4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
b'MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
4YQOA 4YVKA 1NS5A 3AI9X 3O7BA 3IC6A 5FAIA 3E5YA 3QUVA 3NK6A 4YQCA 5CO4A 4E8BA 4YQJA 3BBHA 4KDZA 3AXZA 4CNDA 1UAKA 4JAKA 4YQDA 4KGNA 1UALA 4YQ4A 4YQRA 3GYQA 1OY5A 3AIAA 4YQ7A 1VHYA 4CNFA 3ILKA 1K3RA 1J85A 4YVGA 5GMBA 4YQLA 4YPXA 4X3MA 4YQ5A 3OINA 4YQBA 4MCBA 3KY7A 4YPZA 4H3YA 4J3CA 3OIJA 4H3ZA 4CNEA 4YQIA 3BBEA 3IEFA 3N4JA 1VH0A 1NXZA 1P9PA 4RG1A 2HA8A 4X3LA 2EGVA 5GM8A 4YPYA 1TO0A 4YVHA 4YQ0A 4YQ1A 1IPAA 4XBOA 3DCMX 4FAKA 4YQ9A 4YQ6A 4YQKA 2V3JA 4YQQA 5GMCA 1VHKA 4YQ8A 1Z85A 4JALA 2Z0YA 3ONPA 4YVIA 1GZ0A 1X7OA 1V2XA 1X7PA 3N4KA 1ZJRA 3L8UA 4CNGA 4YQAA 4YVJA 3KNUA 1V6ZA 4YQGA 2V3KA 4MCCA 4YQ3A 1UAMA 1MXIA 4IG6A 2I6DA 2O3AA 5D9FA 4YQNA 3KTYA 4YPWA 2QMMA 4YQPA 2CX8A 4L69A 4YQ2A 2QWVA 3BBDA 3NK7A 4YQSA 1O6DA 4MCDA 4PZKA 3OIIA 1UAJA 4YQTA 2EGWA 2YY8A 3KW2A
chains in the Genus database with same CATH superfamily
3K92A 3KS4A 1VEJA 5KO3A 3DFZA 4L6V6 4YVKA 2R62A 3K2LA 3WHKA 3AOEC 3GRVA 2ZBKB 3IC6A 4D81A 1VG5A 2Y0TA 3J7AS 4GMQA 1PJSA 1WIVA 2BJVA 3FYCA 3L26A 5EJCA 4DV4M 3T1YM 4E8BA 2LVNC 4CNDA 2JZ0A 5EP3A 3GLHB 5IREB 3W0FA 1IXSA 1OTRA 2K9DA 1UAKA 2LTUA 4JAKA 2DVWB 4Q7JA 4DV5M 4DV7M 1IBKM 4DR4M 4YQRA 1OJLA 3GYQA 2DAMA 3W68A 1OY5A 2ERCA 4YQ7A 2XH9A 4IBIA 3ONPA 2KNAA 3H4JA 3L28A 1IN7A 2KNVA 3NWLA 4GIPA 2F5SA 3JR5A 1IN4A 1J85A 5GMBA 3ZQJA 3U6PA 1HNXM 4AZFA 4IJEA 2XF3A 2UXDM 1DGFA 4HLQA 1XWIA 1ZMUA 1OAIA 2HCBA 3IECA 4G6ZA 4LJ9A 1KFVA 1L1ZA 4H3ZA 2ZANA 2J7NA 1WGNA 4YQTA 4QOSA 1DO0A 1E9RA 4G4QA 2Y20A 4IBFA 1MJGM 1GABA 3I4VA 1NXZA 1N77A 5EQTA 1TDHA 2CV0A 4HL4A 1R2ZA 3LQRA 1XHBA 4YPYA 3TQSA 2DZLA 4OVZB 3HHZA 1TO0A 3UZUA 4YVHA 2KW0A 3VK8A 2FH0A 1J7KA 1IXZA 2XZFA 4LF4M 2QQ8A 1CUKA 1EIJA 1IPAA 2OQ4A 2HKJA 4YQ6A 2L6OA 2DAGA 2R4JA 3FD9A 4ITQA 1HQCA 4AG5A 4LG2A 5BPVA 3D8BA 2LH0A 4IBBA 2QNJA 5H37D 1NNJA 4AKHA 5L8RF 1OIZA 1TH4A 2WSEF 4IJFA 3TE6A 4D82A 2C9CA 5ITTA 1QDTA 5F3WA 5IT9S 1TH2A 4XGIA 4JALA 1OFIA 3GPUA 1YLAA 2KNZA 2VF8A 2ZTDA 4GC9A 2BWBA 4MM3B 3TWKA 3V76A 1NO1A 4R7GA 3EIHA 3UK6A 2J5YA 3GRRA 1OKSA 3E46A 4IBGA 3SAUA 3GPPA 3CF2A 4NRVA 4DR5M 2CV1A 3JR4A 4KDZA 4L15A 4LFCM 4DR1M 1HNZM 1XMOM 2UXBM 2XSZD 4XK8F 1IY0A 4AKGA 2QBYA 3L8UA 3HWSA 3KSXA 1R2YA 4CNGA 1Q39A 4EIWA 3KNUA 3AOGA 4M9ZA 4QHSA 1DGHB 4MCCA 3GLIE 4DR2M 2KHHA 2Z4SA 3LCVB 4YQ3A 3GQ3A 2CUZA 4JWHA 1T3TA 5DYIA 4P17A 4RF1A 1E9SA 2FS1A 2H1RA 3C3DA 1QANA 5BR8M 1PGYA 3FTFA 1T6OA 3FKEA 4REZA 1YSYA 1GJTA 4L4UA 3KTYA 4L8RC 1WJ7A 2WSCF 3QYBA 3C9PA 5EXTA 3GO8A 2L7HA 2DAIA 4Z8XA 2LNHC 1IY1A 1D0KA 1NVMA 2O5RA 3VLFB 3U6OA 4LJ4A 4JI8M 1I4WA 3L25A 1JB0F 2L4FA 2QHOB 2ZTCA 3A98B 3NK7A 2DENA 3B7ZA 4MGHA 3HJSA 1O6DA 3U6DA 4DUZM 4KLNA 1GL7A 2R0IA 3R9XB 4PZKA 1ZMVA 2JWSA 1W5TA 4CNEA 3OTOM 3KW2A 3KW6A 3DOAA 3GLFB 1TGUA 4DBGB 1MX0A 2DNAA 3M0EA 4P16A 3U60B 1A5TA 2C5RA 3J80S 2P5TA 4PT5A 3QUVA 4YQCA 3U6MA 1GLNA 1HT1E 4JV5M 2KDLA 2M5ZA 3QYEA 1G8PA 4LRSA 3VFDA 1XMQM 1J5EM 3RGSA 1KSFX 1ZMWA 2AHMA 2R45A 1ZQ9A 3UMMA 1IFYA 4YQJA 1IN8A 2MROB 1PJQA 8CATA 5JI2E 1DO2A 2C98A 3SYLA 3U6SA 4KGNA 2Y0QA 3A42A 3DZDA 3LQQA 3KSJA 2R46A 3HU3A 2R6FA 3AIAA 3KS8A 5IZ7D 4MGKE 2V6ZM 1AIPC 2KRKA 4CJ6A 1Z5BA 3VDPA 4CNFA 3BOSA 3SAVA 3NBIA 1NY5A 3SHGB 2XEPA 4JI3M 3T15A 2QPAA 3U6QA 2YQZA 4K0KM 1QZEA 3ZCBB 4YPXA 1G71A 2UXCM 2HWJA 3H4MA 3U5ZA 4BLCA 4YPZA 1NHGC 2Z4RA 1SXJD 1SG9A 4B7GA 4MB7A 4I81A 1R6BX 2JY8A 5C1BA 3K1JA 3HKPA 4OX9M 2A5YB 4WW0A 2UUCM 1VH0A 2C99A 3GPYA 4IBKA 1E94E 1SXJB 4LJ8A 3VDUA 1P9PA 2EO2A 4RG1A 1GO5A 1R7RA 1WGLA 2KEBA 4GHAA 2EGVA 4IBEA 4X3LA 2LVOC 2FE8A 3PFIA 2DZOB 4LJAA 3T38A 3KOZE 5FTNA 2R4EA 4FWDA 3GP1A 4I4LA 1FJGM 1VEKA 2OOAA 4YQ1A 5KPTA 2OPFA 1HT2E 4CIZA 2XZUA 1Z59A 2R44A 4A3VB 3FRHA 1V92A 1WHCA 4F1IA 3FTDA 2V3JA 4KT0F 3K9PA 2VQEM 3IG5A 2BNKA 2DHYA 5GMCA 2CHGA 3A46A 1TF0B 1HJPA 4HEOA 1Z85A 4YQ8A 2LHCA 1OQYA 2CHVA 3U61A 4B3MM 4MGZE 2Z0YA 4M0DA 1X7OA 1OIPA 3GLGA 4Y28F 3K9OA 3SASA 3B89A 4CISA 1G59A 4JI0M 1D0MA 1PRBA 2CE7A 2YFQA 3TPZA 1AUAA 2K47A 3HHWA 1I94M 3JAMS 2APLA 1XXHB 1QUSA 3RE8A 5FLXS 3GQ4A 2EA0A 4DV0M 4YQAA 4KODA 2K0BX 5EP2A 2QCUA 1JR3A 2JP7A 3RFWA 2V3KA 2O01F 2LVQD 4IIWA 1TTEA 4I8OA 4GC5A 3SMSA 2WZJA 2LWXA 3ZC7B 3U6LA 3GLGE 1QYRA 4DV2M 1PJIA 2JNHA 4DR7M 5EXPA 4G4OA 