4CNFA

Crystal structure of sulfolobus acidocaldarius trmj
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
Knots found
sequence length
157
structure length
155
Chain Sequence
b'MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKADINEAIKFSAKGSEVIEKMMKITNNFDDAIRDVDLKIATSSIADGDLLRKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVLNLSHAVGIVLYELWRNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOU RRNA METHYLASE
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 47
structure length 155
sequence length 157
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cnfA00
2QMMA 3AI9X 4YQGA 4FAKA 4RG1A 3E5YA 2EGWA 3ONPA 3AXZA 1X7OA 4YQ6A 3IC6A 4YVKA 4CNDA 2Z0YA 3KY7A 4YQAA 4YVHA 1UAKA 2V3JA 5D9FA 2HA8A 3KW2A 2I6DA 3NK6A 1J85A 4YQ9A 4YPYA 4H3ZA 2CX8A 3BBDA 3OIIA 4YQQA 3BBEA 4H3YA 4L69A 4J3CA 1GZ0A 2YY8A 4X3MA 3GYQA 3KNUA 3QUVA 4X3LA 2V3KA 4JAKA 4MCDA 1VHYA 1ZJRA 1MXIA 5GMBA 4YQRA 3N4JA 3O7BA 4YQ3A 4KDZA 4YQ7A 4YQLA 4E8BA 1VH0A 4YQDA 4YQPA 4YPXA 4YVGA 4CNEA 1K3RA 4MCCA 1IPAA 4PZKA 4YQOA 4YQ4A 4YQNA 1VHKA 5CO4A 1V2XA 4YVIA 4YQIA 4YQ5A 4YQKA 1UAMA 3DCMX 4JALA 1TO0A 3BBHA 4IG6A 4MCBA 4YPZA 4YQTA 4YQ1A 3L8UA 3ILKA 4KGNA 1NS5A 1UALA 3KTYA 4YPWA 1V6ZA 4YQ0A 5GMCA 4CNFA 1UAJA 4CNGA 4YQBA 4YQSA 4YQ2A 4YVJA 2QWVA 3N4KA 5GM8A 3OIJA 5FAIA 4YQCA 1O6DA 3IEFA 3OINA 3AIAA 1OY5A 1X7PA 1P9PA 1NXZA 1Z85A 4YQ8A 4YQJA 2O3AA 2EGVA 4XBOA 3NK7A
chains in the Genus database with same CATH superfamily
2QMMA 3AI9X 4YQGA 4FAKA 4RG1A 3E5YA 2EGWA 3ONPA 3AXZA 1X7OA 4YQ6A 3IC6A 4YVKA 4CNDA 2Z0YA 3KY7A 4YQAA 4YVHA 1UAKA 2V3JA 5D9FA 2HA8A 3KW2A 2I6DA 3NK6A 1J85A 4YQ9A 4YPYA 4H3ZA 2CX8A 3BBDA 3OIIA 4YQQA 3BBEA 4H3YA 4L69A 4J3CA 1GZ0A 2YY8A 4X3MA 3GYQA 3KNUA 3QUVA 4X3LA 2V3KA 4JAKA 4MCDA 1VHYA 1ZJRA 1MXIA 5GMBA 4YQRA 3N4JA 3O7BA 4YQ3A 4KDZA 4YQ7A 4JWFA 4YQLA 4E8BA 4FMWA 1VH0A 4YQDA 4YQPA 4YPXA 4YVGA 4CNEA 1K3RA 4MCCA 1IPAA 4PZKA 4YQOA 4YQ4A 4YQNA 1VHKA 5CO4A 1V2XA 4YVIA 4YQIA 4YQ5A 4YQKA 1UAMA 3DCMX 4JALA 4JWHA 1TO0A 3BBHA 4IG6A 4MCBA 4YPZA 4YQTA 4YQ1A 3L8UA 3ILKA 4JWJA 4KGNA 1NS5A 1UALA 3KTYA 4YPWA 1V6ZA 4YQ0A 5GMCA 4CNFA 1UAJA 4CNGA 4YQBA 4YQSA 4YQ2A 4YVJA 2QWVA 3N4KA 5GM8A 3OIJA 5FAIA 4YQCA 1O6DA 3IEFA 3OINA 3AIAA 1OY5A 4JWGA 1X7PA 1P9PA 1NXZA 1Z85A 4YQ8A 4YQJA 2O3AA 2EGVA 4XBOA 3NK7A
chains in the Genus database with same CATH topology
