4CNFA

Crystal structure of sulfolobus acidocaldarius trmj
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
Knots found
sequence length
157
structure length
155
Chain Sequence
MTIRLVIVEPEGAYNLGFIARLVKNFLIDEFYVVNPKADINEAIKFSAKGSEVIEKMMKITNNFDDAIRDVDLKIATSSIADGDLLRKSIRPIDLERLIKDKKVAFIFGRESVGLTREEIAKSDFLLFIPANPEYPVLNLSHAVGIVLYELWRNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SPOU RRNA METHYLASE
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 47
structure length 155
sequence length 157
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cnfA00
1GZ0A 3O7BA 1VH0A 1V6ZA 3NK7A 3ONPA 4YQ6A 4YQ4A 3KW2A 4YQ9A 4MCBA 4CNFA 1VHYA 1Z85A 2V3KA 3E5YA 3N4JA 4YQ5A 5GMCA 4YQCA 4YQ1A 1TO0A 4IG6A 1IPAA 3AXZA 1NS5A 4KGNA 4YQTA 3OIJA 4CNGA 4YQNA 4YPWA 1UAJA 2EGVA 1UALA 4YQ8A 4YQOA 4CNEA 2V3JA 1UAMA 3AIAA 4YQRA 3IC6A 1X7OA 2Z0YA 4YVGA 4YQJA 3QUVA 1OY5A 1MXIA 2CX8A 5CO4A 4YQ0A 4L69A 3NK6A 4MCDA 3KY7A 4YQPA 4YQBA 4H3ZA 4JALA 3GYQA 5GMBA 5D9FA 3BBDA 2O3AA 3IEFA 4E8BA 3N4KA 4YQQA 5GM8A 2HA8A 1ZJRA 4YVHA 3L8UA 4YPYA 4YQDA 3ILKA 4CNDA 2QMMA 4J3CA 4YQGA 4YQLA 4YQIA 4YQSA 3BBEA 4FAKA 4YQ7A 4YPZA 4YQ3A 2QWVA 4X3MA 4XBOA 4PZKA 4X3LA 1P9PA 1X7PA 1VHKA 3DCMX 4YQ2A 3OIIA 4YQAA 2YY8A 5FAIA 4RG1A 4YPXA 1K3RA 1O6DA 4YVKA 3AI9X 4KDZA 4H3YA 3BBHA 4JAKA 2I6DA 1UAKA 3KNUA 1NXZA 4YVJA 3OINA 3KTYA 4YVIA 4MCCA 1J85A 4YQKA 1V2XA 2EGWA
chains in the Genus database with same CATH superfamily
1GZ0A 3O7BA 1VH0A 1V6ZA 3NK7A 3ONPA 4YQ6A 4YQ4A 3KW2A 4YQ9A 4MCBA 4CNFA 1VHYA 1Z85A 2V3KA 3E5YA 3N4JA 4YQ5A 5GMCA 4YQCA 4YQ1A 1TO0A 4IG6A 1IPAA 3AXZA 1NS5A 4KGNA 4YQTA 3OIJA 4JWHA 4CNGA 4YQNA 4YPWA 1UAJA 2EGVA 1UALA 4YQ8A 4YQOA 4CNEA 2V3JA 4JWGA 1UAMA 3AIAA 4YQRA 3IC6A 1X7OA 2Z0YA 4YVGA 4YQJA 3QUVA 1OY5A 1MXIA 2CX8A 5CO4A 4YQ0A 4FMWA 4L69A 3NK6A 4MCDA 3KY7A 4YQPA 4YQBA 4H3ZA 4JALA 3GYQA 5GMBA 5D9FA 3BBDA 2O3AA 3IEFA 4E8BA 3N4KA 4YQQA 5GM8A 2HA8A 1ZJRA 4YVHA 3L8UA 4YPYA 4YQDA 4JWFA 3ILKA 4CNDA 2QMMA 4J3CA 4YQGA 4YQLA 4YQIA 4YQSA 3BBEA 4FAKA 4YQ7A 4YPZA 4YQ3A 2QWVA 4JWJA 4X3MA 4XBOA 4PZKA 1P9PA 4X3LA 1X7PA 1VHKA 3DCMX 4YQ2A 3OIIA 4YQAA 2YY8A 5FAIA 4RG1A 4YPXA 1K3RA 1O6DA 4YVKA 3AI9X 4KDZA 4H3YA 3BBHA 4JAKA 2I6DA 1UAKA 3KNUA 1NXZA 4YVJA 3OINA 3KTYA 4YVIA 4MCCA 1J85A 4YQKA 1V2XA 2EGWA
chains in the Genus database with same CATH topology