4B7HA 1UAMA 4IBDA 4DV6M 2I6DA 2O3AA 5D9FA 2RGHA 3A45A 1Z5AA 5IWAM 2RRUA 3FUVA 1DGBA 1QAOA 4D80A 2DAKA 1JR3E 2QMMA 1G3IA 3FUXA 3L29A 5C18A 2CX8A 4YQPA 4FWHA 4Z6YA 1N36M 4L69A 2J7OA 1LV7A 4TUWA 1N32M 3BXWA 3Q8XA 2KZUA 4B3SM 2CHQA 4GKKM 5FTLA 1RU3A 5ITXA 3MHVC 4JI2M 3W0LB 3B74A 4YQQA 4X66M 2BJWA 3AFHA 3GRYA 2Z3XA 1GL6A 2JY5A 3HGIA 4NOOB 4PD2A 4IBJA 1K3WA 1L2BA 4IBCA 1VEGA 1GJSA 2YY8A 4FCVA 1C7YA 4FMWA 4DV1M 4QOZC 2XFTA 1OFHA 4II7A 1NS5A 3AI9X 1N75A 4LRTA 3O7BA 5FAIA 3LMMA 3QWLA 4LFAM 2DWZB 1IXSB 2N35A 4LJ5A 4LY6A 2V1UA 5CO4A 2Q2EB 4R3DA 4NSOB 5EP4A 3AXZA 2H5XA 4JWFA 1UALA 4OW0A 2QZ4A 2DWMA 2MJ5B 4YQ4A 3GLHA 4MGIE 4IG6A 1XNQM 2JZ1A 4PDIA 2UUBM 3J2PB 1DGGA 4WURA 1VHYA 4QHTA 1HQYE 4NSRA 4GHLA 1XC8A 1S3SA 2LHGA 1K3RA 5FTKA 1NNUC 4CHTB 1L2DA 4YQBA 4S12A 4FW9A 1V33A 3M7GA 4MCBA 3GLHE 4B3TM 1YE9A 4LGYA 3AJIB 1NJFA 1TDZA 3BBEA 4JI1M 2FFJA 2R65A 3M6AA 3E9SA 2FNAA 3N4JA 1R5LA 2EUCA 3PXGA 3FTEA 3BBHA 1PM5A 2DWNA 3C3EA 3QAUA 4FCWA 1EFUB 3HZJA 4R71A 2NQ8C 2F5PA 1ZAEA 2HA8A 3WHLA 4B08A 4LGMA 4JI4M 5GM8A 5KPZA 3FTCA 4YQ0A 4YHHM 3HU1A 1X37A 4M9XA 4FAKA 1YUBA 4OVZA 1IBMM 2EKFA 3CTWB 1DV0A 3CF6E 3ZH9B 1H6UA 4YQKA 3BBZA 3HJ8A 4NL4H 2JXNA 2V1CA 4KHPM 1WXQA 3T6PA 2VQFM 2VIIA 4LCBA 5DYGA 3W67A 5FTJA 3GRUA 3GLIB 2KZSA 4JXJA 4DR3M 3SARA 5KQDA 1PJJA 3J7BA 1K3XA 2D7GA 2DI0A 1L8QA 4NXNM 4YVIA 4GH9A 1GZ0A 1V2XA 2EKKA 2RKOA 1GVNA 2L09A 4RKUF 2QBYB 1OAOC 1HR0M 5LMNM 2W82A 3KFUG 3B9PA 1ZJRA 5LMUM 2UU9M 1JQJC 3KP0E 1Q3CA 4QNRA 5ITQA 4AQYM 3FUTA 5EXXA 4YVJA 3AL0C 1Z5CA 3U6EA 1V6ZA 4YQGA 2CWBA 4JI7M 4AI6A 5FSWA 1BVSA 2Z8YM 2OO9A 4LJ6A 2ZM6M 3SAWA 4LF9M 4YY3M 1NHWC 2CRUA 3I51A 4LF8M 1DGHA 2MGWA 1N33M 2KA6B 2XSZA 2GNOA 1V34A 2XLJA 2F5QA 2L7IA 2DXIA 2G8LA 2O25A 4GKJM 3UJNA 4YQNA 1IQPA 4YPWA 4PDGA 3J81S 3LCUA 1Z6TA 1C1KA 3B7NA 1NY6A 1UM8A 2X8AA 3GQ5A 4JN6A 4G3OA 4YQ2A 1G4AE 2QWVA 2YR0A 1FNNA 4YQSA 2F5OA 3FE3A 2DHRA 1WR1B 3I4YA 4KO8A 4MCDA 3VKGA 1QUTA 7CATA 1VQ1A 2KRUA 5DNYA 4G4NA 1ZV1A 2G5GX 3VK7A 1HNWM 3HU2A 3KP1E 1ORYB 2Y21A 3KVWA 3UGJA 2QSFX 4YQOA 3CGWA 3CF0A 3AKZA 1P3QQ 4L16A 3SYKA 3D8LA 3GLFA 3PNVA 3E5YA 1D0LA 3NK6A 1MN3A 3HY5A 1UFZA 5FTMA 3U60A 3HHYA 4F2LA 2EJSA 2C96A 2G3QA 3AOEA 1Y8GA 3TWMA 2L4EA 4LF6M 4LFBM 1F4IA 3TL4X 1L2CA 1IN6A 1QVRA 2ZAOA 3L27A 2I7PA 4FVMA 4DR6M 1SXJC 3KXEC 4QNMA 4G4RA 1TR8A 2UUAM 4YQDA 1GKIA 3PVSA 5KPRA 3EIEA 2HHHM 2X4AA 3SMPA 3GLFE 1K82A 1MU5A 2C9OA 1KYIA 3KOYE 5A2QS 2L2DA 2XGNA 2CV2A 1QDRA 3THGA 1G41A 4FWGA 3RGPA 2RGOA 3C58A 4X62M 3IHPA 4DUYM 1IN5A 2M60A 3U5ZB 3GLIA 1NSFA 3ILKA 4NXMM 4JWJA 2ZAMA 4YVGA 4YQLA 5GKNA 2KXEA 4YQ5A 4X3MA 4BBAA 3OINA 3HX3A 3MMPA 3KY7A 1TH3A 4X64M 4B7FA 4H3YA 3E4RA 4J3CA 3OIJA 3DA1A 2CEAA 3K8ZA 1XNRM 2HAKA 4YQIA 1XB2B 2DWLA 4AKIA 3MK6A 4CGYB 2X49A 1QAQA 5ITXE 4JWGA 4JYAM 3IEFA 4LF7M 3SATA 5E26A 4DV3M 3SBJA 4FD2A 4GRIA 1T43A 2QP9X 1LTMA 3I04M 3LVWA 1IY2A 1SXJA 4M0WA 3GPXA 1N34M 2I7NA 3T1HM 2LVPC 1EE8A 3LVVA 2CFOA 2JY7A 3PNYA 1N78A 2R18A 3DCMX 4XBOA 4YQ9A 2MR9A 1R4GA 4NRWA 1W5SA 3R8FA 1NV9A 3FUUA 2XFSA 3SFZA 3U61B 2D7EA 1VHKA 1QAMA 2LXEA 2QENA 2LBCA 2LVAA 4AW4A 2GQFA 3U6CA 2D7HA 1SXJE 4LZZA 4B3RM 4RF0A 3FUWA 5KQ8A 5EP1A 3GLGB 2JY6B 2VDBB 4MGYE 5DFLA 2JUJA 1VDLA 1JR3D 4ANRA 3KDSE 4LJ7A 4LF5M 1X7PA 1D2NA 1IBLM 5EXSA 2FOIC 5JI3E 3N4KA 5ITYA 3HJQA 4ZPXA 5E6JA 1VDDA 4JI6M 2CP8A 4BB9A 3E21A 2MH8A 2Z7JA 3FRIA 3KOWE 1PJTA 1UAJA 2WSFF 4JI5M 5ITUA 4OU7A 2HL7A 2B3TA 2DZNB 1XXHA 1IXRC 3F92A 4WP2A 2E5LM 1Q02A 3MJ5A 1MXIA 3VKHA 4M9SA 2YNMD 4GEWA 4MH0E 4LZJA 3J27B 4AG6A 3KOXE 4X65M 3IG8A 1NJGA 3LW5F 1E32A 4NC6A 2F5NA 2BWEA 4PCZA 4W5WA 2VF7A 1Q3BA 2DKLA 3AV0A 1QQWA 1XXHE 1IM2A 1J09A 4I5SA 2K6BA 3TWLA 2OOBA 2DAEA 4GITA 3L2AA 4UN2B 5ITRA 3BBDA 3FYDA 2F4VM 3I01M 3NBXX 4L78A 3B7QA 3SHFA 4FCTA 1NV8A 3Q8GA 3SC3A 3HHXA 2JA2A 3OIIA 1L1TA 2EGWA 4RNAA 1QZMA
chains in the Genus database with same CATH topology
