4XBOA

Crystal structure of full length e.coli trmj in complex with sah
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
238
structure length
228
Chain Sequence
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQTPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb
source organism Escherichia coli k12
total genus 67
structure length 228
sequence length 238
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.590 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4xboA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4xboA01
4PZKA 4MCBA 1X7PA 1GZ0A 2EGWA 3OIJA 3KNUA 3NK6A 3NK7A 4CNDA 1UALA 4RG1A 2V3JA 5GMBA 3KW2A 3N4JA 4YQ6A 4YQ1A 4MCCA 2HA8A 2QMMA 4L69A 3KTYA 2YY8A 4YQ5A 4YQJA 4YVHA 4YQLA 4YQKA 4MCDA 1ZJRA 3AI9X 4KGNA 4YQNA 4YQ8A 4YQ9A 2O3AA 4YQBA 4YQDA 3ILKA 5GMCA 2V3KA 4H3YA 4YPYA 4YQ3A 1IPAA 4YQQA 1J85A 4X3LA 4YQ2A 2QWVA 1VHKA 3GYQA 1OY5A 4CNFA 1V2XA 1Z85A 2CX8A 1UAKA 4YQ0A 2EGVA 4YVGA 4XBOA 3O7BA 5CO4A 4YPXA 4YVKA 4X3MA 4YQ7A 3OINA 3ONPA 4CNGA 3QUVA 4YQSA 3DCMX 1NS5A 4YQTA 3AXZA 4YQIA 1UAMA 4YQOA 4KDZA 4CNEA 1TO0A 3BBHA 1O6DA 1NXZA 2Z0YA 3L8UA 1VH0A 4IG6A 4YQRA 1VHYA 4H3ZA 4YQCA 4YQAA 3E5YA 1UAJA 5D9FA 4YQ4A 3IC6A 1V6ZA 1K3RA 4YPZA 3N4KA 3KY7A 4JAKA 4JALA 4YQPA 3AIAA 3BBEA 5GM8A 1X7OA 5FAIA 3OIIA 1MXIA 1P9PA 4YQGA 3IEFA 3BBDA 4J3CA 4FAKA 4YVJA 2I6DA 4YVIA 4YPWA 4E8BA
chains in the Genus database with same CATH superfamily
1I4WA 3UJNA 4GITA 1OJLA 1GZ0A 2DWZB 3KNUA 4B7FA 1JQJC 1OKSA 2JUJA 2DAIA 2ZAOA 1QAQA 1DO2A 2V3JA 4MGYE 4JI8M 1HR0M 1N34M 2X8AA 2VDBB 4KLNA 3SC3A 1Z59A 1FJGM 4G3OA 1IN8A 1NV9A 3AOEA 1GJSA 1SXJA 4LZJA 5KO3A 3AOEC 2DHYA 1NY5A 2C96A 1AIPC 4YQJA 2LTUA 2K0BX 3D8LA 3GLHB 3VDPA 2DVWB 2HKJA 2DKLA 2EKFA 4YY3M 4FWGA 4DR5M 2DAMA 3L26A 4YQ9A 1OTRA 1IY1A 4MH0E 1NJFA 2O3AA 2FE8A 5ITYA 4YQDA 3ILKA 1VDDA 3SAVA 2XF3A 5GMCA 4H3YA 1TDHA 2L7HA 3FYDA 4YPYA 1TDZA 5GKNA 2L09A 2O5RA 3SYLA 4EIWA 5L8RF 3LW5F 3K9OA 3MHVC 4L15A 2OQ4A 4YQQA 1J85A 4X3LA 3FUVA 3UMMA 1VQ1A 2KEBA 1SXJE 2QNJA 3KOYE 3E21A 3SBJA 2F5OA 2EJSA 4P16A 1CUKA 5FTJA 2VF7A 4B3TM 3IG8A 4REZA 1YE9A 3TWMA 4LFCM 1IN7A 2QCUA 1NJGA 3KDSE 4CNFA 1J7KA 1HQCA 2CHVA 1Q3BA 1ZMVA 2HAKA 4OW0A 3GQ5A 2HWJA 4XBOA 3B7ZA 2CV2A 3O7BA 2L4FA 1XHBA 2ZTCA 2ERCA 4QOZC 4YPXA 3HU1A 3EIHA 3W68A 3WHLA 2GQFA 2CWBA 1UFZA 1P3QQ 4L6V6 4X3MA 4YVKA 1JR3A 4YQ7A 4IBKA 3ONPA 2D7HA 2M5ZA 4CNGA 3U6CA 5KPRA 3SMSA 1NS5A 3GPYA 5EXSA 3AXZA 3HZJA 2QHOB 2XSZD 1WIVA 1PM5A 3GO8A 4LRTA 2ZTDA 2FFJA 4MB7A 4RF0A 4ANRA 1OFHA 2LVPC 2J7OA 3I04M 3PNVA 3GPUA 2Z0YA 1Q39A 2OPFA 4QNRA 4II7A 3GRRA 3AL0C 5ITUA 4I4LA 3RE8A 4JWJA 3HX3A 1RU3A 4YQCA 1G4AE 1WJ7A 3U6LA 4YQAA 1GJTA 4DR6M 4LJ4A 3GQ4A 2MH8A 3K2LA 2H5XA 1V6ZA 3T15A 3B74A 3A42A 1ZMUA 1JR3E 4YPZA 3M6AA 4LF7M 2LVQD 3FYCA 1QUSA 1YUBA 2ZBKB 2YFQA 3GLFA 2DWLA 1N32M 4JALA 4MGHA 4G6ZA 2YQZA 3SMPA 2CV1A 4LFBM 3OIIA 2C98A 2Z7JA 2DI0A 5JI2E 4NSOB 3GLIA 1IXSA 1N36M 3SATA 2YR0A 2GNOA 2L2DA 4QNMA 4IG6A 3DZDA 3BBDA 2DNAA 3QWLA 3KSJA 2BJWA 3K8ZA 4FWHA 2R62A 2XFSA 3M7GA 1L2DA 3J27B 4L78A 4B7HA 2I6DA 4GRIA 5EP2A 3I4YA 1K82A 4JV5M 3J2PB 4LJ5A 5BPVA 4YVIA 3SFZA 2JZ0A 3KS4A 4B08A 3U6QA 1XNRM 4YPWA 5EJCA 2HL7A 3GQ3A 4FD2A 1TTEA 3VKGA 5DFLA 2Z4SA 1PJTA 4NSRA 3RFWA 2OO9A 3A98B 3GLFE 2D7EA 4IBEA 2FOIC 1IBMM 3NK6A 3NK7A 3KOXE 4MGIE 1G41A 3SASA 2KNVA 5F3WA 3GPPA 2B3TA 3GLGA 2LHCA 4Q7JA 3GLIE 1QYRA 4HL4A 3N4JA 3U5ZA 2A5YB 1IQPA 2K6BA 4YQ6A 4YQ1A 2LH0A 2DENA 2LWXA 3FE3A 3HY5A 1NY6A 4D80A 2Z4RA 1KFVA 4L69A 3KTYA 3ZCBB 4JWGA 2YY8A 3FRHA 4X64M 1DGFA 4DUYM 2WZJA 3JR4A 1HJPA 2BNKA 2G8LA 1SXJB 5DYGA 3HKPA 4YQLA 3C3DA 2X4AA 4MCDA 1ZJRA 3AI9X 1R6BX 3HHXA 4DV0M 4DV2M 4G4NA 3PFIA 5KPTA 2L6OA 3E9SA 4B3SM 2KZSA 3R8FA 3KOZE 2UXBM 4LY6A 1PJSA 3GLGE 2BJVA 1XXHA 3I01M 3B7NA 4LF4M 5FTLA 4YQ3A 2KRUA 4DV5M 4WURA 3HGIA 5E26A 3SAWA 2VQFM 3SYKA 3W0LB 4YQ2A 1NO1A 2CFOA 4G4QA 2R65A 5C18A 4NC6A 4R71A 4DR3M 4ITQA 4L8RC 1DGBA 4M0DA 4B7GA 3AOGA 4HEOA 4RNAA 2ZM6M 4AW4A 1OY5A 1OFIA 1NHWC 2CHGA 5EP4A 1L8QA 4FCTA 1G8PA 4I8OA 3U6EA 1XMQM 2QZ4A 2Z8YM 3L28A 4Z8XA 2QBYB 4DR2M 1WHCA 1WXQA 4FWDA 1HNWM 2JY6B 4YVGA 4YQ0A 1H6UA 2K47A 1ZMWA 3FUWA 2V1CA 3HWSA 3IG5A 3RGPA 3UGJA 2BWBA 3QAUA 2HHHM 3R9XB 1GLNA 3OINA 1A5TA 3QUVA 3DCMX 2EUCA 1D2NA 5FLXS 4GC9A 3HU2A 4FMWA 4YQOA 4KDZA 4UN2B 1KYIA 1Z5BA 2WSEF 3U60A 1OAIA 4LFAM 4BBAA 1Z5AA 3FUUA 