2QMMA 3AI9X 4YQGA 4FAKA 4RG1A 3E5YA 2EGWA 3ONPA 3AXZA 1X7OA 4YQ6A 3IC6A 4YVKA 4CNDA 2Z0YA 3KY7A 4YQAA 4YVHA 1UAKA 2V3JA 5D9FA 2HA8A 3KW2A 2I6DA 3NK6A 1J85A 4YQ9A 4YPYA 4H3ZA 2CX8A 3BBDA 3OIIA 4YQQA 3BBEA 4H3YA 4L69A 4J3CA 1GZ0A 2YY8A 4X3MA 3GYQA 3KNUA 3QUVA 4X3LA 2V3KA 4JAKA 4MCDA 1VHYA 1ZJRA 1MXIA 5GMBA 4YQRA 3N4JA 3O7BA 4YQ3A 4KDZA 4YQ7A 4JWFA 4YQLA 4E8BA 4FMWA 1VH0A 4YQDA 4YQPA 4YPXA 4YVGA 4CNEA 1K3RA 4MCCA 1IPAA 4PZKA 4YQOA 4YQ4A 4YQNA 1VHKA 5CO4A 1V2XA 4YVIA 4YQIA 4YQ5A 4YQKA 1UAMA 3DCMX 4JALA 4JWHA 1TO0A 3BBHA 4IG6A 4MCBA 4YPZA 4YQTA 4YQ1A 3L8UA 3ILKA 4JWJA 4KGNA 1NS5A 1UALA 3KTYA 4YPWA 1V6ZA 4YQ0A 5GMCA 4CNFA 1UAJA 4CNGA 4YQBA 4YQSA 4YQ2A 4YVJA 2QWVA 3N4KA 5GM8A 3OIJA 5FAIA 4YQCA 1O6DA 3IEFA 3OINA 3AIAA 1OY5A 4JWGA 1X7PA 1P9PA 1NXZA 1Z85A 4YQ8A 4YQJA 2O3AA 2EGVA 4XBOA 3NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMM A;  3AI9 X;  4YQG A;  4FAK A;  4RG1 A;  3E5Y A;  2EGW A;  3ONP A;  3AXZ A;  1X7O A;  4YQ6 A;  3IC6 A;  4YVK A;  4CND A;  2Z0Y A;  3KY7 A;  4YQA A;  4YVH A;  1UAK A;  2V3J A;  5D9F A;  2HA8 A;  3KW2 A;  2I6D A;  3NK6 A;  1J85 A;  4YQ9 A;  4YPY A;  4H3Z A;  2CX8 A;  3BBD A;  3OII A;  4YQQ A;  3BBE A;  4H3Y A;  4L69 A;  4J3C A;  1GZ0 A;  2YY8 A;  4X3M A;  3GYQ A;  3KNU A;  3QUV A;  4X3L A;  2V3K A;  4JAK A;  4MCD A;  1VHY A;  1ZJR A;  1MXI A;  5GMB A;  4YQR A;  3N4J A;  3O7B A;  4YQ3 A;  4KDZ A;  4YQ7 A;  4YQL A;  4E8B A;  1VH0 A;  4YQD A;  4YQP A;  4YPX A;  4YVG A;  4CNE A;  1K3R A;  4MCC A;  1IPA A;  4PZK A;  4YQO A;  4YQ4 A;  4YQN A;  1VHK A;  5CO4 A;  1V2X A;  4YVI A;  4YQI A;  4YQ5 A;  4YQK A;  1UAM A;  3DCM X;  4JAL A;  1TO0 A;  3BBH A;  4IG6 A;  4MCB A;  4YPZ A;  4YQT A;  4YQ1 A;  3L8U A;  3ILK A;  4KGN A;  1NS5 A;  1UAL A;  3KTY A;  4YPW A;  1V6Z A;  4YQ0 A;  5GMC A;  4CNF A;  1UAJ A;  4CNG A;  4YQB A;  4YQS A;  4YQ2 A;  4YVJ A;  2QWV A;  3N4K A;  5GM8 A;  3OIJ A;  5FAI A;  4YQC A;  1O6D A;  3IEF A;  3OIN A;  3AIA A;  1OY5 A;  1X7P A;  1P9P A;  1NXZ A;  1Z85 A;  4YQ8 A;  4YQJ A;  2O3A A;  2EGV A;  4XBO A;  3NK7 A; 
#chains in the Genus database with same CATH topology