3K92A 3KS4A 5KO3A 3DFZA 4YVKA 2R62A 3K2LA 3WHKA 3AOEC 3GRVA 2ZBKB 3IC6A 4D81A 2Y0TA 3J7AS 4GMQA 2BJVA 3FYCA 3L26A 5EJCA 4DV4M 3T1YM 4E8BA 4CNDA 5IREB 5EP3A 3GLHB 3W0FA 1UAKA 4JAKA 2DVWB 4DV5M 4DV7M 1IBKM 4DR4M 4YQRA 1OJLA 3GYQA 1OY5A 2ERCA 4YQ7A 2XH9A 4IBIA 3L28A 1IN7A 3NWLA 4GIPA 2F5SA 3JR5A 1IN4A 1J85A 5GMBA 3U6PA 1HNXM 4AZFA 4IJEA 2XF3A 2UXDM 1DGFA 4HLQA 1XWIA 4LJ9A 4G6ZA 2HCBA 1L1ZA 1KFVA 4H3ZA 2ZANA 2J7NA 4YQTA 4QOSA 1DO0A 1E9RA 4G4QA 2Y20A 4IBFA 3I4VA 1NXZA 1N77A 5EQTA 1TDHA 2CV0A 4HL4A 1R2ZA 3LQRA 1XHBA 4YPYA 3TQSA 4OVZB 3HHZA 1TO0A 3UZUA 4YVHA 2KW0A 3VK8A 1J7KA 1IXZA 2XZFA 4LF4M 1IPAA 2OQ4A 2HKJA 4YQ6A 2L6OA 2R4JA 3FD9A 4ITQA 1HQCA 4AG5A 4LG2A 5BPVA 3D8BA 2LH0A 4IBBA 5H37D 1NNJA 4AKHA 4YQQA 1TH4A 4IJFA 3TE6A 4D82A 2C9CA 5ITTA 5F3WA 5IT9S 1TH2A 4XGIA 4JALA 1OFIA 3GPUA 4GC9A 4MM3B 3ONPA 3TWKA 3GLIA 3UK6A 4R7GA 3EIHA 3SAUA 3GRRA 4IBGA 3GPPA 3CF2A 4NRVA 4DR5M 2CV1A 3JR4A 4KDZA 4L15A 4LFCM 4DR1M 1HNZM 1XMOM 2UXBM 2XSZD 3L8UA 1IY0A 4AKGA 2QBYA 3HWSA 3KSXA 1R2YA 4CNGA 1Q39A 4EIWA 3KNUA 3AOGA 4M9ZA 4QHSA 1DGHB 4MCCA 4DR2M 2Z4SA 4YQ3A 3GQ3A 2CUZA 4JWHA 1T3TA 5DYIA 4RF1A 1E9SA 2H1RA 5BR8M 1QANA 3FTFA 4REZA 3FKEA 1YSYA 4L4UA 3KTYA 4L8RC 5EXTA 3GO8A 2L7HA 4Z8XA 2LNHC 1IY1A 2O5RA 1NVMA 3U6OA 3VLFB 4JI8M 4LJ4A 1I4WA 3L25A 3A98B 3NK7A 4MGHA 3HJSA 1O6DA 3U6DA 4DUZM 4KLNA 1GL7A 4PZKA 3R9XB 1W5TA 4CNEA 3OTOM 3KW2A 3KW6A 3DOAA 3GLFB 1TGUA 1MX0A 3M0EA 3U60B 4P16A 2C5RA 3J80S 2P5TA 4PT5A 3QUVA 4YQCA 3U6MA 1GLNA 1HT1E 4JV5M 2M5ZA 4LRSA 3VFDA 1G8PA 1XMQM 1J5EM 3RGSA 1KSFX 2AHMA 2R45A 1ZQ9A 3UMMA 4YQJA 1IN8A 8CATA 5JI2E 1DO2A 2C98A 3SYLA 3U6SA 4KGNA 2Y0QA 3A42A 3DZDA 3LQQA 3KSJA 2R46A 3HU3A 3AIAA 3KS8A 5IZ7D 4MGKE 2V6ZM 2KRKA 1Z5BA 3VDPA 4CNFA 3BOSA 3SAVA 3NBIA 1NY5A 3SHGB 2XEPA 4JI3M 3T15A 2QPAA 3U6QA 2YQZA 4K0KM 3ZCBB 4YPXA 2UXCM 3H4MA 3U5ZA 4BLCA 4YPZA 1NHGC 2Z4RA 1SXJD 4B7GA 4MB7A 4I81A 1R6BX 5C1BA 3K1JA 3HKPA 4OX9M 2A5YB 4WW0A 2UUCM 1VH0A 2C99A 3GPYA 4IBKA 1E94E 1SXJB 4LJ8A 3VDUA 1P9PA 2EO2A 4RG1A 1R7RA 4GHAA 2KEBA 2EGVA 4X3LA 4IBEA 2FE8A 3PFIA 2DZOB 4LJAA 3T38A 3KOZE 5FTNA 2R4EA 4FWDA 3GP1A 4I4LA 1FJGM 4YQ1A 5KPTA 2OPFA 1HT2E 2XZUA 1Z59A 4A3VB 2V3JA 3FTDA 2VQEM 3IG5A 2BNKA 5GMCA 2CHGA 3A46A 4YQ8A 1Z85A 2CHVA 3U61A 4B3MM 4MGZE 2Z0YA 4M0DA 1X7OA 3GLGA 3SASA 4CISA 1G59A 4JI0M 2CE7A 2YFQA 3TPZA 2K47A 3HHWA 1I94M 3JAMS 3RE8A 1XXHB 5FLXS 3GQ4A 2EA0A 4DV0M 4YQAA 4KODA 5EP2A 2QCUA 1JR3A 3RFWA 2V3KA 4IIWA 4I8OA 4GC5A 3SMSA 3ZC7B 2LWXA 3U6LA 4DR7M 1QYRA 4DV2M 1PJIA 1UAMA 4IG6A 5EXPA 4G4OA 4B7HA 2I6DA 4IBDA 4DV6M 2O3AA 5D9FA 2RGHA 3A45A 1Z5AA 5IWAM 3FUVA 1DGBA 1QAOA 4D80A 2QMMA 3FUXA 3L29A 1G3IA 5C18A 2CX8A 4YQPA 4FWHA 4Z6YA 1N36M 4L69A 2J7OA 1LV7A 4TUWA 1N32M 3Q8XA 2KZUA 4B3SM 2CHQA 4GKKM 5FTLA 5ITXA 3MHVC 4JI2M 3W0LB 4X66M 2BJWA 3AFHA 3GRYA 2Z3XA 1GL6A 3HGIA 4NOOB 1UAJA 4PD2A 4IBJA 1K3WA 1L2BA 4IBCA 2YY8A 4FCVA 4FMWA 4DV1M 4QOZC 2XFTA 1OFHA 4II7A 1NS5A 3AI9X 1N75A 4LRTA 3O7BA 5FAIA 3LMMA 3QWLA 4LFAM 2DWZB 1IXSB 4LJ5A 4LY6A 2V1UA 5CO4A 2Q2EB 4R3DA 4NSOB 5EP4A 3AXZA 4JWFA 1UALA 4OW0A 2QZ4A 2DWMA 4YQ4A 3GLHA 4MGIE 1XNQM 4PDIA 2UUBM 3J2PB 1DGGA 4WURA 1VHYA 4QHTA 1HQYE 4NSRA 4GHLA 1XC8A 1S3SA 1K3RA 5FTKA 1NNUC 4CHTB 1L2DA 4YQBA 4S12A 4FW9A 3M7GA 4MCBA 4B3TM 1YE9A 4LGYA 3AJIB 1NJFA 1TDZA 3BBEA 4JI1M 2FFJA 2R65A 3M6AA 3E9SA 2FNAA 3N4JA 2EUCA 3PXGA 3FTEA 3BBHA 1PM5A 2DWNA 3QAUA 4FCWA 2NQ8C 2F5PA 1ZAEA 2HA8A 3WHLA 4B08A 4LGMA 4JI4M 5GM8A 5KPZA 3FTCA 4YQ0A 4YHHM 3HU1A 1X37A 4M9XA 4FAKA 1YUBA 4OVZA 1IBMM 3CTWB 3CF6E 3ZH9B 1H6UA 4YQKA 3HJ8A 4NL4H 2V1CA 4KHPM 1WXQA 2VQFM 2VIIA 4LCBA 5DYGA 5FTJA 3GRUA 3GLIB 2KZSA 4JXJA 4DR3M 3SARA 5KQDA 1PJJA 3J7BA 1K3XA 2D7GA 1L8QA 4NXNM 4YVIA 4GH9A 1GZ0A 1V2XA 2RKOA 1GVNA 2L09A 2QBYB 1HR0M 5LMNM 2W82A 3KFUG 3B9PA 1ZJRA 5LMUM 2UU9M 1JQJC 3KP0E 1Q3CA 4QNRA 5ITQA 4AQYM 3FUTA 5EXXA 4YVJA 3AL0C 1Z5CA 3U6EA 1V6ZA 4YQGA 4JI7M 4AI6A 5FSWA 4LJ6A 3SAWA 2ZM6M 4LF9M 4YY3M 1NHWC 3I51A 4LF8M 1DGHA 1N33M 2KA6B 2XSZA 2XLJA 2F5QA 2L7IA 2DXIA 2G8LA 4GKJM 3UJNA 4YQNA 1IQPA 4YPWA 4PDGA 3J81S 1C1KA 1Z6TA 1NY6A 1UM8A 2X8AA 3GQ5A 4JN6A 4YQ2A 1G4AE 2QWVA 2YR0A 1FNNA 4YQSA 2F5OA 2DHRA 3I4YA 4KO8A 4MCDA 3VKGA 7CATA 2KRUA 5DNYA 4G4NA 2G5GX 1HNWM 3VK7A 3HU2A 3KP1E 1ORYB 2Y21A 3KVWA 3UGJA 4YQOA 3CF0A 3AKZA 4L16A 3SYKA 3D8LA 3GLFA 3PNVA 3E5YA 3NK6A 5FTMA 3U60A 3HHYA 2C96A 3AOEA 3TWMA 4LF6M 4LFBM 3TL4X 1L2CA 1IN6A 1QVRA 2ZAOA 3L27A 2I7PA 4FVMA 4DR6M 1SXJC 3KXEC 4QNMA 4G4RA 2UUAM 4YQDA 1GKIA 3PVSA 5KPRA 3EIEA 2HHHM 2X4AA 3SMPA 1K82A 1MU5A 2C9OA 1KYIA 3KOYE 5A2QS 2XGNA 2CV2A 3THGA 1G41A 4FWGA 3RGPA 2RGOA 3C58A 4X62M 4DUYM 1IN5A 2M60A 3U5ZB 4NXMM 1NSFA 3ILKA 4JWJA 2ZAMA 4YVGA 4YQLA 5GKNA 2KXEA 4YQ5A 