1O6DA 1E9RA 3JAMS 3LCUA 1N33M 3KVWA 3KOWE 2DWNA 3KS8A 3MMPA 1QZEA 2Z3XA 3LQQA 3MK6A 1MU5A 3TWKA 1JB0F 1FNNA 3SHGB 4FCVA 4LF8M 1VHYA 4YQRA 1T3TA 1G71A 1ZQ9A 3FKEA 4GHAA 4AKIA 3E4RA 3H4MA 1D0MA 4IBBA 3E5YA 1GVNA 4Z6YA 4IBGA 3IC6A 4WW0A 2VIIA 2R0IA 1QZMA 3UZUA 1E32A 3Q8GA 3VFDA 1IY2A 4JAKA 2XGNA 3AIAA 3QYEA 2F5QA 2QENA 5GM8A 1C1KA 1X7OA 5FAIA 3NBIA 3PVSA 2MGWA 1MXIA 4HLQA 4JI7M 1VEGA 3PXGA 3T6PA 4NL4H 3GLFB 2KA6B 4IBFA 2R18A 2JZ1A 3ZC7B 5KQ8A 2LVNC 2I7NA 3FTDA 1XC8A 1PJJA 4GHLA 2UXDM 2KNAA 4M9SA 4FAKA 3GLIB 4YVJA 2HCBA 1QVRA 4IBCA 4NOOB 2NQ8C 2CV0A 3LCVB 5EP3A 3ZH9B 4JI3M 3KSXA 4AI6A 4E8BA 2N35A 4MCBA 2MJ5B 2R4EA 3BXWA 4FW9A 1TGUA 1L1TA 4GC5A 1UM8A 3K1JA 4M9XA 2DZLA 4PD2A 2C99A 1NVMA 4IBIA 4BB9A 5EQTA 3RGSA 5ITRA 4CNDA 4QHTA 4RG1A 4P17A 4LJ8A 1N77A 3FTEA 5LMNM 1L2BA 4JYAM 2DZOB 5KQDA 1SG9A 2QQ8A 1N78A 4Y28F 3NWLA 2G3QA 2XLJA 4NXMM 3TQSA 4MCCA 3ZQJA 1IXZA 1E9SA 1TF0B 1VEKA 2QMMA 4IBJA 4DBGB 2F5NA 2UU9M 4CISA 1D0LA 3U5ZB 4AKHA 4RF1A 1IN6A 4YQ5A 2JY5A 1V92A 2DAKA 1N75A 4DR4M 1DGHA 1IY0A 4JN6A 4I81A 1ZAEA 1IN5A 2XSZA 4F2LA 5ITQA 4DR1M 4YQNA 4YQ8A 2KRKA 2RGHA 3FTCA 4YQBA 2LXEA 2FS1A 3TL4X 2APLA 2RGOA 1TR8A 1ZV1A 1GO5A 1Z5CA 4CHTB 3PNYA 1QDTA 4IJEA 3DA1A 1J09A 2JA2A 4X66M 1IPAA 2EA0A 4B3RM 3CGWA 3I51A 4MGZE 1XWIA 2QWVA 1TH2A 1VHKA 1OIZA 1QAMA 2CRUA 4OVZA 3AKZA 4LZZA 1Q3CA 1YSYA 4LJ9A 3GYQA 1TH4A 1V2XA 2DAEA 3KXEC 4DUZM 1EIJA 1Z85A 3KFUG 2CX8A 1UAKA 4D81A 1V34A 4PCZA 1EE8A 2RRUA 2EGVA 3VDUA 4CGYB 3U6OA 2K9DA 1SXJD 3Q8XA 4LGMA 2OOAA 2JXNA 4JI1M 5DYIA 1HNXM 1E94E 4LJ7A 4YQSA 2KW0A 2V6ZM 4YQIA 5JI3E 5C1BA 2J7NA 4DV6M 2Y20A 1R2YA 1TH3A 1UAMA 2V1UA 1VH0A 1R4GA 4MGKE 1YLAA 3GP1A 3U61A 1X37A 2Y0TA 1QUTA 3D8BA 1XMOM 1NXZA 1EFUB 1GKIA 4OX9M 2WSFF 3FTFA 3L8UA 1PGYA 2FH0A 3C9PA 1L1ZA 5BR8M 3HHZA 3VK8A 4M9ZA 3EIEA 4BLCA 1J5EM 3U6DA 4LF9M 3SARA 2UUAM 1IFYA 1I94M 1UAJA 2L4EA 4GMQA 3KW6A 1LTMA 1ORYB 2FNAA 3MJ5A 1F4IA 4AKGA 3KP1E 2R44A 2KDLA 4KT0F 4AG6A 2F5SA 2DAGA 3KY7A 3J81S 1DV0A 2O01F 1IXRC 4YQPA 4NRVA 3BBEA 4I5SA 1XXHE 2VQEM 2R46A 3T1YM 3OTOM 4K0KM 1P9PA 2QP9X 1HQYE 3FRIA 3HU3A 1D0KA 3IEFA 2LHGA 3AV0A 4J3CA 1G59A 1JR3D 4G4OA 1SXJC 4JI5M 4B3MM 3LVVA 2C5RA 5FSWA 4GEWA 2Y0QA 3U6SA 1GL7A 3J7AS 4KODA 2EO2A 2CUZA 2H1RA 4FCWA 2XH9A 3DOAA 1S3SA 1R5LA 1L2CA 1X7PA 4PZKA 3L25A 4YQ4A 1PRBA 2EGWA 3OIJA 4PT5A 1QANA 3CTWB 3VK7A 4QHSA 5DNYA 2R45A 2R4JA 4LCBA 3FUXA 4JI4M 1UALA 3VLFB 2DHRA 2F5PA 1Z6TA 4W5WA 1QQWA 3KW2A 5GMBA 1BVSA 2QSFX 1MX0A 3V76A 5LMUM 3A45A 2MR9A 1LV7A 2VF8A 4G4RA 3GLHA 3E46A 3QYBA 5FTKA 2QBYA 2HA8A 2AHMA 1GABA 4L16A 3TWLA 3WHKA 3F92A 4OU7A 3GRUA 1Y8GA 3BBZA 3HJQA 4JI0M 1MJGM 4R7GA 3FUTA 1IXSB 3TPZA 4XGIA 4YVHA 1W5SA 2JWSA 2JY7A 3H4JA 1IM2A 2WSCF 4YQKA 4KGNA 3L2AA 2MROB 4R3DA 1HNZM 5IREB 1NHGC 4CJ6A 1K3WA 4X62M 1KSFX 2ZAMA 4LF5M 1DGHB 4RKUF 2KXEA 3J7BA 1R2ZA 2LVAA 1PJIA 2V3KA 3C3EA 3UK6A 1IBKM 1NSFA 4S12A 3L29A 1XNQM 2E5LM 3LVWA 2C9CA 2X49A 2O25A 4LG2A 3HJSA 3GLHE 4XK8F 3T38A 1GL6A 3B9PA 2L7IA 4AG5A 3GLGB 3W67A 4JXJA 1C7YA 4JWFA 5KPZA 4AZFA 2XZUA 4FVMA 3C58A 2CHQA 5ITTA 3VKHA 3L27A 1T6OA 2UXCM 3HJ8A 2DZNB 1HT1E 4OVZB 4F1IA 3B89A 2G5GX 4MM3B 5CO4A 4DV7M 1K3XA 3GRVA 2JNHA 4LF6M 5E6JA 1T43A 1V33A 3CF0A 5EXTA 3LMMA 5EP1A 7CATA 1IN4A 2J5YA 4A3VB 2EKKA 1OIPA 4AQYM 4LJAA 4DV4M 4KO8A 4LGYA 3K9PA 4ZPXA 2RKOA 3FD9A 2KNZA 3CF2A 4YQTA 4IIWA 1WGNA 4PDGA 4L4UA 4JI6M 4CNEA 2CP8A 2QPAA 3NBXX 3HHYA 1TO0A 1OAOC 5ITXA 1AUAA 3BBHA 4GKKM 2F4VM 3TE6A 4NXNM 3A46A 2KZUA 3AFHA 4DV1M 4IJFA 3K92A 1NV8A 2XZFA 1XXHB 3B7QA 2W82A 4TUWA 1VEJA 2OOBA 4IBDA 4JWHA 3U61B 1NNJA 5FTNA 1VG5A 2XEPA 2JP7A 1NNUC 3M0EA 4D82A 1WR1B 3U6PA 4H3ZA 2CE7A 4QOSA 1IBLM 2I7PA 3IECA 1R7RA 1W5TA 2P5TA 3U6MA 5D9FA 2BWEA 2LBCA 3HHWA 4GH9A 5IWAM 1XB2B 1K3RA 1DGGA 2M60A 3THGA 8CATA 3KP0E 5A2QS 2UUBM 4GIPA 5IT9S 2D7GA 3W0FA 3SAUA 3N4KA 4KHPM 2ZANA 2UUCM 2YNMD 3SHFA 2LVOC 4CIZA 1QDRA 5EXPA 4WP2A 1VDLA 3GPXA 1QAOA 2JY8A 2XFTA 4DV3M 2LNHC 3DFZA 5ITXE 2DXIA 1PJQA 5H37D 1MN3A 3LQRA 4M0WA 3T1HM 4YQGA 3BOSA 3IHPA 5EXXA 3GRYA 2Q2EB 3I4VA 4GKJM 2Y21A 2R6FA 4YHHM 1WGLA 2KHHA 4LRSA 1Q02A 2C9OA 5FTMA 3AJIB 3JR5A 4JI2M 4NRWA 4LJ6A 1OQYA 2DWMA 3U60B 5IZ7D 4X65M 4DR7M 3J80S 2CEAA 4PDIA 1DO0A 3CF6E 1HT2E 1G3IA
chains in the Genus database with same CATH topology
