N A;  2HL7 A;  3N4K A;  4GH9 A;  1DGH B;  2DZN B;  1N32 M;  5C18 A;  2FNA A;  4NXM M;  2CUZ A;  4MGK E;  2CHQ A;  4JXJ A;  1ORY B;  3HJQ A;  4DUZ M;  4YQK A;  2I6D A;  2Z3X A;  4FCW A;  4XBO A;  4JI8 M;  4GKK M;  2EUC A;  3FUU A;  3AL0 C;  1R7R A;  3J27 B;  1XC8 A;  2CV1 A;  3FUW A;  4JI5 M;  3LVW A;  2QBY A;  4GC5 A;  1OFI A;  2L7H A;  1IN7 A;  4MCC A;  4DV2 M;  3SMP A;  3AOE C;  3O7B A;  4CNG A;  3DOA A;  3CF2 A;  1L2C A;  2YY8 A;  1C1K A;  2DWN A;  4JN6 A;  1TO0 A;  4NL4 H;  2HA8 A;  3J2P B;  1MXI A;  1IN4 A;  5EQT A;  2C99 A;  3UMM A;  4IJE A;  1OFH A;  1N34 M;  3TWM A;  1LV7 A;  2ZBK B;  2BJV A;  1UAJ A;  2UUB M;  4MGI E;  1N36 M;  2C5R A;  4YQ1 A;  3TQS A;  2HKJ A;  1JQJ C;  1TDH A;  2XSZ A;  3PXG A;  4DR2 M;  3U6D A;  2CEA A;  3RE8 A;  5JI2 E;  4YQQ A;  1IBM M;  5EXP A;  5EP2 A;  4NRW A;  4LFB M;  4MM3 B;  1UM8 A;  5EP1 A;  4IBJ A;  1S3S A;  1IXZ A;  3I51 A;  3LQR A;  3TWK A;  2EGW A;  5DYI A;  5H37 D;  4YQR A;  5EP3 A;  3PVS A;  3HU3 A;  2F5O A;  3KDS E;  2EGV A;  1G41 A;  4YQ5 A;  4NOO B;  3QUV A;  2J7N A;  4DR7 M;  3AOG A;  3FYC A;  3HU2 A;  4DR1 M;  4WW0 A;  5IT9 S;  1W5T A;  4FW9 A;  4AG5 A;  3FUT A;  3GPU A;  4FCT A;  1K3W A;  3GLI A;  1DO0 A;  4YPX A;  3FUV A;  1N33 M;  1V2X A;  1G8P A;  1SXJ A;  2AHM A;  5DYG A;  4FAK A;  3SHG B;  4AW4 A;  2NQ8 C;  3T38 A;  4WUR A;  3VLF B;  1WXQ A;  4AQY M;  4YQO A;  2RGO A;  3J7B A;  1KYI A;  2LXE A;  4YY3 M;  5IZ7 D;  4RNA A;  4AG6 A;  3E4R A;  3HWS A;  1Z59 A;  3BOS A;  4LRS A;  2J7O A;  2CHG A;  2YQZ A;  4IBI A;  5DNY A;  3U6S A;  3KXE C;  4FWD A;  3U5Z A;  2R46 A;  3TPZ A;  4LGY A;  3KTY A;  4MGY E;  4YQS A;  4Z8X A;  4X65 M;  1NHW C;  4M0W A;  3M0E A;  1MU5 A;  1NSF A;  2QEN A;  4FWG A;  3WHK A;  4J3C A;  3FUX A;  3KW2 A;  3K8Z A;  3TL4 X;  4YVI A;  2QWV A;  4YQC A;  3FTF A;  4FD2 A;  1N78 A;  3CF6 E;  5EJC A;  2P5T A;  1W5S A;  1OY5 A;  3KNU A;  4KO8 A;  4LZJ A;  3EIE A;  1G59 A;  4KHP M;  1IN6 A;  3L27 A;  4REZ A;  5FTN A;  5JI3 E;  2QMM A;  3SHF A;  4PDI A;  1I94 M;  1VHY A;  1HQY E;  3NK7 A;  4IG6 A;  2CV0 A;  1IM2 A;  5D9F A;  4DV3 M;  1NY5 A;  3UGJ A;  3WHL A;  4LFC M;  5KPZ A;  3HKP A;  2R45 A;  4LJ8 A;  1NNJ A;  4D80 A;  4RF1 A;  4MGH A;  2DZO B;  4YQ9 A;  3W0L B;  3LQQ A;  5BPV A;  4FMW A;  3T1Y M;  1O6D A;  4L16 A;  4JWF A;  4AKG A;  4MH0 E;  4YQ4 A;  5EXX A;  2Y21 A;  3KSJ A;  4LF4 M;  2D7E A;  5C1B A;  1XXH B;  1NHG C;  2KW0 A;  2R62 A;  