4X3MA 4BBAA 3OINA 3KY7A 1TH3A 4X64M 4B7FA 4H3YA 3E4RA 4J3CA 3OIJA 3DA1A 2CEAA 3K8ZA 1XNRM 4YQIA 2DWLA 4AKIA 3MK6A 4CGYB 2X49A 1QAQA 5ITXE 4JWGA 4JYAM 3IEFA 4LF7M 3SATA 5E26A 4DV3M 3SBJA 4FD2A 4GRIA 2QP9X 3LVWA 1IY2A 1SXJA 4M0WA 3GPXA 1N34M 2I7NA 3T1HM 3LVVA 1EE8A 3PNYA 2CFOA 1N78A 2R18A 3DCMX 4XBOA 4YQ9A 4NRWA 1W5SA 3R8FA 3FUUA 2XFSA 3SFZA 3U61B 2D7EA 1VHKA 1QAMA 2LXEA 2QENA 4AW4A 3U6CA 2D7HA 1SXJE 4LZZA 4B3RM 4RF0A 3FUWA 5KQ8A 5EP1A 3GLGB 4MGYE 1JR3D 3KDSE 4LJ7A 4LF5M 1X7PA 1D2NA 1IBLM 5EXSA 2FOIC 5JI3E 3N4KA 5ITYA 3HJQA 4ZPXA 5E6JA 1VDDA 4JI6M 4BB9A 2Z7JA 3KOWE 4JI5M 5ITUA 4OU7A 2HL7A 2DZNB 1XXHA 1IXRC 2E5LM 3MJ5A 1MXIA 3VKHA 4M9SA 2YNMD 4MH0E 4AG6A 4LZJA 3J27B 4X65M 3KOXE 3IG8A 1NJGA 2F5NA 1E32A 4PCZA 4W5WA 1Q3BA 3AV0A 1QQWA 4I5SA 1IM2A 1J09A 3TWLA 4GITA 3L2AA 5ITRA 3BBDA 3FYDA 2F4VM 4L78A 3SHFA 4FCTA 3SC3A 3HHXA 2JA2A 3OIIA 1L1TA 2EGWA 4RNAA 1QZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQO A;  4YVK A;  1NS5 A;  3AI9 X;  3O7B A;  3IC6 A;  5FAI A;  3E5Y A;  3QUV A;  3NK6 A;  4YQC A;  5CO4 A;  4E8B A;  4YQJ A;  3BBH A;  4KDZ A;  3AXZ A;  4CND A;  1UAK A;  4JAK A;  4YQD A;  4KGN A;  1UAL A;  4YQ4 A;  4YQR A;  3GYQ A;  1OY5 A;  3AIA A;  4YQ7 A;  1VHY A;  4CNF A;  3ILK A;  1K3R A;  1J85 A;  4YVG A;  5GMB A;  4YQL A;  4YPX A;  4X3M A;  4YQ5 A;  3OIN A;  4YQB A;  4MCB A;  3KY7 A;  4YPZ A;  4H3Y A;  4J3C A;  3OIJ A;  4H3Z A;  4CNE A;  4YQI A;  3BBE A;  3IEF A;  3N4J A;  1VH0 A;  1NXZ A;  1P9P A;  4RG1 A;  2HA8 A;  4X3L A;  2EGV A;  5GM8 A;  4YPY A;  1TO0 A;  4YVH A;  4YQ0 A;  4YQ1 A;  1IPA A;  4XBO A;  3DCM X;  4FAK A;  4YQ9 A;  4YQ6 A;  4YQK A;  2V3J A;  4YQQ A;  5GMC A;  1VHK A;  4YQ8 A;  1Z85 A;  4JAL A;  2Z0Y A;  3ONP A;  4YVI A;  1GZ0 A;  1X7O A;  1V2X A;  1X7P A;  3N4K A;  1ZJR A;  3L8U A;  4CNG A;  4YQA A;  4YVJ A;  3KNU A;  1V6Z A;  4YQG A;  2V3K A;  4MCC A;  4YQ3 A;  1UAM A;  1MXI A;  4IG6 A;  2I6D A;  2O3A A;  5D9F A;  4YQN A;  3KTY A;  4YPW A;  2QMM A;  4YQP A;  2CX8 A;  4L69 A;  4YQ2 A;  2QWV A;  3BBD A;  3NK7 A;  4YQS A;  1O6D A;  4MCD A;  4PZK A;  3OII A;  1UAJ A;  4YQT A;  2EGW A;  2YY8 A;  3KW2 A; 
#chains in the Genus database with same CATH topology
 3K92 A;  3KS4 A;  1VEJ A;  5KO3 A;  3DFZ A;  4L6V 6;  4YVK A;  2R62 A;  3K2L A;  3WHK A;  3AOE C;  3GRV A;  2ZBK B;  3IC6 A;  4D81 A;  1VG5 A;  2Y0T A;  3J7A S;  4GMQ A;  1PJS A;  1WIV A;  2BJV A;  3FYC A;  3L26 A;  5EJC A;  4DV4 M;  3T1Y M;  4E8B A;  2LVN C;  4CND A;  2JZ0 A;  5EP3 A;  3GLH B;  5IRE B;  3W0F A;  1IXS A;  1OTR A;  2K9D A;  1UAK A;  2LTU A;  4JAK A;  2DVW B;  4Q7J A;  4DV5 M;  4DV7 M;  1IBK M;  4DR4 M;  4YQR A;  1OJL A;  3GYQ A;  2DAM A;  3W68 A;  1OY5 A;  2ERC A;  4YQ7 A;  2XH9 A;  4IBI A;  3ONP A;  2KNA A;  3H4J A;  3L28 A;  1IN7 A;  2KNV A;  3NWL A;  4GIP A;  2F5S A;  3JR5 A;  1IN4 A;  1J85 A;  5GMB A;  3ZQJ A;  3U6P A;  1HNX M;  4AZF A;  4IJE A;  2XF3 A;  2UXD M;  1DGF A;  4HLQ A;  1XWI A;  1ZMU A;  1OAI A;  2HCB A;  3IEC A;  4G6Z A;  4LJ9 A;  1KFV A;  1L1Z A;  4H3Z A;  2ZAN A;  2J7N A;  1WGN A;  4YQT A;  4QOS A;  1DO0 A;  1E9R A;  4G4Q A;  2Y20 A;  4IBF A;  1MJG M;  1GAB A;  3I4V A;  1NXZ A;  1N77 A;  5EQT A;  1TDH A;  2CV0 A;  4HL4 A;  1R2Z A;  3LQR A;  1XHB A;  4YPY A;  3TQS A;  2DZL A;  4OVZ B;  3HHZ A;  1TO0 A;  3UZU A;  4YVH A;  2KW0 A;  3VK8 A;  2FH0 A;  1J7K A;  1IXZ A;  2XZF A;  4LF4 M;  2QQ8 A;  1CUK A;  1EIJ A;  1IPA A;  2OQ4 A;  2HKJ A;  4YQ6 A;  2L6O A;  2DAG A;  2R4J A;  3FD9 A;  4ITQ A;  1HQC A;  4AG5 A;  4LG2 A;  5BPV A;  3D8B A;  2LH0 A;  4IBB A;  2QNJ A;  5H37 D;  1NNJ A;  4AKH A;  5L8R F;  1OIZ A;  1TH4 A;  2WSE F;  4IJF A;  3TE6 A;  4D82 A;  2C9C A;  5ITT A;  1QDT A;  5F3W A;  5IT9 S;  1TH2 A;  4XGI A;  4JAL A;  1OFI A;  3GPU A;  1YLA A;  2KNZ A;  2VF8 A;  2ZTD A;  4GC9 A;  2BWB A;  4MM3 B;  3TWK A;  3V76 A;  1NO1 A;  4R7G A;  3EIH A;  3UK6 A;  2J5Y A;  3GRR A;  1OKS A;  3E46 A;  4IBG A;  3SAU A;  3GPP A;  3CF2 A;  4NRV A;  4DR5 M;  2CV1 A;  3JR4 A;  4KDZ A;  4L15 A;  4LFC M;  4DR1 M;  1HNZ M;  1XMO M;  2UXB M;  2XSZ D;  4XK8 F;  1IY0 A;  4AKG A;  2QBY A;  3L8U A;  3HWS A;  3KSX A;  1R2Y A;  4CNG A;  1Q39 A;  4EIW A;  3KNU A;  3AOG A;  4M9Z A;  4QHS A;  1DGH B;  4MCC A;  3GLI E;  