1I4WA 3UJNA 4GITA 1OJLA 1GZ0A 2DWZB 3KNUA 4B7FA 1JQJC 2ZAOA 1QAQA 1DO2A 2V3JA 4MGYE 4JI8M 1HR0M 1N34M 2X8AA 4KLNA 3SC3A 1Z59A 1FJGM 1IN8A 3AOEA 1SXJA 4LZJA 5KO3A 3AOEC 1NY5A 2C96A 4YQJA 3GLHB 3VDPA 3D8LA 2DVWB 2HKJA 4YY3M 4FWGA 4DR5M 3L26A 4YQ9A 1IY1A 4MH0E 1NJFA 2O3AA 2FE8A 5ITYA 4YQDA 3ILKA 1VDDA 3SAVA 2XF3A 5GMCA 4H3YA 1TDHA 2L7HA 3FYDA 4YPYA 1TDZA 5GKNA 2L09A 2O5RA 3SYLA 4EIWA 3MHVC 4L15A 2OQ4A 4YQQA 1J85A 4X3LA 3FUVA 3UMMA 3KOYE 2KEBA 1SXJE 2F5OA 3SBJA 4P16A 5FTJA 4B3TM 3IG8A 4REZA 1YE9A 3TWMA 4LFCM 1IN7A 3KDSE 1NJGA 2QCUA 4CNFA 1J7KA 1HQCA 2CHVA 1Q3BA 4OW0A 3GQ5A 4XBOA 2CV2A 3O7BA 4QOZC 1XHBA 4YPXA 2ERCA 3HU1A 3EIHA 3WHLA 4YVKA 4X3MA 1JR3A 4YQ7A 4IBKA 3ONPA 2D7HA 2M5ZA 4CNGA 3U6CA 5KPRA 3SMSA 1NS5A 3GPYA 5EXSA 3AXZA 2XSZD 1G3IA 1PM5A 3GO8A 4LRTA 2FFJA 4MB7A 4RF0A 1OFHA 2J7OA 3PNVA 3GPUA 2Z0YA 1Q39A 2OPFA 4QNRA 4II7A 3GRRA 3AL0C 5ITUA 4I4LA 3RE8A 4JWJA 4YQCA 4YQAA 1G4AE 3U6LA 4DR6M 4LJ4A 3GQ4A 4YQ4A 3K2LA 1V6ZA 3T15A 4YPZA 3A42A 3M6AA 4LF7M 3FYCA 2DWLA 1YUBA 2ZBKB 2YFQA 3GLFA 1N32M 4JALA 4MGHA 4G6ZA 2YQZA 3SMPA 2CV1A 4LFBM 3OIIA 2C98A 2Z7JA 5JI2E 3GLIA 4NSOB 1N36M 3SATA 2UXBM 4IG6A 2YR0A 4QNMA 3DZDA 3BBDA 3QWLA 3KSJA 2BJWA 3K8ZA 4FWHA 2R62A 2XFSA 3M7GA 1L2DA 3J27B 4L78A 4B7HA 2I6DA 4GRIA 5EP2A 3I4YA 1K82A 4JV5M 3J2PB 4LJ5A 5BPVA 4YVIA 3SFZA 4B08A 3KS4A 3U6QA 1XNRM 4YPWA 5EJCA 2HL7A 3GQ3A 4FD2A 3VKGA 2Z4SA 4NSRA 3RFWA 3A98B 2D7EA 4IBEA 2FOIC 1IBMM 3NK6A 3NK7A 3KOXE 4MGIE 1G41A 3SASA 5F3WA 3GPPA 3GLGA 3N4JA 1QYRA 4HL4A 3U5ZA 2A5YB 1IQPA 4YQ6A 4YQ1A 2LH0A 2LWXA 1KFVA 1NY6A 4D80A 2Z4RA 4L69A 3KTYA 3ZCBB 4JWGA 2YY8A 4X64M 1DGFA 4DUYM 3JR4A 2BNKA 2G8LA 1SXJB 5DYGA 3HKPA 4YQLA 2X4AA 4MCDA 1ZJRA 3AI9X 1R6BX 3HHXA 4DV0M 4DV2M 4G4NA 3PFIA 5KPTA 2L6OA 3E9SA 4B3SM 2KZSA 3R8FA 3KOZE 4LY6A 2BJVA 1XXHA 4LF4M 5FTLA 4YQ3A 2KRUA 4DV5M 4WURA 3HGIA 5E26A 3SAWA 2VQFM 3SYKA 3W0LB 4YQ2A 2CFOA 4G4QA 2R65A 5C18A 4DR3M 4ITQA 4L8RC 1DGBA 4M0DA 4B7GA 3AOGA 4RNAA 2ZM6M 4AW4A 1OY5A 1OFIA 1NHWC 2CHGA 5EP4A 1L8QA 4FCTA 1G8PA 4I8OA 3U6EA 1XMQM 2QZ4A 4Z8XA 3L28A 2QBYB 1HNWM 4DR2M 1WXQA 4FWDA 4YQ0A 4YVGA 1H6UA 2K47A 3FUWA 2V1CA 3HWSA 3IG5A 3RGPA 3UGJA 3QAUA 2HHHM 3R9XB 1GLNA 3OINA 3QUVA 3DCMX 2EUCA 1D2NA 5FLXS 4GC9A 3HU2A 4FMWA 4YQOA 4KDZA 1KYIA 1Z5BA 3U60A 4BBAA 4LFAM 1Z5AA 3FUUA 1O6DA 1E9RA 3JAMS 1N33M 3KVWA 3KOWE 2DWNA 3KS8A 2Z3XA 3LQQA 3MK6A 1MU5A 3TWKA 1VH0A 1FNNA 3SHGB 4FCVA 4LF8M 1VHYA 4YQRA 1T3TA 4GHAA 1ZQ9A 3FKEA 4AKIA 3E5YA 3E4RA 3H4MA 4IBBA 1GVNA 4Z6YA 4IBGA 3IC6A 4WW0A 2VIIA 1QZMA 3UZUA 1E32A 3VFDA 1IY2A 4JAKA 2XGNA 3AIAA 2F5QA 2QENA 5GM8A 1C1KA 1X7OA 5FAIA 3NBIA 3PVSA 1MXIA 4HLQA 4JI7M 3PXGA 4NL4H 3GLFB 2KA6B 4IBFA 2R18A 3ZC7B 5KQ8A 2I7NA 3FTDA 1XC8A 1PJJA 4GHLA 2UXDM 4M9SA 4FAKA 3GLIB 4YVJA 2HCBA 1QVRA 4IBCA 4NOOB 2NQ8C 2CV0A 5EP3A 3ZH9B 4JI3M 3KSXA 4AI6A 4E8BA 4MCBA 2R4EA 4FW9A 1TGUA 1L1TA 4GC5A 1UM8A 3K1JA 4M9XA 4PD2A 2C99A 1NVMA 4IBIA 4BB9A 5EQTA 3RGSA 5ITRA 4CNDA 4QHTA 4RG1A 4LJ8A 1N77A 3FTEA 5LMNM 1L2BA 4JYAM 2DZOB 5KQDA 1N78A 3NWLA 2XLJA 4NXMM 3TQSA 4MCCA 1IXZA 1E9SA 2QMMA 4IBJA 2F5NA 2UU9M 4CISA 3U5ZB 4AKHA 4RF1A 1IN6A 4YQ5A 1N75A 4DR4M 1DGHA 1IY0A 4JN6A 4I81A 1ZAEA 1IN5A 2XSZA 4DR1M 5ITQA 4YQNA 4YQ8A 2KRKA 2RGHA 3FTCA 4YQBA 2LXEA 3TL4X 2RGOA 1Z5CA 4CHTB 3PNYA 4IJEA 3DA1A 1J09A 2JA2A 4X66M 1IPAA 2EA0A 4B3RM 4MGZE 3I51A 1XWIA 2QWVA 1TH2A 1VHKA 1QAMA 4OVZA 3AKZA 4LZZA 1Q3CA 1YSYA 4LJ9A 3GYQA 1TH4A 1V2XA 3KXEC 4DUZM 1Z85A 3KFUG 2CX8A 1UAKA 4D81A 4PCZA 1EE8A 2EGVA 3VDUA 4CGYB 3U6OA 1SXJD 3Q8XA 4LGMA 4JI1M 5DYIA 1HNXM 1E94E 4LJ7A 4YQSA 2KW0A 2V6ZM 4YQIA 5JI3E 5C1BA 2J7NA 4DV6M 2Y20A 1R2YA 1TH3A 1UAMA 2V1UA 4MGKE 3U61A 3GP1A 1X37A 2Y0TA 3D8BA 1XMOM 1NXZA 1GKIA 4OX9M 3FTFA 3L8UA 1L1ZA 5BR8M 3HHZA 3VK8A 4M9ZA 3EIEA 4BLCA 1J5EM 3U6DA 4LF9M 3SARA 2UUAM 1I94M 1UAJA 4GMQA 3KW6A 2FNAA 1ORYB 3MJ5A 4AKGA 3KP1E 4AG6A 2F5SA 3KY7A 3J81S 1IXRC 4YQPA 4NRVA 3BBEA 4I5SA 2VQEM 2R46A 3T1YM 3OTOM 4K0KM 1P9PA 2QP9X 1HQYE 3HU3A 3IEFA 3AV0A 4J3CA 1G59A 1JR3D 4G4OA 1SXJC 4JI5M 4B3MM 3LVVA 2C5RA 5FSWA 2Y0QA 3U6SA 1GL7A 3J7AS 4KODA 2EO2A 2CUZA 2H1RA 4FCWA 2XH9A 3DOAA 1S3SA 1L2CA 4PZKA 1X7PA 3L25A 2EGWA 3OIJA 4PT5A 1QANA 3CTWB 3VK7A 4QHSA 5DNYA 2R45A 2R4JA 4LCBA 3FUXA 4JI4M 1UALA 3VLFB 2DHRA 2F5PA 1Z6TA 4W5WA 1QQWA 3KW2A 5GMBA 1MX0A 5LMUM 3A45A 1LV7A 4G4RA 3GLHA 5FTKA 2QBYA 2HA8A 2AHMA 4L16A 3TWLA 3WHKA 4OU7A 3GRUA 3HJQA 4JI0M 4R7GA 3FUTA 1IXSB 