3DCM X;  1J09 A;  4IIW A;  3RGP A;  1TDZ A;  1X7P A;  1QAO A;  1Q3C A;  4G4O A;  2A5Y B;  2CE7 A;  4EIW A;  2VQF M;  4B7F A;  3VKH A;  2XFS A;  5E26 A;  4AKH A;  1PM5 A;  3QWL A;  3I4V A;  3BBH A;  2ERC A;  4CHT B;  1IY2 A;  3GLF B;  3KVW A;  3JR4 A;  3KS4 A;  3NBI A;  3OTO M;  1ZJR A;  1VHK A;  1IXS B;  3VDU A;  1XHB A;  4CIS A;  3TWL A;  4YPY A;  5EXS A;  2HHH M;  4JI2 M;  3GLG B;  5EP4 A;  1VH0 A;  1DGF A;  1JR3 A;  2C96 A;  4JYA M;  2LWX A;  4GIT A;  3PNV A;  2F5N A;  1L8Q A;  4GC9 A;  1DGB A;  3HU1 A;  3E9S A;  3B9P A;  4OVZ A;  4PT5 A;  1N75 A;  1QYR A;  2EA0 A;  4B3T M;  2CHV A;  2XEP A;  5IRE B;  4BLC A;  4I5S A;  2UXD M;  3L2A A;  1L2D A;  2C9O A;  3FD9 A;  4M0D A;  4PCZ A;  3GP1 A;  1L1T A;  2CX8 A;  4L15 A;  4RF0 A;  3U61 B;  3BBE A;  4G6Z A;  1N77 A;  1IY0 A;  4LF9 M;  4YVJ A;  1HNZ M;  3KS8 A;  3KFU G;  1J85 A;  2G5G X;  4YQA A;  2BNK A;  4B3R M;  3GLH A;  2H1R A;  2YNM D;  2R4E A;  2Z0Y A;  5KQ8 A;  1E32 A;  3SAS A;  4X62 M;  5FSW A;  2KEB A;  3IG8 A;  2Y0Q A;  1E9R A;  5KPT A;  4JAL A;  3R8F A;  3IEF A;  4CNF A;  4ITQ A;  3GPY A;  1GVN A;  1IPA A;  2KZS A;  3GPP A;  5FTM A;  1R2Z A;  2XGN A;  1ZQ9 A;  2XZU A;  4YQ2 A;  3RFW A;  3DFZ A;  3U60 A;  1NJG A;  4YPZ A;  4DV0 M;  4DUY M;  3L29 A;  4DR4 M;  1T3T A;  4YQ3 A;  2L7I A;  1SXJ C;  3UJN A;  4AKI A;  3MJ5 A;  3PFI A;  3K1J A;  3H4M A;  1I4W A;  1X7O A;  1J5E M;  4LRT A;  3HHZ A;  1NVM A;  2Z4R A;  1Q3B A;  3M6A A;  4QHS A;  3BBD A;  1GLN A;  2R18 A;  4IBE A;  1VDD A;  2YR0 A;  5GMC A;  2KZU A;  4M9S A;  3L26 A;  1GKI A;  3AJI B;  2F5P A;  1HNX M;  4W5W A;  4YQB A;  4K0K M;  1XMO M;  4JI3 M;  2FFJ A;  3J81 S;  2DVW B;  3AI9 X;  3ZC7 B;  1R6B X;  2Z4S A;  2UUC M;  4H3Y A;  3IG5 A;  4PZK A;  4JI7 M;  1NY6 A;  2Y20 A;  2R65 A;  1Z85 A;  2QBY B;  3AIA A;  4LCB A;  5ITT A;  4MB7 A;  1HT1 E;  3SAW A;  2E5L M;  2V6Z M;  2XF3 A;  2F5S A;  4X3L A;  1NNU C;  2LH0 A;  3GYQ A;  4ZPX A;  4RG1 A;  1NXZ A;  3J7A S;  3HHW A;  4IJF A;  3THG A;  3W0F A;  4OU7 A;  8CAT A;  5LMU M;  4LF6 M;  2RGH A;  2K47 A;  3U6C A;  4YQ0 A;  4CGY B;  2G8L A;  1GZ0 A;  3VKG A;  3U6P A;  5E6J A;  1L2B A;  2V1U A;  3T1H M;  3L25 A;  4HLQ A;  4DV6 M;  4DV1 M;  1QAM A;  2HCB A;  1ZAE A;  3ZCB B;  4YQ7 A;  1DGH A;  1YSY A;  3KOZ E;  1QZM A;  4GIP A;  4II7 A;  4GRI A;  2L6O A;  3DZD A;  4IBF A;  3KW6 A;  4B7H A;  4GMQ A;  4H3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...