4DR2 M;  2KHH A;  2Z4S A;  3LCV B;  4YQ3 A;  3GQ3 A;  2CUZ A;  4JWH A;  1T3T A;  5DYI A;  4P17 A;  4RF1 A;  1E9S A;  2FS1 A;  2H1R A;  3C3D A;  1QAN A;  5BR8 M;  1PGY A;  3FTF A;  1T6O A;  3FKE A;  4REZ A;  1YSY A;  1GJT A;  4L4U A;  3KTY A;  4L8R C;  1WJ7 A;  2WSC F;  3QYB A;  3C9P A;  5EXT A;  3GO8 A;  2L7H A;  2DAI A;  4Z8X A;  2LNH C;  1IY1 A;  1D0K A;  1NVM A;  2O5R A;  3VLF B;  3U6O A;  4LJ4 A;  4JI8 M;  1I4W A;  3L25 A;  1JB0 F;  2L4F A;  2QHO B;  2ZTC A;  3A98 B;  3NK7 A;  2DEN A;  3B7Z A;  4MGH A;  3HJS A;  1O6D A;  3U6D A;  4DUZ M;  4KLN A;  1GL7 A;  2R0I A;  3R9X B;  4PZK A;  1ZMV A;  2JWS A;  1W5T A;  4CNE A;  3OTO M;  3KW2 A;  3KW6 A;  3DOA A;  3GLF B;  1TGU A;  4DBG B;  1MX0 A;  2DNA A;  3M0E A;  4P16 A;  3U60 B;  1A5T A;  2C5R A;  3J80 S;  2P5T A;  4PT5 A;  3QUV A;  4YQC A;  3U6M A;  1GLN A;  1HT1 E;  4JV5 M;  2KDL A;  2M5Z A;  3QYE A;  1G8P A;  4LRS A;  3VFD A;  1XMQ M;  1J5E M;  3RGS A;  1KSF X;  1ZMW A;  2AHM A;  2R45 A;  1ZQ9 A;  3UMM A;  1IFY A;  4YQJ A;  1IN8 A;  2MRO B;  1PJQ A;  8CAT A;  5JI2 E;  1DO2 A;  2C98 A;  3SYL A;  3U6S A;  4KGN A;  2Y0Q A;  3A42 A;  3DZD A;  3LQQ A;  3KSJ A;  2R46 A;  3HU3 A;  2R6F A;  3AIA A;  3KS8 A;  5IZ7 D;  4MGK E;  2V6Z M;  1AIP C;  2KRK A;  4CJ6 A;  1Z5B A;  3VDP A;  4CNF A;  3BOS A;  3SAV A;  3NBI A;  1NY5 A;  3SHG B;  2XEP A;  4JI3 M;  3T15 A;  2QPA A;  3U6Q A;  2YQZ A;  4K0K M;  1QZE A;  3ZCB B;  4YPX A;  1G71 A;  2UXC M;  2HWJ A;  3H4M A;  3U5Z A;  4BLC A;  4YPZ A;  1NHG C;  2Z4R A;  1SXJ D;  1SG9 A;  4B7G A;  4MB7 A;  4I81 A;  1R6B X;  2JY8 A;  5C1B A;  3K1J A;  3HKP A;  4OX9 M;  2A5Y B;  4WW0 A;  2UUC M;  1VH0 A;  2C99 A;  3GPY A;  4IBK A;  1E94 E;  1SXJ B;  4LJ8 A;  3VDU A;  1P9P A;  2EO2 A;  4RG1 A;  1GO5 A;  1R7R A;  1WGL A;  2KEB A;  4GHA A;  2EGV A;  4IBE A;  4X3L A;  2LVO C;  2FE8 A;  3PFI A;  2DZO B;  4LJA A;  3T38 A;  3KOZ E;  5FTN A;  2R4E A;  4FWD A;  3GP1 A;  4I4L A;  1FJG M;  1VEK A;  2OOA A;  4YQ1 A;  5KPT A;  2OPF A;  1HT2 E;  4CIZ A;  2XZU A;  1Z59 A;  2R44 A;  4A3V B;  3FRH A;  1V92 A;  1WHC A;  4F1I A;  3FTD A;  2V3J A;  4KT0 F;  3K9P A;  2VQE M;  3IG5 A;  2BNK A;  2DHY A;  5GMC A;  2CHG A;  3A46 A;  1TF0 B;  1HJP A;  4HEO A;  1Z85 A;  4YQ8 A;  2LHC A;  1OQY A;  2CHV A;  3U61 A;  4B3M M;  4MGZ E;  2Z0Y A;  4M0D A;  1X7O A;  1OIP A;  3GLG A;  4Y28 F;  3K9O A;  3SAS A;  3B89 A;  4CIS A;  1G59 A;  4JI0 M;  1D0M A;  1PRB A;  2CE7 A;  2YFQ A;  3TPZ A;  1AUA A;  2K47 A;  3HHW A;  1I94 M;  3JAM S;  2APL A;  1XXH B;  1QUS A;  3RE8 A;  5FLX S;  3GQ4 A;  2EA0 A;  4DV0 M;  4YQA A;  4KOD A;  2K0B X;  5EP2 A;  2QCU A;  1JR3 A;  2JP7 A;  3RFW A;  2V3K A;  2O01 F;  2LVQ D;  4IIW A;  1TTE A;  4I8O A;  4GC5 A;  3SMS A;  2WZJ A;  2LWX A;  3ZC7 B;  3U6L A;  3GLG E;  1QYR A;  4DV2 M;  1PJI A;  2JNH A;  4DR7 M;  5EXP A;  4G4O A;  4B7H A;  1UAM A;  4IBD A;  4DV6 M;  2I6D A;  2O3A A;  5D9F A;  2RGH A;  3A45 A;  1Z5A A;  5IWA M;  2RRU A;  3FUV A;  1DGB A;  1QAO A;  4D80 A;  2DAK A;  1JR3 E;  2QMM A;  1G3I A;  3FUX A;  3L29 A;  5C18 A;  2CX8 A;  4YQP A;  4FWH A;  4Z6Y A;  1N36 M;  4L69 A;  2J7O A;  1LV7 A;  4TUW A;  1N32 M;  3BXW A;  3Q8X A;  2KZU A;  4B3S M;  2CHQ A;  4GKK M;  5FTL A;  1RU3 A;  5ITX A;  3MHV C;  4JI2 M;  3W0L B;  3B74 A;  4YQQ A;  4X66 M;  2BJW A;  3AFH A;  3GRY A;  2Z3X A;  1GL6 A;  2JY5 A;  3HGI A;  4NOO B;  4PD2 A;  4IBJ A;  1K3W A;  1L2B A;  4IBC A;  1VEG A;  1GJS A;  2YY8 A;  4FCV A;  1C7Y A;  4FMW A;  4DV1 M;  4QOZ C;  2XFT A;  1OFH A;  4II7 A;  1NS5 A;  3AI9 X;  1N75 A;  4LRT A;  3O7B A;  5FAI A;  3LMM A;  3QWL A;  4LFA M;  2DWZ B;  1IXS B;  2N35 A;  4LJ5 A;  4LY6 A;  2V1U A;  5CO4 A;  2Q2E B;  4R3D A;  4NSO B;  5EP4 A;  3AXZ A;  2H5X A;  4JWF A;  1UAL A;  4OW0 A;  2QZ4 A;  2DWM A;  2MJ5 B;  4YQ4 A;  3GLH A;  4MGI E;  4IG6 A;  1XNQ M;  2JZ1 A;  4PDI A;  2UUB M;  3J2P B;  1DGG A;  4WUR A;  1VHY A;  4QHT A;  1HQY E;  4NSR A;  4GHL A;  1XC8 A;  1S3S A;  2LHG A;  1K3R A;  5FTK A;  1NNU C;  4CHT B;  1L2D A;  4YQB A;  4S12 A;  4FW9 A;  1V33 A;  3M7G A;  4MCB A;  3GLH E;  4B3T M;  1YE9 A;  4LGY A;  3AJI B;  1NJF A;  1TDZ A;  3BBE A;  4JI1 M;  2FFJ A;  2R65 A;  3M6A A;  3E9S A;  2FNA A;  3N4J A;  1R5L A;  2EUC A;  