3TPZA 4XGIA 4YVHA 1W5SA 4YQKA 1IM2A 4KGNA 3L2AA 4R3DA 1HNZM 5IREB 1NHGC 1K3WA 4X62M 1KSFX 2ZAMA 4LF5M 1DGHB 2KXEA 3J7BA 1R2ZA 1PJIA 2V3KA 3UK6A 1IBKM 1NSFA 4S12A 3L29A 1XNQM 2E5LM 3LVWA 2C9CA 4LG2A 3HJSA 3T38A 1GL6A 3B9PA 2L7IA 4AG5A 3GLGB 4JWFA 4JXJA 5KPZA 4AZFA 2XZUA 4FVMA 3C58A 2CHQA 5ITTA 3VKHA 3L27A 2UXCM 3HJ8A 2DZNB 1HT1E 4OVZB 2G5GX 4MM3B 5CO4A 4DV7M 1K3XA 3GRVA 4LF6M 5E6JA 3CF0A 5EXTA 3LMMA 5EP1A 7CATA 1IN4A 4A3VB 4AQYM 4LJAA 4DV4M 4KO8A 4LGYA 4ZPXA 2RKOA 3FD9A 4YQTA 3CF2A 4IIWA 4PDGA 4L4UA 4JI6M 4CNEA 2QPAA 3HHYA 1TO0A 5ITXA 3BBHA 4GKKM 2F4VM 3TE6A 4NXNM 3A46A 2KZUA 3AFHA 4DV1M 4IJFA 3K92A 2XZFA 1XXHB 2W82A 4TUWA 4JWHA 4IBDA 3U61B 1NNJA 5FTNA 2XEPA 1NNUC 3M0EA 4D82A 3U6PA 4H3ZA 2CE7A 4QOSA 1IBLM 2I7PA 1R7RA 1W5TA 2P5TA 3U6MA 5D9FA 3HHWA 4GH9A 5IWAM 1K3RA 1DGGA 2M60A 3THGA 8CATA 3KP0E 5A2QS 2UUBM 4GIPA 5IT9S 2D7GA 3W0FA 3SAUA 3N4KA 4KHPM 2ZANA 2UUCM 2YNMD 3SHFA 5EXPA 3GPXA 4DV3M 1QAOA 2XFTA 2LNHC 3DFZA 5ITXE 2DXIA 5H37D 3LQRA 4M0WA 3T1HM 4YQGA 3BOSA 5EXXA 3GRYA 2Q2EB 3I4VA 4GKJM 2Y21A 4YHHM 4LRSA 3JR5A 2C9OA 5FTMA 3AJIB 4JI2M 4NRWA 4LJ6A 2DWMA 3U60B 5IZ7D 4X65M 4DR7M 3J80S 2CEAA 4PDIA 1DO0A 3CF6E 1HT2E 2X49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZK A;  4MCB A;  1X7P A;  1GZ0 A;  2EGW A;  3OIJ A;  3KNU A;  3NK6 A;  3NK7 A;  4CND A;  1UAL A;  4RG1 A;  2V3J A;  5GMB A;  3KW2 A;  3N4J A;  4YQ6 A;  4YQ1 A;  4MCC A;  2HA8 A;  2QMM A;  4L69 A;  3KTY A;  2YY8 A;  4YQ5 A;  4YQJ A;  4YVH A;  4YQL A;  4YQK A;  4MCD A;  1ZJR A;  3AI9 X;  4KGN A;  4YQN A;  4YQ8 A;  4YQ9 A;  2O3A A;  4YQB A;  4YQD A;  3ILK A;  5GMC A;  2V3K A;  4H3Y A;  4YPY A;  4YQ3 A;  1IPA A;  4YQQ A;  1J85 A;  4X3L A;  4YQ2 A;  2QWV A;  1VHK A;  3GYQ A;  1OY5 A;  4CNF A;  1V2X A;  1Z85 A;  2CX8 A;  1UAK A;  4YQ0 A;  2EGV A;  4YVG A;  4XBO A;  3O7B A;  5CO4 A;  4YPX A;  4YVK A;  4X3M A;  4YQ7 A;  3OIN A;  3ONP A;  4CNG A;  3QUV A;  4YQS A;  3DCM X;  1NS5 A;  4YQT A;  3AXZ A;  4YQI A;  1UAM A;  4YQO A;  4KDZ A;  4CNE A;  1TO0 A;  3BBH A;  1O6D A;  1NXZ A;  2Z0Y A;  3L8U A;  1VH0 A;  4IG6 A;  4YQR A;  1VHY A;  4H3Z A;  4YQC A;  4YQA A;  3E5Y A;  1UAJ A;  5D9F A;  4YQ4 A;  3IC6 A;  1V6Z A;  1K3R A;  4YPZ A;  3N4K A;  3KY7 A;  4JAK A;  4JAL A;  4YQP A;  3AIA A;  3BBE A;  5GM8 A;  1X7O A;  5FAI A;  3OII A;  1MXI A;  1P9P A;  4YQG A;  3IEF A;  3BBD A;  4J3C A;  4FAK A;  4YVJ A;  2I6D A;  4YVI A;  4YPW A;  4E8B A; 
#chains in the Genus database with same CATH topology
 1I4W A;  3UJN A;  4GIT A;  1OJL A;  1GZ0 A;  2DWZ B;  3KNU A;  4B7F A;  1JQJ C;  1OKS A;  2JUJ A;  2DAI A;  2ZAO A;  1QAQ A;  1DO2 A;  2V3J A;  4MGY E;  4JI8 M;  1HR0 M;  1N34 M;  2X8A A;  2VDB B;  4KLN A;  3SC3 A;  1Z59 A;  1FJG M;  4G3O A;  1IN8 A;  1NV9 A;  3AOE A;  1GJS A;  1SXJ A;  4LZJ A;  5KO3 A;  3AOE C;  2DHY A;  1NY5 A;  2C96 A;  1AIP C;  4YQJ A;  2LTU A;  2K0B X;  3D8L A;  3GLH B;  3VDP A;  2DVW B;  2HKJ A;  2DKL A;  2EKF A;  4YY3 M;  4FWG A;  4DR5 M;  2DAM A;  3L26 A;  4YQ9 A;  1OTR A;  1IY1 A;  4MH0 E;  1NJF A;  2O3A A;  2FE8 A;  5ITY A;  4YQD A;  3ILK A;  1VDD A;  3SAV A;  2XF3 A;  5GMC A;  4H3Y A;  1TDH A;  2L7H A;  3FYD A;  4YPY A;  1TDZ A;  5GKN A;  2L09 A;  2O5R A;  3SYL A;  4EIW A;  5L8R F;  3LW5 F;  3K9O A;  3MHV C;  4L15 A;  2OQ4 A;  4YQQ A;  1J85 A;  4X3L A;  3FUV A;  3UMM A;  1VQ1 A;  2KEB A;  1SXJ E;  2QNJ A;  3KOY E;  3E21 A;  3SBJ A;  2F5O A;  2EJS A;  4P16 A;  1CUK A;  5FTJ A;  2VF7 A;  4B3T M;  3IG8 A;  4REZ A;  1YE9 A;  3TWM A;  4LFC M;  1IN7 A;  2QCU A;  1NJG A;  3KDS E;  4CNF A;  1J7K A;  1HQC A;  2CHV A;  1Q3B A;  1ZMV A;  2HAK A;  4OW0 A;  3GQ5 A;  2HWJ A;  4XBO A;  3B7Z A;  2CV2 A;  3O7B A;  2L4F A;  1XHB A;  2ZTC A;  2ERC A;  4QOZ C;  4YPX A;  3HU1 A;  3EIH A;  3W68 A;  3WHL A;  2GQF A;  2CWB A;  1UFZ A;  1P3Q Q;  4L6V 6;  4X3M A;  4YVK A;  1JR3 A;  4YQ7 A;  4IBK A;  3ONP A;  2D7H A;  2M5Z A;  4CNG A;  3U6C A;  5KPR A;  3SMS A;  1NS5 A;  3GPY A;  5EXS A;  3AXZ A;  3HZJ A;  2QHO B;  2XSZ D;  1WIV A;  1PM5 A;  3GO8 A;  4LRT A;  2ZTD A;  2FFJ A;  4MB7 A;  4RF0 A;  4ANR A;  1OFH A;  2LVP C;  2J7O A;  3I04 M;  3PNV A;  3GPU A;  2Z0Y A;  1Q39 A;  2OPF A;  4QNR A;  4II7 A;  3GRR A;  3AL0 C;  5ITU A;  4I4L A;  3RE8 A;  4JWJ A;  3HX3 A;  1RU3 A;  4YQC A;  1G4A E;  1WJ7 A;  3U6L