 2QMM A;  3AI9 X;  4YQG A;  4FAK A;  4RG1 A;  3E5Y A;  2EGW A;  3ONP A;  3AXZ A;  1X7O A;  4YQ6 A;  3IC6 A;  4YVK A;  4CND A;  2Z0Y A;  3KY7 A;  4YQA A;  4YVH A;  1UAK A;  2V3J A;  5D9F A;  2HA8 A;  3KW2 A;  2I6D A;  3NK6 A;  1J85 A;  4YQ9 A;  4YPY A;  4H3Z A;  2CX8 A;  3BBD A;  3OII A;  4YQQ A;  3BBE A;  4H3Y A;  4L69 A;  4J3C A;  1GZ0 A;  2YY8 A;  4X3M A;  3GYQ A;  3KNU A;  3QUV A;  4X3L A;  2V3K A;  4JAK A;  4MCD A;  1VHY A;  1ZJR A;  1MXI A;  5GMB A;  4YQR A;  3N4J A;  3O7B A;  4YQ3 A;  4KDZ A;  4YQ7 A;  4JWF A;  4YQL A;  4E8B A;  4FMW A;  1VH0 A;  4YQD A;  4YQP A;  4YPX A;  4YVG A;  4CNE A;  1K3R A;  4MCC A;  1IPA A;  4PZK A;  4YQO A;  4YQ4 A;  4YQN A;  1VHK A;  5CO4 A;  1V2X A;  4YVI A;  4YQI A;  4YQ5 A;  4YQK A;  1UAM A;  3DCM X;  4JAL A;  4JWH A;  1TO0 A;  3BBH A;  4IG6 A;  4MCB A;  4YPZ A;  4YQT A;  4YQ1 A;  3L8U A;  3ILK A;  4JWJ A;  4KGN A;  1NS5 A;  1UAL A;  3KTY A;  4YPW A;  1V6Z A;  4YQ0 A;  5GMC A;  4CNF A;  1UAJ A;  4CNG A;  4YQB A;  4YQS A;  4YQ2 A;  4YVJ A;  2QWV A;  3N4K A;  5GM8 A;  3OIJ A;  5FAI A;  4YQC A;  1O6D A;  3IEF A;  3OIN A;  3AIA A;  1OY5 A;  4JWG A;  1X7P A;  1P9P A;  1NXZ A;  1Z85 A;  4YQ8 A;  4YQJ A;  2O3A A;  2EGV A;  4XBO A;  3NK7 A; 
#chains in the Genus database with same CATH homology
 2QMM A;  3AI9 X;  4YQG A;  4FAK A;  4RG1 A;  3E5Y A;  2EGW A;  3ONP A;  3AXZ A;  1X7O A;  4YQ6 A;  3IC6 A;  4YVK A;  4CND A;  2Z0Y A;  3KY7 A;  4YQA A;  4YVH A;  1UAK A;  2V3J A;  5D9F A;  2HA8 A;  3KW2 A;  2I6D A;  3NK6 A;  1J85 A;  4YQ9 A;  4YPY A;  4H3Z A;  2CX8 A;  3BBD A;  3OII A;  4YQQ A;  3BBE A;  4H3Y A;  4L69 A;  4J3C A;  1GZ0 A;  2YY8 A;  4X3M A;  3GYQ A;  3KNU A;  3QUV A;  4X3L A;  2V3K A;  4JAK A;  4MCD A;  1VHY A;  1ZJR A;  1MXI A;  5GMB A;  4YQR A;  3N4J A;  3O7B A;  4YQ3 A;  4KDZ A;  4YQ7 A;  4JWF A;  4YQL A;  4E8B A;  4FMW A;  1VH0 A;  4YQD A;  4YQP A;  4YPX A;  4YVG A;  4CNE A;  1K3R A;  4MCC A;  1IPA A;  4PZK A;  4YQO A;  4YQ4 A;  4YQN A;  1VHK A;  5CO4 A;  1V2X A;  4YVI A;  4YQI A;  4YQ5 A;  4YQK A;  1UAM A;  3DCM X;  4JAL A;  4JWH A;  1TO0 A;  3BBH A;  4IG6 A;  4MCB A;  4YPZ A;  4YQT A;  4YQ1 A;  3L8U A;  3ILK A;  4JWJ A;  4KGN A;  1NS5 A;  1UAL A;  3KTY A;  4YPW A;  1V6Z A;  4YQ0 A;  5GMC A;  4CNF A;  1UAJ A;  4CNG A;  4YQB A;  4YQS A;  4YQ2 A;  4YVJ A;  2QWV A;  3N4K A;  5GM8 A;  3OIJ A;  5FAI A;  4YQC A;  1O6D A;  3IEF A;  3OIN A;  3AIA A;  1OY5 A;  4JWG A;  1X7P A;  1P9P A;  1NXZ A;  1Z85 A;  4YQ8 A;  4YQJ A;  2O3A A;  2EGV A;  4XBO A;  3NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...