3PXG A;  3FTE A;  3BBH A;  1PM5 A;  2DWN A;  3C3E A;  3QAU A;  4FCW A;  1EFU B;  3HZJ A;  4R71 A;  2NQ8 C;  2F5P A;  1ZAE A;  2HA8 A;  3WHL A;  4B08 A;  4LGM A;  4JI4 M;  5GM8 A;  5KPZ A;  3FTC A;  4YQ0 A;  4YHH M;  3HU1 A;  1X37 A;  4M9X A;  4FAK A;  1YUB A;  4OVZ A;  1IBM M;  2EKF A;  3CTW B;  1DV0 A;  3CF6 E;  3ZH9 B;  1H6U A;  4YQK A;  3BBZ A;  3HJ8 A;  4NL4 H;  2JXN A;  2V1C A;  4KHP M;  1WXQ A;  3T6P A;  2VQF M;  2VII A;  4LCB A;  5DYG A;  3W67 A;  5FTJ A;  3GRU A;  3GLI B;  2KZS A;  4JXJ A;  4DR3 M;  3SAR A;  5KQD A;  1PJJ A;  3J7B A;  1K3X A;  2D7G A;  2DI0 A;  1L8Q A;  4NXN M;  4YVI A;  4GH9 A;  1GZ0 A;  1V2X A;  2EKK A;  2RKO A;  1GVN A;  2L09 A;  4RKU F;  2QBY B;  1OAO C;  1HR0 M;  5LMN M;  2W82 A;  3KFU G;  3B9P A;  1ZJR A;  5LMU M;  2UU9 M;  1JQJ C;  3KP0 E;  1Q3C A;  4QNR A;  5ITQ A;  4AQY M;  3FUT A;  5EXX A;  4YVJ A;  3AL0 C;  1Z5C A;  3U6E A;  1V6Z A;  4YQG A;  2CWB A;  4JI7 M;  4AI6 A;  5FSW A;  1BVS A;  2Z8Y M;  2OO9 A;  4LJ6 A;  2ZM6 M;  3SAW A;  4LF9 M;  4YY3 M;  1NHW C;  2CRU A;  3I51 A;  4LF8 M;  1DGH A;  2MGW A;  1N33 M;  2KA6 B;  2XSZ A;  2GNO A;  1V34 A;  2XLJ A;  2F5Q A;  2L7I A;  2DXI A;  2G8L A;  2O25 A;  4GKJ M;  3UJN A;  4YQN A;  1IQP A;  4YPW A;  4PDG A;  3J81 S;  3LCU A;  1Z6T A;  1C1K A;  3B7N A;  1NY6 A;  1UM8 A;  2X8A A;  3GQ5 A;  4JN6 A;  4G3O A;  4YQ2 A;  1G4A E;  2QWV A;  2YR0 A;  1FNN A;  4YQS A;  2F5O A;  3FE3 A;  2DHR A;  1WR1 B;  3I4Y A;  4KO8 A;  4MCD A;  3VKG A;  1QUT A;  7CAT A;  1VQ1 A;  2KRU A;  5DNY A;  4G4N A;  1ZV1 A;  2G5G X;  3VK7 A;  1HNW M;  3HU2 A;  3KP1 E;  1ORY B;  2Y21 A;  3KVW A;  3UGJ A;  2QSF X;  4YQO A;  3CGW A;  3CF0 A;  3AKZ A;  1P3Q Q;  4L16 A;  3SYK A;  3D8L A;  3GLF A;  3PNV A;  3E5Y A;  1D0L A;  3NK6 A;  1MN3 A;  3HY5 A;  1UFZ A;  5FTM A;  3U60 A;  3HHY A;  4F2L A;  2EJS A;  2C96 A;  2G3Q A;  3AOE A;  1Y8G A;  3TWM A;  2L4E A;  4LF6 M;  4LFB M;  1F4I A;  3TL4 X;  1L2C A;  1IN6 A;  1QVR A;  2ZAO A;  3L27 A;  2I7P A;  4FVM A;  4DR6 M;  1SXJ C;  3KXE C;  4QNM A;  4G4R A;  1TR8 A;  2UUA M;  4YQD A;  1GKI A;  3PVS A;  5KPR A;  3EIE A;  2HHH M;  2X4A A;  3SMP A;  3GLF E;  1K82 A;  1MU5 A;  2C9O A;  1KYI A;  3KOY E;  5A2Q S;  2L2D A;  2XGN A;  2CV2 A;  1QDR A;  3THG A;  1G41 A;  4FWG A;  3RGP A;  2RGO A;  3C58 A;  4X62 M;  3IHP A;  4DUY M;  1IN5 A;  2M60 A;  3U5Z B;  3GLI A;  1NSF A;  3ILK A;  4NXM M;  4JWJ A;  2ZAM A;  4YVG A;  4YQL A;  5GKN A;  2KXE A;  4YQ5 A;  4X3M A;  4BBA A;  3OIN A;  3HX3 A;  3MMP A;  3KY7 A;  1TH3 A;  4X64 M;  4B7F A;  4H3Y A;  3E4R A;  4J3C A;  3OIJ A;  3DA1 A;  2CEA A;  3K8Z A;  1XNR M;  2HAK A;  4YQI A;  1XB2 B;  2DWL A;  4AKI A;  3MK6 A;  4CGY B;  2X49 A;  1QAQ A;  5ITX E;  4JWG A;  4JYA M;  3IEF A;  4LF7 M;  3SAT A;  5E26 A;  4DV3 M;  3SBJ A;  4FD2 A;  4GRI A;  1T43 A;  2QP9 X;  1LTM A;  3I04 M;  3LVW A;  1IY2 A;  1SXJ A;  4M0W A;  3GPX A;  1N34 M;  2I7N A;  3T1H M;  2LVP C;  1EE8 A;  3LVV A;  2CFO A;  2JY7 A;  3PNY A;  1N78 A;  2R18 A;  3DCM X;  4XBO A;  4YQ9 A;  2MR9 A;  1R4G A;  4NRW A;  1W5S A;  3R8F A;  1NV9 A;  3FUU A;  2XFS A;  3SFZ A;  3U61 B;  2D7E A;  1VHK A;  1QAM A;  2LXE A;  2QEN A;  2LBC A;  2LVA A;  4AW4 A;  2GQF A;  3U6C A;  2D7H A;  1SXJ E;  4LZZ A;  4B3R M;  4RF0 A;  3FUW A;  5KQ8 A;  5EP1 A;  3GLG B;  2JY6 B;  2VDB B;  4MGY E;  5DFL A;  2JUJ A;  1VDL A;  1JR3 D;  4ANR A;  3KDS E;  4LJ7 A;  4LF5 M;  1X7P A;  1D2N A;  1IBL M;  5EXS A;  2FOI C;  5JI3 E;  3N4K A;  5ITY A;  3HJQ A;  4ZPX A;  5E6J A;  1VDD A;  4JI6 M;  2CP8 A;  4BB9 A;  3E21 A;  2MH8 A;  2Z7J A;  3FRI A;  3KOW E;  1PJT A;  1UAJ A;  2WSF F;  4JI5 M;  5ITU A;  4OU7 A;  2HL7 A;  2B3T A;  2DZN B;  1XXH A;  1IXR C;  3F92 A;  4WP2 A;  2E5L M;  1Q02 A;  3MJ5 A;  1MXI A;  3VKH A;  4M9S A;  2YNM D;  4GEW A;  4MH0 E;  4LZJ A;  3J27 B;  4AG6 A;  3KOX E;  4X65 M;  3IG8 A;  1NJG A;  3LW5 F;  1E32 A;  4NC6 A;  2F5N A;  2BWE A;  4PCZ A;  4W5W A;  2VF7 A;  1Q3B A;  2DKL A;  3AV0 A;  1QQW A;  1XXH E;  1IM2 A;  1J09 A;  4I5S A;  2K6B A;  3TWL A;  2OOB A;  2DAE A;  4GIT A;  3L2A A;  4UN2 B;  5ITR A;  3BBD A;  3FYD A;  2F4V M;  3I01 M;  3NBX X;  4L78 A;  3B7Q A;  3SHF A;  4FCT A;  1NV8 A;  3Q8G A;  3SC3 A;  3HHX A;  2JA2 A;  3OII A;  1L1T A;  2EGW A;  4RNA A;  1QZM A; 