A;  4YQA A;  1GJT A;  4DR6 M;  4LJ4 A;  3GQ4 A;  2MH8 A;  3K2L A;  2H5X A;  1V6Z A;  3T15 A;  3B74 A;  3A42 A;  1ZMU A;  1JR3 E;  4YPZ A;  3M6A A;  4LF7 M;  2LVQ D;  3FYC A;  1QUS A;  1YUB A;  2ZBK B;  2YFQ A;  3GLF A;  2DWL A;  1N32 M;  4JAL A;  4MGH A;  4G6Z A;  2YQZ A;  3SMP A;  2CV1 A;  4LFB M;  3OII A;  2C98 A;  2Z7J A;  2DI0 A;  5JI2 E;  4NSO B;  3GLI A;  1IXS A;  1N36 M;  3SAT A;  2YR0 A;  2GNO A;  2L2D A;  4QNM A;  4IG6 A;  3DZD A;  3BBD A;  2DNA A;  3QWL A;  3KSJ A;  2BJW A;  3K8Z A;  4FWH A;  2R62 A;  2XFS A;  3M7G A;  1L2D A;  3J27 B;  4L78 A;  4B7H A;  2I6D A;  4GRI A;  5EP2 A;  3I4Y A;  1K82 A;  4JV5 M;  3J2P B;  4LJ5 A;  5BPV A;  4YVI A;  3SFZ A;  2JZ0 A;  3KS4 A;  4B08 A;  3U6Q A;  1XNR M;  4YPW A;  5EJC A;  2HL7 A;  3GQ3 A;  4FD2 A;  1TTE A;  3VKG A;  5DFL A;  2Z4S A;  1PJT A;  4NSR A;  3RFW A;  2OO9 A;  3A98 B;  3GLF E;  2D7E A;  4IBE A;  2FOI C;  1IBM M;  3NK6 A;  3NK7 A;  3KOX E;  4MGI E;  1G41 A;  3SAS A;  2KNV A;  5F3W A;  3GPP A;  2B3T A;  3GLG A;  2LHC A;  4Q7J A;  3GLI E;  1QYR A;  4HL4 A;  3N4J A;  3U5Z A;  2A5Y B;  1IQP A;  2K6B A;  4YQ6 A;  4YQ1 A;  2LH0 A;  2DEN A;  2LWX A;  3FE3 A;  3HY5 A;  1NY6 A;  4D80 A;  2Z4R A;  1KFV A;  4L69 A;  3KTY A;  3ZCB B;  4JWG A;  2YY8 A;  3FRH A;  4X64 M;  1DGF A;  4DUY M;  2WZJ A;  3JR4 A;  1HJP A;  2BNK A;  2G8L A;  1SXJ B;  5DYG A;  3HKP A;  4YQL A;  3C3D A;  2X4A A;  4MCD A;  1ZJR A;  3AI9 X;  1R6B X;  3HHX A;  4DV0 M;  4DV2 M;  4G4N A;  3PFI A;  5KPT A;  2L6O A;  3E9S A;  4B3S M;  2KZS A;  3R8F A;  3KOZ E;  2UXB M;  4LY6 A;  1PJS A;  3GLG E;  2BJV A;  1XXH A;  3I01 M;  3B7N A;  4LF4 M;  5FTL A;  4YQ3 A;  2KRU A;  4DV5 M;  4WUR A;  3HGI A;  5E26 A;  3SAW A;  2VQF M;  3SYK A;  3W0L B;  4YQ2 A;  1NO1 A;  2CFO A;  4G4Q A;  2R65 A;  5C18 A;  4NC6 A;  4R71 A;  4DR3 M;  4ITQ A;  4L8R C;  1DGB A;  4M0D A;  4B7G A;  3AOG A;  4HEO A;  4RNA A;  2ZM6 M;  4AW4 A;  1OY5 A;  1OFI A;  1NHW C;  2CHG A;  5EP4 A;  1L8Q A;  4FCT A;  1G8P A;  4I8O A;  3U6E A;  1XMQ M;  2QZ4 A;  2Z8Y M;  3L28 A;  4Z8X A;  2QBY B;  4DR2 M;  1WHC A;  1WXQ A;  4FWD A;  1HNW M;  2JY6 B;  4YVG A;  4YQ0 A;  1H6U A;  2K47 A;  1ZMW A;  3FUW A;  2V1C A;  3HWS A;  3IG5 A;  3RGP A;  3UGJ A;  2BWB A;  3QAU A;  2HHH M;  3R9X B;  1GLN A;  3OIN A;  1A5T A;  3QUV A;  3DCM X;  2EUC A;  1D2N A;  5FLX S;  4GC9 A;  3HU2 A;  4FMW A;  4YQO A;  4KDZ A;  4UN2 B;  1KYI A;  1Z5B A;  2WSE F;  3U60 A;  1OAI A;  4LFA M;  4BBA A;  1Z5A A;  3FUU A;  1O6D A;  1E9R A;  3JAM S;  3LCU A;  1N33 M;  3KVW A;  3KOW E;  2DWN A;  3KS8 A;  3MMP A;  1QZE A;  2Z3X A;  3LQQ A;  3MK6 A;  1MU5 A;  3TWK A;  1JB0 F;  1FNN A;  3SHG B;  4FCV A;  4LF8 M;  1VHY A;  4YQR A;  1T3T A;  1G71 A;  1ZQ9 A;  3FKE A;  4GHA A;  4AKI A;  3E4R A;  3H4M A;  1D0M A;  4IBB A;  3E5Y A;  1GVN A;  4Z6Y A;  4IBG A;  3IC6 A;  4WW0 A;  2VII A;  2R0I A;  1QZM A;  3UZU A;  1E32 A;  3Q8G A;  3VFD A;  1IY2 A;  4JAK A;  2XGN A;  3AIA A;  3QYE A;  2F5Q A;  2QEN A;  5GM8 A;  1C1K A;  1X7O A;  5FAI A;  3NBI A;  3PVS A;  2MGW A;  1MXI A;  4HLQ A;  4JI7 M;  1VEG A;  3PXG A;  3T6P A;  4NL4 H;  3GLF B;  2KA6 B;  4IBF A;  2R18 A;  2JZ1 A;  3ZC7 B;  5KQ8 A;  2LVN C;  2I7N A;  3FTD A;  1XC8 A;  1PJJ A;  4GHL A;  2UXD M;  2KNA A;  4M9S A;  4FAK A;  3GLI B;  4YVJ A;  2HCB A;  1QVR A;  4IBC A;  4NOO B;  2NQ8 C;  2CV0 A;  3LCV B;  5EP3 A;  3ZH9 B;  4JI3 M;  3KSX A;  4AI6 A;  4E8B A;  2N35 A;  4MCB A;  2MJ5 B;  2R4E A;  3BXW A;  4FW9 A;  1TGU A;  1L1T A;  4GC5 A;  1UM8 A;  3K1J A;  4M9X A;  2DZL A;  4PD2 A;  2C99 A;  1NVM A;  4IBI A;  4BB9 A;  5EQT A;  3RGS A;  5ITR A;  4CND A;  4QHT A;  4RG1 A;  4P17 A;  4LJ8 A;  1N77 A;  3FTE A;  5LMN M;  1L2B A;  4JYA M;  2DZO B;  5KQD A;  1SG9 A;  2QQ8 A;  1N78 A;  4Y28 F;  3NWL A;  2G3Q A;  2XLJ A;  4NXM M;  3TQS A;  4MCC A;  3ZQJ A;  1IXZ A;  1E9S A;  1TF0 B;  1VEK A;  2QMM A;  4IBJ A;  4DBG B;  2F5N A;  2UU9 M;  4CIS A;  1D0L A;  3U5Z B;  4AKH A;  4RF1 A;  1IN6 A;  4YQ5 A;  2JY5 A;  1V92 A;  2DAK A;  1N75 A;  4DR4 M;  1DGH A;  1IY0 A;  4JN6 A;  4I81 A;  1ZAE A;  1IN5 A;  2XSZ A;  4F2L A;  5ITQ A;  4DR1 M;  4YQN A;  4YQ8 A;  2KRK A;  2RGH A;  3FTC A;  4YQB A;  2LXE A;  2FS1 A;  3TL4 X;  2APL A;  2RGO A;  1TR8 A;  1ZV1 A;  1GO5 A;  1Z5C A;  4CHT B;  3PNY A;  1QDT