#chains in the Genus database with same CATH homology
 3K92 A;  3KS4 A;  5KO3 A;  3DFZ A;  4YVK A;  2R62 A;  3K2L A;  3WHK A;  3AOE C;  3GRV A;  2ZBK B;  3IC6 A;  4D81 A;  2Y0T A;  3J7A S;  4GMQ A;  2BJV A;  3FYC A;  3L26 A;  5EJC A;  4DV4 M;  3T1Y M;  4E8B A;  4CND A;  5IRE B;  5EP3 A;  3GLH B;  3W0F A;  1UAK A;  4JAK A;  2DVW B;  4DV5 M;  4DV7 M;  1IBK M;  4DR4 M;  4YQR A;  1OJL A;  3GYQ A;  1OY5 A;  2ERC A;  4YQ7 A;  2XH9 A;  4IBI A;  3L28 A;  1IN7 A;  3NWL A;  4GIP A;  2F5S A;  3JR5 A;  1IN4 A;  1J85 A;  5GMB A;  3U6P A;  1HNX M;  4AZF A;  4IJE A;  2XF3 A;  2UXD M;  1DGF A;  4HLQ A;  1XWI A;  4LJ9 A;  4G6Z A;  2HCB A;  1L1Z A;  1KFV A;  4H3Z A;  2ZAN A;  2J7N A;  4YQT A;  4QOS A;  1DO0 A;  1E9R A;  4G4Q A;  2Y20 A;  4IBF A;  3I4V A;  1NXZ A;  1N77 A;  5EQT A;  1TDH A;  2CV0 A;  4HL4 A;  1R2Z A;  3LQR A;  1XHB A;  4YPY A;  3TQS A;  4OVZ B;  3HHZ A;  1TO0 A;  3UZU A;  4YVH A;  2KW0 A;  3VK8 A;  1J7K A;  1IXZ A;  2XZF A;  4LF4 M;  1IPA A;  2OQ4 A;  2HKJ A;  4YQ6 A;  2L6O A;  2R4J A;  3FD9 A;  4ITQ A;  1HQC A;  4AG5 A;  4LG2 A;  5BPV A;  3D8B A;  2LH0 A;  4IBB A;  5H37 D;  1NNJ A;  4AKH A;  4YQQ A;  1TH4 A;  4IJF A;  3TE6 A;  4D82 A;  2C9C A;  5ITT A;  5F3W A;  5IT9 S;  1TH2 A;  4XGI A;  4JAL A;  1OFI A;  3GPU A;  4GC9 A;  4MM3 B;  3ONP A;  3TWK A;  3GLI A;  3UK6 A;  4R7G A;  3EIH A;  3SAU A;  3GRR A;  4IBG A;  3GPP A;  3CF2 A;  4NRV A;  4DR5 M;  2CV1 A;  3JR4 A;  4KDZ A;  4L15 A;  4LFC M;  4DR1 M;  1HNZ M;  1XMO M;  2UXB M;  2XSZ D;  3L8U A;  1IY0 A;  4AKG A;  2QBY A;  3HWS A;  3KSX A;  1R2Y A;  4CNG A;  1Q39 A;  4EIW A;  3KNU A;  3AOG A;  4M9Z A;  4QHS A;  1DGH B;  4MCC A;  4DR2 M;  2Z4S A;  4YQ3 A;  3GQ3 A;  2CUZ A;  4JWH A;  1T3T A;  5DYI A;  4RF1 A;  1E9S A;  2H1R A;  5BR8 M;  1QAN A;  3FTF A;  4REZ A;  3FKE A;  1YSY A;  4L4U A;  3KTY A;  4L8R C;  5EXT A;  3GO8 A;  2L7H A;  4Z8X A;  2LNH C;  1IY1 A;  2O5R A;  1NVM A;  3U6O A;  3VLF B;  4JI8 M;  4LJ4 A;  1I4W A;  3L25 A;  3A98 B;  3NK7 A;  4MGH A;  3HJS A;  1O6D A;  3U6D A;  4DUZ M;  4KLN A;  1GL7 A;  4PZK A;  3R9X B;  1W5T A;  4CNE A;  3OTO M;  3KW2 A;  3KW6 A;  3DOA A;  3GLF B;  1TGU A;  1MX0 A;  3M0E A;  3U60 B;  4P16 A;  2C5R A;  3J80 S;  2P5T A;  4PT5 A;  3QUV A;  4YQC A;  3U6M A;  1GLN A;  1HT1 E;  4JV5 M;  2M5Z A;  4LRS A;  3VFD A;  1G8P A;  1XMQ M;  1J5E M;  3RGS A;  1KSF X;  2AHM A;  2R45 A;  1ZQ9 A;  3UMM A;  4YQJ A;  1IN8 A;  8CAT A;  5JI2 E;  1DO2 A;  2C98 A;  3SYL A;  3U6S A;  4KGN A;  2Y0Q A;  3A42 A;  3DZD A;  3LQQ A;  3KSJ A;  2R46 A;  3HU3 A;  3AIA A;  3KS8 A;  5IZ7 D;  4MGK E;  2V6Z M;  2KRK A;  1Z5B A;  3VDP A;  4CNF A;  3BOS A;  3SAV A;  3NBI A;  1NY5 A;  3SHG B;  2XEP A;  4JI3 M;  3T15 A;  2QPA A;  3U6Q A;  2YQZ A;  4K0K M;  3ZCB B;  4YPX A;  2UXC M;  3H4M A;  3U5Z A;  4BLC A;  4YPZ A;  1NHG C;  2Z4R A;  1SXJ D;  4B7G A;  4MB7 A;  4I81 A;  1R6B X;  5C1B A;  3K1J A;  3HKP A;  4OX9 M;  2A5Y B;  4WW0 A;  2UUC M;  1VH0 A;  2C99 A;  3GPY A;  4IBK A;  1E94 E;  1SXJ B;  4LJ8 A;  3VDU A;  1P9P A;  2EO2 A;  4RG1 A;  1R7R A;  4GHA A;  2KEB A;  2EGV A;  4X3L A;  4IBE A;  2FE8 A;  3PFI A;  2DZO B;  4LJA A;  3T38 A;  3KOZ E;  5FTN A;  2R4E A;  4FWD A;  3GP1 A;  4I4L A;  1FJG M;  4YQ1 A;  5KPT A;  2OPF A;  1HT2 E;  2XZU A;  1Z59 A;  4A3V B;  2V3J A;  3FTD A;  2VQE M;  3IG5 A;  2BNK A;  5GMC A;  2CHG A;  3A46 A;  4YQ8 A;  1Z85 A;  2CHV A;  3U61 A;  4B3M M;  4MGZ E;  2Z0Y A;  4M0D A;  1X7O A;  3GLG A;  3SAS A;  4CIS A;  1G59 A;  4JI0 M;  2CE7 A;  2YFQ A;  3TPZ A;  2K47 A;  3HHW A;  1I94 M;  3JAM S;  3RE8 A;  1XXH B;  5FLX S;  3GQ4 A;  2EA0 A;  4DV0 M;  4YQA A;  4KOD A;  5EP2 A;  2QCU A;  1JR3 A;  3RFW A;  2V3K A;  4IIW A;  4I8O A;  4GC5 A;  3SMS A;  3ZC7 B;  2LWX A;  3U6L A;  4DR7 M;  1QYR A;  4DV2 M;  1PJI A;  1UAM A;  4IG6 A;  5EXP A;  4G4O A;  4B7H A;  2I6D A;  4IBD A;  4DV6 M;  2O3A A;  5D9F A;  2RGH A;  3A45 A;  1Z5A A;  5IWA M;  3FUV A;  1DGB A;  1QAO A;  4D80 A;  2QMM A;  3FUX A;  3L29 A;  1G3I A;  5C18 A;  2CX8 A;  4YQP A;  4FWH A;  4Z6Y A;  1N36 M;  4L69 A;  2J7O A;  1LV7 A;  4TUW A;  1N32 M;  3Q8X A;  2KZU A;  4B3S M;  2CHQ A;  4GKK M;  5FTL A;  5ITX A;  3MHV C;  4JI2 M;  3W0L