A;  4IJE A;  3DA1 A;  1J09 A;  2JA2 A;  4X66 M;  1IPA A;  2EA0 A;  4B3R M;  3CGW A;  3I51 A;  4MGZ E;  1XWI A;  2QWV A;  1TH2 A;  1VHK A;  1OIZ A;  1QAM A;  2CRU A;  4OVZ A;  3AKZ A;  4LZZ A;  1Q3C A;  1YSY A;  4LJ9 A;  3GYQ A;  1TH4 A;  1V2X A;  2DAE A;  3KXE C;  4DUZ M;  1EIJ A;  1Z85 A;  3KFU G;  2CX8 A;  1UAK A;  4D81 A;  1V34 A;  4PCZ A;  1EE8 A;  2RRU A;  2EGV A;  3VDU A;  4CGY B;  3U6O A;  2K9D A;  1SXJ D;  3Q8X A;  4LGM A;  2OOA A;  2JXN A;  4JI1 M;  5DYI A;  1HNX M;  1E94 E;  4LJ7 A;  4YQS A;  2KW0 A;  2V6Z M;  4YQI A;  5JI3 E;  5C1B A;  2J7N A;  4DV6 M;  2Y20 A;  1R2Y A;  1TH3 A;  1UAM A;  2V1U A;  1VH0 A;  1R4G A;  4MGK E;  1YLA A;  3GP1 A;  3U61 A;  1X37 A;  2Y0T A;  1QUT A;  3D8B A;  1XMO M;  1NXZ A;  1EFU B;  1GKI A;  4OX9 M;  2WSF F;  3FTF A;  3L8U A;  1PGY A;  2FH0 A;  3C9P A;  1L1Z A;  5BR8 M;  3HHZ A;  3VK8 A;  4M9Z A;  3EIE A;  4BLC A;  1J5E M;  3U6D A;  4LF9 M;  3SAR A;  2UUA M;  1IFY A;  1I94 M;  1UAJ A;  2L4E A;  4GMQ A;  3KW6 A;  1LTM A;  1ORY B;  2FNA A;  3MJ5 A;  1F4I A;  4AKG A;  3KP1 E;  2R44 A;  2KDL A;  4KT0 F;  4AG6 A;  2F5S A;  2DAG A;  3KY7 A;  3J81 S;  1DV0 A;  2O01 F;  1IXR C;  4YQP A;  4NRV A;  3BBE A;  4I5S A;  1XXH E;  2VQE M;  2R46 A;  3T1Y M;  3OTO M;  4K0K M;  1P9P A;  2QP9 X;  1HQY E;  3FRI A;  3HU3 A;  1D0K A;  3IEF A;  2LHG A;  3AV0 A;  4J3C A;  1G59 A;  1JR3 D;  4G4O A;  1SXJ C;  4JI5 M;  4B3M M;  3LVV A;  2C5R A;  5FSW A;  4GEW A;  2Y0Q A;  3U6S A;  1GL7 A;  3J7A S;  4KOD A;  2EO2 A;  2CUZ A;  2H1R A;  4FCW A;  2XH9 A;  3DOA A;  1S3S A;  1R5L A;  1L2C A;  1X7P A;  4PZK A;  3L25 A;  4YQ4 A;  1PRB A;  2EGW A;  3OIJ A;  4PT5 A;  1QAN A;  3CTW B;  3VK7 A;  4QHS A;  5DNY A;  2R45 A;  2R4J A;  4LCB A;  3FUX A;  4JI4 M;  1UAL A;  3VLF B;  2DHR A;  2F5P A;  1Z6T A;  4W5W A;  1QQW A;  3KW2 A;  5GMB A;  1BVS A;  2QSF X;  1MX0 A;  3V76 A;  5LMU M;  3A45 A;  2MR9 A;  1LV7 A;  2VF8 A;  4G4R A;  3GLH A;  3E46 A;  3QYB A;  5FTK A;  2QBY A;  2HA8 A;  2AHM A;  1GAB A;  4L16 A;  3TWL A;  3WHK A;  3F92 A;  4OU7 A;  3GRU A;  1Y8G A;  3BBZ A;  3HJQ A;  4JI0 M;  1MJG M;  4R7G A;  3FUT A;  1IXS B;  3TPZ A;  4XGI A;  4YVH A;  1W5S A;  2JWS A;  2JY7 A;  3H4J A;  1IM2 A;  2WSC F;  4YQK A;  4KGN A;  3L2A A;  2MRO B;  4R3D A;  1HNZ M;  5IRE B;  1NHG C;  4CJ6 A;  1K3W A;  4X62 M;  1KSF X;  2ZAM A;  4LF5 M;  1DGH B;  4RKU F;  2KXE A;  3J7B A;  1R2Z A;  2LVA A;  1PJI A;  2V3K A;  3C3E A;  3UK6 A;  1IBK M;  1NSF A;  4S12 A;  3L29 A;  1XNQ M;  2E5L M;  3LVW A;  2C9C A;  2X49 A;  2O25 A;  4LG2 A;  3HJS A;  3GLH E;  4XK8 F;  3T38 A;  1GL6 A;  3B9P A;  2L7I A;  4AG5 A;  3GLG B;  3W67 A;  4JXJ A;  1C7Y A;  4JWF A;  5KPZ A;  4AZF A;  2XZU A;  4FVM A;  3C58 A;  2CHQ A;  5ITT A;  3VKH A;  3L27 A;  1T6O A;  2UXC M;  3HJ8 A;  2DZN B;  1HT1 E;  4OVZ B;  4F1I A;  3B89 A;  2G5G X;  4MM3 B;  5CO4 A;  4DV7 M;  1K3X A;  3GRV A;  2JNH A;  4LF6 M;  5E6J A;  1T43 A;  1V33 A;  3CF0 A;  5EXT A;  3LMM A;  5EP1 A;  7CAT A;  1IN4 A;  2J5Y A;  4A3V B;  2EKK A;  1OIP A;  4AQY M;  4LJA A;  4DV4 M;  4KO8 A;  4LGY A;  3K9P A;  4ZPX A;  2RKO A;  3FD9 A;  2KNZ A;  3CF2 A;  4YQT A;  4IIW A;  1WGN A;  4PDG A;  4L4U A;  4JI6 M;  4CNE A;  2CP8 A;  2QPA A;  3NBX X;  3HHY A;  1TO0 A;  1OAO C;  5ITX A;  1AUA A;  3BBH A;  4GKK M;  2F4V M;  3TE6 A;  4NXN M;  3A46 A;  2KZU A;  3AFH A;  4DV1 M;  4IJF A;  3K92 A;  1NV8 A;  2XZF A;  1XXH B;  3B7Q A;  2W82 A;  4TUW A;  1VEJ A;  2OOB A;  4IBD A;  4JWH A;  3U61 B;  1NNJ A;  5FTN A;  1VG5 A;  2XEP A;  2JP7 A;  1NNU C;  3M0E A;  4D82 A;  1WR1 B;  3U6P A;  4H3Z A;  2CE7 A;  4QOS A;  1IBL M;  2I7P A;  3IEC A;  1R7R A;  1W5T A;  2P5T A;  3U6M A;  5D9F A;  2BWE A;  2LBC A;  3HHW A;  4GH9 A;  5IWA M;  1XB2 B;  1K3R A;  1DGG A;  2M60 A;  3THG A;  8CAT A;  3KP0 E;  5A2Q S;  2UUB M;  4GIP A;  5IT9 S;  2D7G A;  3W0F A;  3SAU A;  3N4K A;  4KHP M;  2ZAN A;  2UUC M;  2YNM D;  3SHF A;  2LVO C;  4CIZ A;  1QDR A;  5EXP A;  4WP2 A;  1VDL A;  3GPX A;  1QAO A;  2JY8 A;  2XFT A;  4DV3 M;  2LNH C;  3DFZ A;  5ITX E;  2DXI A;  1PJQ A;  5H37 D;  1MN3 A;  3LQR A;  4M0W A;  3T1H M;  4YQG A;  3BOS A;  3IHP A;  5EXX A;  3GRY A;  2Q2E B;  3I4V A;  4GKJ M;  2Y21 A;  2R6F A;  4YHH M;  1WGL A;  2KHH A;  4LRS A;  1Q02 A;  2C9O A;  5FTM A;  3AJI B;  3JR5 A;  4JI2 M;  4NRW A;  4LJ6 A;  1OQY A;  2DWM A;  3U60 B;  5IZ7 D;  4X65 M;  4DR7 M;  3J80 S;  2CEA A;  4PDI A;  1DO0 A;  3CF6 E;  1HT2 E;  1G3I A; 