B;  4X66 M;  2BJW A;  3AFH A;  3GRY A;  2Z3X A;  1GL6 A;  3HGI A;  4NOO B;  1UAJ A;  4PD2 A;  4IBJ A;  1K3W A;  1L2B A;  4IBC A;  2YY8 A;  4FCV A;  4FMW A;  4DV1 M;  4QOZ C;  2XFT A;  1OFH A;  4II7 A;  1NS5 A;  3AI9 X;  1N75 A;  4LRT A;  3O7B A;  5FAI A;  3LMM A;  3QWL A;  4LFA M;  2DWZ B;  1IXS B;  4LJ5 A;  4LY6 A;  2V1U A;  5CO4 A;  2Q2E B;  4R3D A;  4NSO B;  5EP4 A;  3AXZ A;  4JWF A;  1UAL A;  4OW0 A;  2QZ4 A;  2DWM A;  4YQ4 A;  3GLH A;  4MGI E;  1XNQ M;  4PDI A;  2UUB M;  3J2P B;  1DGG A;  4WUR A;  1VHY A;  4QHT A;  1HQY E;  4NSR A;  4GHL A;  1XC8 A;  1S3S A;  1K3R A;  5FTK A;  1NNU C;  4CHT B;  1L2D A;  4YQB A;  4S12 A;  4FW9 A;  3M7G A;  4MCB A;  4B3T M;  1YE9 A;  4LGY A;  3AJI B;  1NJF A;  1TDZ A;  3BBE A;  4JI1 M;  2FFJ A;  2R65 A;  3M6A A;  3E9S A;  2FNA A;  3N4J A;  2EUC A;  3PXG A;  3FTE A;  3BBH A;  1PM5 A;  2DWN A;  3QAU A;  4FCW A;  2NQ8 C;  2F5P A;  1ZAE A;  2HA8 A;  3WHL A;  4B08 A;  4LGM A;  4JI4 M;  5GM8 A;  5KPZ A;  3FTC A;  4YQ0 A;  4YHH M;  3HU1 A;  1X37 A;  4M9X A;  4FAK A;  1YUB A;  4OVZ A;  1IBM M;  3CTW B;  3CF6 E;  3ZH9 B;  1H6U A;  4YQK A;  3HJ8 A;  4NL4 H;  2V1C A;  4KHP M;  1WXQ A;  2VQF M;  2VII A;  4LCB A;  5DYG A;  5FTJ A;  3GRU A;  3GLI B;  2KZS A;  4JXJ A;  4DR3 M;  3SAR A;  5KQD A;  1PJJ A;  3J7B A;  1K3X A;  2D7G A;  1L8Q A;  4NXN M;  4YVI A;  4GH9 A;  1GZ0 A;  1V2X A;  2RKO A;  1GVN A;  2L09 A;  2QBY B;  1HR0 M;  5LMN M;  2W82 A;  3KFU G;  3B9P A;  1ZJR A;  5LMU M;  2UU9 M;  1JQJ C;  3KP0 E;  1Q3C A;  4QNR A;  5ITQ A;  4AQY M;  3FUT A;  5EXX A;  4YVJ A;  3AL0 C;  1Z5C A;  3U6E A;  1V6Z A;  4YQG A;  4JI7 M;  4AI6 A;  5FSW A;  4LJ6 A;  3SAW A;  2ZM6 M;  4LF9 M;  4YY3 M;  1NHW C;  3I51 A;  4LF8 M;  1DGH A;  1N33 M;  2KA6 B;  2XSZ A;  2XLJ A;  2F5Q A;  2L7I A;  2DXI A;  2G8L A;  4GKJ M;  3UJN A;  4YQN A;  1IQP A;  4YPW A;  4PDG A;  3J81 S;  1C1K A;  1Z6T A;  1NY6 A;  1UM8 A;  2X8A A;  3GQ5 A;  4JN6 A;  4YQ2 A;  1G4A E;  2QWV A;  2YR0 A;  1FNN A;  4YQS A;  2F5O A;  2DHR A;  3I4Y A;  4KO8 A;  4MCD A;  3VKG A;  7CAT A;  2KRU A;  5DNY A;  4G4N A;  2G5G X;  1HNW M;  3VK7 A;  3HU2 A;  3KP1 E;  1ORY B;  2Y21 A;  3KVW A;  3UGJ A;  4YQO A;  3CF0 A;  3AKZ A;  4L16 A;  3SYK A;  3D8L A;  3GLF A;  3PNV A;  3E5Y A;  3NK6 A;  5FTM A;  3U60 A;  3HHY A;  2C96 A;  3AOE A;  3TWM A;  4LF6 M;  4LFB M;  3TL4 X;  1L2C A;  1IN6 A;  1QVR A;  2ZAO A;  3L27 A;  2I7P A;  4FVM A;  4DR6 M;  1SXJ C;  3KXE C;  4QNM A;  4G4R A;  2UUA M;  4YQD A;  1GKI A;  3PVS A;  5KPR A;  3EIE A;  2HHH M;  2X4A A;  3SMP A;  1K82 A;  1MU5 A;  2C9O A;  1KYI A;  3KOY E;  5A2Q S;  2XGN A;  2CV2 A;  3THG A;  1G41 A;  4FWG A;  3RGP A;  2RGO A;  3C58 A;  4X62 M;  4DUY M;  1IN5 A;  2M60 A;  3U5Z B;  4NXM M;  1NSF A;  3ILK A;  4JWJ A;  2ZAM A;  4YVG A;  4YQL A;  5GKN A;  2KXE A;  4YQ5 A;  4X3M A;  4BBA A;  3OIN A;  3KY7 A;  1TH3 A;  4X64 M;  4B7F A;  4H3Y A;  3E4R A;  4J3C A;  3OIJ A;  3DA1 A;  2CEA A;  3K8Z A;  1XNR M;  4YQI A;  2DWL A;  4AKI A;  3MK6 A;  4CGY B;  2X49 A;  1QAQ A;  5ITX E;  4JWG A;  4JYA M;  3IEF A;  4LF7 M;  3SAT A;  5E26 A;  4DV3 M;  3SBJ A;  4FD2 A;  4GRI A;  2QP9 X;  3LVW A;  1IY2 A;  1SXJ A;  4M0W A;  3GPX A;  1N34 M;  2I7N A;  3T1H M;  3LVV A;  1EE8 A;  3PNY A;  2CFO A;  1N78 A;  2R18 A;  3DCM X;  4XBO A;  4YQ9 A;  4NRW A;  1W5S A;  3R8F A;  3FUU A;  2XFS A;  3SFZ A;  3U61 B;  2D7E A;  1VHK A;  1QAM A;  2LXE A;  2QEN A;  4AW4 A;  3U6C A;  2D7H A;  1SXJ E;  4LZZ A;  4B3R M;  4RF0 A;  3FUW A;  5KQ8 A;  5EP1 A;  3GLG B;  4MGY E;  1JR3 D;  3KDS E;  4LJ7 A;  4LF5 M;  1X7P A;  1D2N A;  1IBL M;  5EXS A;  2FOI C;  5JI3 E;  3N4K A;  5ITY A;  3HJQ A;  4ZPX A;  5E6J A;  1VDD A;  4JI6 M;  4BB9 A;  2Z7J A;  3KOW E;  4JI5 M;  5ITU A;  4OU7 A;  2HL7 A;  2DZN B;  1XXH A;  1IXR C;  2E5L M;  3MJ5 A;  1MXI A;  3VKH A;  4M9S A;  2YNM D;  4MH0 E;  4AG6 A;  4LZJ A;  3J27 B;  4X65 M;  3KOX E;  3IG8 A;  1NJG A;  2F5N A;  1E32 A;  4PCZ A;  4W5W A;  1Q3B A;  3AV0 A;  1QQW A;  4I5S A;  1IM2 A;  1J09 A;  3TWL A;  4GIT A;  3L2A A;  5ITR A;  3BBD A;  3FYD A;  2F4V M;  4L78 A;  3SHF A;  4FCT A;  3SC3 A;  3HHX A;  2JA2 A;  3OII A;  1L1T A;  2EGW A;  4RNA A;  1QZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...