#chains in the Genus database with same CATH homology
 1I4W A;  3UJN A;  4GIT A;  1OJL A;  1GZ0 A;  2DWZ B;  3KNU A;  4B7F A;  1JQJ C;  2ZAO A;  1QAQ A;  1DO2 A;  2V3J A;  4MGY E;  4JI8 M;  1HR0 M;  1N34 M;  2X8A A;  4KLN A;  3SC3 A;  1Z59 A;  1FJG M;  1IN8 A;  3AOE A;  1SXJ A;  4LZJ A;  5KO3 A;  3AOE C;  1NY5 A;  2C96 A;  4YQJ A;  3GLH B;  3VDP A;  3D8L A;  2DVW B;  2HKJ A;  4YY3 M;  4FWG A;  4DR5 M;  3L26 A;  4YQ9 A;  1IY1 A;  4MH0 E;  1NJF A;  2O3A A;  2FE8 A;  5ITY A;  4YQD A;  3ILK A;  1VDD A;  3SAV A;  2XF3 A;  5GMC A;  4H3Y A;  1TDH A;  2L7H A;  3FYD A;  4YPY A;  1TDZ A;  5GKN A;  2L09 A;  2O5R A;  3SYL A;  4EIW A;  3MHV C;  4L15 A;  2OQ4 A;  4YQQ A;  1J85 A;  4X3L A;  3FUV A;  3UMM A;  3KOY E;  2KEB A;  1SXJ E;  2F5O A;  3SBJ A;  4P16 A;  5FTJ A;  4B3T M;  3IG8 A;  4REZ A;  1YE9 A;  3TWM A;  4LFC M;  1IN7 A;  3KDS E;  1NJG A;  2QCU A;  4CNF A;  1J7K A;  1HQC A;  2CHV A;  1Q3B A;  4OW0 A;  3GQ5 A;  4XBO A;  2CV2 A;  3O7B A;  4QOZ C;  1XHB A;  4YPX A;  2ERC A;  3HU1 A;  3EIH A;  3WHL A;  4YVK A;  4X3M A;  1JR3 A;  4YQ7 A;  4IBK A;  3ONP A;  2D7H A;  2M5Z A;  4CNG A;  3U6C A;  5KPR A;  3SMS A;  1NS5 A;  3GPY A;  5EXS A;  3AXZ A;  2XSZ D;  1G3I A;  1PM5 A;  3GO8 A;  4LRT A;  2FFJ A;  4MB7 A;  4RF0 A;  1OFH A;  2J7O A;  3PNV A;  3GPU A;  2Z0Y A;  1Q39 A;  2OPF A;  4QNR A;  4II7 A;  3GRR A;  3AL0 C;  5ITU A;  4I4L A;  3RE8 A;  4JWJ A;  4YQC A;  4YQA A;  1G4A E;  3U6L A;  4DR6 M;  4LJ4 A;  3GQ4 A;  4YQ4 A;  3K2L A;  1V6Z A;  3T15 A;  4YPZ A;  3A42 A;  3M6A A;  4LF7 M;  3FYC A;  2DWL A;  1YUB A;  2ZBK B;  2YFQ A;  3GLF A;  1N32 M;  4JAL A;  4MGH A;  4G6Z A;  2YQZ A;  3SMP A;  2CV1 A;  4LFB M;  3OII A;  2C98 A;  2Z7J A;  5JI2 E;  3GLI A;  4NSO B;  1N36 M;  3SAT A;  2UXB M;  4IG6 A;  2YR0 A;  4QNM A;  3DZD A;  3BBD A;  3QWL A;  3KSJ A;  2BJW A;  3K8Z A;  4FWH A;  2R62 A;  2XFS A;  3M7G A;  1L2D A;  3J27 B;  4L78 A;  4B7H A;  2I6D A;  4GRI A;  5EP2 A;  3I4Y A;  1K82 A;  4JV5 M;  3J2P B;  4LJ5 A;  5BPV A;  4YVI A;  3SFZ A;  4B08 A;  3KS4 A;  3U6Q A;  1XNR M;  4YPW A;  5EJC A;  2HL7 A;  3GQ3 A;  4FD2 A;  3VKG A;  2Z4S A;  4NSR A;  3RFW A;  3A98 B;  2D7E A;  4IBE A;  2FOI C;  1IBM M;  3NK6 A;  3NK7 A;  3KOX E;  4MGI E;  1G41 A;  3SAS A;  5F3W A;  3GPP A;  3GLG A;  3N4J A;  1QYR A;  4HL4 A;  3U5Z A;  2A5Y B;  1IQP A;  4YQ6 A;  4YQ1 A;  2LH0 A;  2LWX A;  1KFV A;  1NY6 A;  4D80 A;  2Z4R A;  4L69 A;  3KTY A;  3ZCB B;  4JWG A;  2YY8 A;  4X64 M;  1DGF A;  4DUY M;  3JR4 A;  2BNK A;  2G8L A;  1SXJ B;  5DYG A;  3HKP A;  4YQL A;  2X4A A;  4MCD A;  1ZJR A;  3AI9 X;  1R6B X;  3HHX A;  4DV0 M;  4DV2 M;  4G4N A;  3PFI A;  5KPT A;  2L6O A;  3E9S A;  4B3S M;  2KZS A;  3R8F A;  3KOZ E;  4LY6 A;  2BJV A;  1XXH A;  4LF4 M;  5FTL A;  4YQ3 A;  2KRU A;  4DV5 M;  4WUR A;  3HGI A;  5E26 A;  3SAW A;  2VQF M;  3SYK A;  3W0L B;  4YQ2 A;  2CFO A;  4G4Q A;  2R65 A;  5C18 A;  4DR3 M;  4ITQ A;  4L8R C;  1DGB A;  4M0D A;  4B7G A;  3AOG A;  4RNA A;  2ZM6 M;  4AW4 A;  1OY5 A;  1OFI A;  1NHW C;  2CHG A;  5EP4 A;  1L8Q A;  4FCT A;  1G8P A;  4I8O A;  3U6E A;  1XMQ M;  2QZ4 A;  4Z8X A;  3L28 A;  2QBY B;  1HNW M;  4DR2 M;  1WXQ A;  4FWD A;  4YQ0 A;  4YVG A;  1H6U A;  2K47 A;  3FUW A;  2V1C A;  3HWS A;  3IG5 A;  3RGP A;  3UGJ A;  3QAU A;  2HHH M;  3R9X B;  1GLN A;  3OIN A;  3QUV A;  3DCM X;  2EUC A;  1D2N A;  5FLX S;  4GC9 A;  3HU2 A;  4FMW A;  4YQO A;  4KDZ A;  1KYI A;  1Z5B A;  3U60 A;  4BBA A;  4LFA M;  1Z5A A;  3FUU A;  1O6D A;  1E9R A;  3JAM S;  1N33 M;  3KVW A;  3KOW E;  2DWN A;  3KS8 A;  2Z3X A;  3LQQ A;  3MK6 A;  1MU5 A;  3TWK A;  1VH0 A;  1FNN A;  3SHG B;  4FCV A;  4LF8 M;  1VHY A;  4YQR A;  1T3T A;  4GHA A;  1ZQ9 A;  3FKE A;  4AKI A;  3E5Y A;  3E4R A;  3H4M A;  4IBB A;  1GVN A;  4Z6Y A;  4IBG A;  3IC6 A;  4WW0 A;  2VII A;  1QZM A;  3UZU A;  1E32 A;  3VFD A;  1IY2 A;  4JAK A;  2XGN A;  3AIA A;  2F5Q A;  2QEN A;  5GM8 A;  1C1K A;  1X7O A;  5FAI A;  3NBI A;  3PVS A;  1MXI A;  4HLQ A;  4JI7 M;  3PXG A;  4NL4 H;  3GLF B;  2KA6 B;  4IBF A;  2R18 A;  3ZC7 B;  5KQ8 A;  2I7N A;  3FTD A;  1XC8 A;  1PJJ A;  4GHL A;  2UXD M;  4M9S A;  4FAK A;  3GLI B;  4YVJ A;  2HCB A;  1QVR A;  4IBC A;  4NOO B;  2NQ8 C;  2CV0 A;  5EP3 A;  3ZH9 B;  4JI3 M;  3KSX A;  4AI6 A;  4E8B A;  4MCB A;  2R4E A;  4FW9 A;  1TGU A;  1L1T A;  4GC5 A;  1UM8 A;  3K1J A;  4M9X A;  4PD2 A;  2C99 A;  1NVM A;  4IBI A;  4BB9 A;  5EQT A;  3RGS A;  5ITR A;  4CND A;  4QHT A;  4RG1 A;  4LJ8 A;  1N77 A;  3FTE A;  5LMN M;  1L2B A;  4JYA M;  2DZO B;  5KQD A;  1N78 A;  3NWL A;  2XLJ A;  4NXM M;  3TQS A;  4MCC A;  1IXZ A;  1E9S A;  2QMM A;  4IBJ A;  2F5N A;  2UU9 M;  4CIS A;  3U5Z B;  4AKH A;  4RF1 A;  1IN6 A;  4YQ5 A;  1N75 A;  4DR4 M;  1DGH A;  1IY0 A;  4JN6 A;  4I81 A;  1ZAE A;  1IN5 A;  2XSZ A;  4DR1 M;  5ITQ A;  4YQN A;  4YQ8 A;  2KRK A;  2RGH A;  3FTC A;  4YQB A;  2LXE A;  3TL4 X;  2RGO A;  1Z5C A;  4CHT B;  3PNY A;  4IJE A;  3DA1 A;  1J09 A;  2JA2 A;  4X66 M;  1IPA A;  2EA0 A;  4B3R M;  4MGZ E;  3I51 A;  1XWI A;  2QWV A;  1TH2 A;  1VHK A;  1QAM A;  4OVZ A;  3AKZ A;  4LZZ A;  1Q3C A;  1YSY A;  4LJ9 A;  3GYQ A;  1TH4 A;  1V2X A;  3KXE C;  4DUZ M;  1Z85 A;  3KFU G;  2CX8 A;  1UAK A;  4D81 A;  4PCZ A;  1EE8 A;  2EGV A;  3VDU A;  4CGY B;  3U6O A;  1SXJ D;  3Q8X A;  4LGM A;  4JI1 M;  5DYI A;  1HNX M;  1E94 E;  4LJ7 A;  4YQS A;  2KW0 A;  2V6Z M;  4YQI A;  5JI3 E;  5C1B A;  2J7N A;  4DV6 M;  2Y20 A;  1R2Y A;  1TH3 A;  1UAM A;  2V1U A;  4MGK E;  3U61 A;  3GP1 A;  1X37 A;  2Y0T A;  3D8B A;  1XMO M;  1NXZ A;  1GKI A;  4OX9 M;  3FTF A;  3L8U A;  1L1Z A;  5BR8 M;  3HHZ A;  3VK8 A;  4M9Z A;  3EIE A;  4BLC A;  1J5E M;  3U6D A;  4LF9 M;  3SAR A;  2UUA M;  1I94 M;  1UAJ A;  4GMQ A;  3KW6 A;  2FNA A;  1ORY B;  3MJ5 A;  4AKG A;  3KP1 E;  4AG6 A;  2F5S A;  3KY7 A;  3J81 S;  1IXR C;  4YQP A;  4NRV A;  3BBE A;  4I5S A;  2VQE M;  2R46 A;  3T1Y M;  3OTO M;  4K0K M;  1P9P A;  2QP9 X;  1HQY E;  3HU3 A;  3IEF A;  3AV0 A;  4J3C A;  1G59 A;  1JR3 D;  4G4O A;  1SXJ C;  4JI5 M;  4B3M M;  3LVV A;  2C5R A;  5FSW A;  2Y0Q A;  3U6S A;  1GL7 A;  3J7A S;  4KOD A;  2EO2 A;  2CUZ A;  2H1R A;  4FCW A;  2XH9 A;  3DOA A;  1S3S A;  1L2C A;  4PZK A;  1X7P A;  3L25 A;  2EGW A;  3OIJ A;  4PT5 A;  1QAN A;  3CTW B;  3VK7 A;  4QHS A;  5DNY A;  2R45 A;  2R4J A;  4LCB A;  3FUX A;  4JI4 M;  1UAL A;  3VLF B;  2DHR A;  2F5P A;  1Z6T A;  4W5W A;  1QQW A;  3KW2 A;  5GMB A;  1MX0 A;  5LMU M;  3A45 A;  1LV7 A;  4G4R A;  3GLH A;  5FTK A;  2QBY A;  2HA8 A;  2AHM A;  4L16 A;  3TWL A;  3WHK A;  4OU7 A;  3GRU A;  3HJQ A;  4JI0 M;  4R7G A;  3FUT A;  1IXS B;  3TPZ A;  4XGI A;  4YVH A;  1W5S A;  4YQK A;  1IM2 A;  4KGN A;  3L2A A;  4R3D A;  1HNZ M;  5IRE B;  1NHG C;  1K3W A;  4X62 M;  1KSF X;  2ZAM A;  4LF5 M;  1DGH B;  2KXE A;  3J7B A;  1R2Z A;  1PJI A;  2V3K A;  3UK6 A;  1IBK M;  1NSF A;  4S12 A;  3L29 A;  1XNQ M;  2E5L M;  3LVW A;  2C9C A;  4LG2 A;  3HJS A;  3T38 A;  1GL6 A;  3B9P A;  2L7I A;  4AG5 A;  3GLG B;  4JWF A;  4JXJ A;  5KPZ A;  4AZF A;  2XZU A;  4FVM A;  3C58 A;  2CHQ A;  5ITT A;  3VKH A;  3L27 A;  2UXC M;  3HJ8 A;  2DZN B;  1HT1 E;  4OVZ B;  2G5G X;  4MM3 B;  5CO4 A;  4DV7 M;  1K3X A;  3GRV A;  4LF6 M;  5E6J A;  3CF0 A;  5EXT A;  3LMM A;  5EP1 A;  7CAT A;  1IN4 A;  4A3V B;  4AQY M;  4LJA A;  4DV4 M;  4KO8 A;  4LGY A;  4ZPX A;  2RKO A;  3FD9 A;  4YQT A;  3CF2 A;  4IIW A;  4PDG A;  4L4U A;  4JI6 M;  4CNE A;  2QPA A;  3HHY A;  1TO0 A;  5ITX A;  3BBH A;  4GKK M;  2F4V M;  3TE6 A;  4NXN M;  3A46 A;  2KZU A;  3AFH A;  4DV1 M;  4IJF A;  3K92 A;  2XZF A;  1XXH B;  2W82 A;  4TUW A;  4JWH A;  4IBD A;  3U61 B;  1NNJ A;  5FTN A;  2XEP A;  1NNU C;  3M0E A;  4D82 A;  3U6P A;  4H3Z A;  2CE7 A;  4QOS A;  1IBL M;  2I7P A;  1R7R A;  1W5T A;  2P5T A;  3U6M A;  5D9F A;  3HHW A;  4GH9 A;  5IWA M;  1K3R A;  1DGG A;  2M60 A;  3THG A;  8CAT A;  3KP0 E;  5A2Q S;  2UUB M;  4GIP A;  5IT9 S;  2D7G A;  3W0F A;  3SAU A;  3N4K A;  4KHP M;  2ZAN A;  2UUC M;  2YNM D;  3SHF A;  5EXP A;  3GPX A;  4DV3 M;  1QAO A;  2XFT A;  2LNH C;  3DFZ A;  5ITX E;  2DXI A;  5H37 D;  3LQR A;  4M0W A;  3T1H M;  4YQG A;  3BOS A;  5EXX A;  3GRY A;  2Q2E B;  3I4V A;  4GKJ M;  2Y21 A;  4YHH M;  4LRS A;  3JR5 A;  2C9O A;  5FTM A;  3AJI B;  4JI2 M;  4NRW A;  4LJ6 A;  2DWM A;  3U60 B;  5IZ7 D;  4X65 M;  4DR7 M;  3J80 S;  2CEA A;  4PDI A;  1DO0 A;  3CF6 E;  1HT2 E;  2X49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...