1GZ0A 3O7BA 1VH0A 1V6ZA 3NK7A 3ONPA 4YQ6A 4YQ4A 3KW2A 4YQ9A 4MCBA 4CNFA 1VHYA 1Z85A 2V3KA 3E5YA 3N4JA 4YQ5A 5GMCA 4YQCA 4YQ1A 1TO0A 4IG6A 1IPAA 3AXZA 1NS5A 4KGNA 4YQTA 3OIJA 4JWHA 4CNGA 4YQNA 4YPWA 1UAJA 2EGVA 1UALA 4YQ8A 4YQOA 4CNEA 2V3JA 4JWGA 1UAMA 3AIAA 4YQRA 3IC6A 1X7OA 2Z0YA 4YVGA 4YQJA 3QUVA 1OY5A 1MXIA 2CX8A 5CO4A 4YQ0A 4FMWA 4L69A 3NK6A 4MCDA 3KY7A 4YQPA 4YQBA 4H3ZA 4JALA 3GYQA 5GMBA 5D9FA 3BBDA 2O3AA 3IEFA 4E8BA 3N4KA 4YQQA 5GM8A 2HA8A 1ZJRA 4YVHA 3L8UA 4YPYA 4YQDA 4JWFA 3ILKA 4CNDA 2QMMA 4J3CA 4YQGA 4YQLA 4YQIA 4YQSA 3BBEA 4FAKA 4YQ7A 4YPZA 4YQ3A 2QWVA 4JWJA 4X3MA 4XBOA 4PZKA 1P9PA 4X3LA 1X7PA 1VHKA 3DCMX 4YQ2A 3OIIA 4YQAA 2YY8A 5FAIA 4RG1A 4YPXA 1K3RA 1O6DA 4YVKA 3AI9X 4KDZA 4H3YA 3BBHA 4JAKA 2I6DA 1UAKA 3KNUA 1NXZA 4YVJA 3OINA 3KTYA 4YVIA 4MCCA 1J85A 4YQKA 1V2XA 2EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZ0 A;  3O7B A;  1VH0 A;  1V6Z A;  3NK7 A;  3ONP A;  4YQ6 A;  4YQ4 A;  3KW2 A;  4YQ9 A;  4MCB A;  4CNF A;  1VHY A;  1Z85 A;  2V3K A;  3E5Y A;  3N4J A;  4YQ5 A;  5GMC A;  4YQC A;  4YQ1 A;  1TO0 A;  4IG6 A;  1IPA A;  3AXZ A;  1NS5 A;  4KGN A;  4YQT A;  3OIJ A;  4CNG A;  4YQN A;  4YPW A;  1UAJ A;  2EGV A;  1UAL A;  4YQ8 A;  4YQO A;  4CNE A;  2V3J A;  1UAM A;  3AIA A;  4YQR A;  3IC6 A;  1X7O A;  2Z0Y A;  4YVG A;  4YQJ A;  3QUV A;  1OY5 A;  1MXI A;  2CX8 A;  5CO4 A;  4YQ0 A;  4L69 A;  3NK6 A;  4MCD A;  3KY7 A;  4YQP A;  4YQB A;  4H3Z A;  4JAL A;  3GYQ A;  5GMB A;  5D9F A;  3BBD A;  2O3A A;  3IEF A;  4E8B A;  3N4K A;  4YQQ A;  5GM8 A;  2HA8 A;  1ZJR A;  4YVH A;  3L8U A;  4YPY A;  4YQD A;  3ILK A;  4CND A;  2QMM A;  4J3C A;  4YQG A;  4YQL A;  4YQI A;  4YQS A;  3BBE A;  4FAK A;  4YQ7 A;  4YPZ A;  4YQ3 A;  2QWV A;  4X3M A;  4XBO A;  4PZK A;  4X3L A;  1P9P A;  1X7P A;  1VHK A;  3DCM X;  4YQ2 A;  3OII A;  4YQA A;  2YY8 A;  5FAI A;  4RG1 A;  4YPX A;  1K3R A;  1O6D A;  4YVK A;  3AI9 X;  4KDZ A;  4H3Y A;  3BBH A;  4JAK A;  2I6D A;  1UAK A;  3KNU A;  1NXZ A;  4YVJ A;  3OIN A;  3KTY A;  4YVI A;  4MCC A;  1J85 A;  4YQK A;  1V2X A;  2EGW A; 
#chains in the Genus database with same CATH topology
 1GZ0 A;  3O7B A;  1VH0 A;  1V6Z A;  3NK7 A;  3ONP A;  4YQ6 A;  4YQ4 A;  3KW2 A;  4YQ9 A;  4MCB A;  4CNF A;  1VHY A;  1Z85 A;  2V3K A;  3E5Y A;  3N4J A;  4YQ5 A;  5GMC A;  4YQC A;  4YQ1 A;  1TO0 A;  4IG6 A;  1IPA A;  3AXZ A;  1NS5 A;  4KGN A;  4YQT A;  3OIJ A;  4JWH A;  4CNG A;  4YQN A;  4YPW A;  1UAJ A;  2EGV A;  1UAL A;  4YQ8 A;  4YQO A;  4CNE A;  2V3J A;  4JWG A;  1UAM A;  3AIA A;  4YQR A;  3IC6 A;  1X7O A;  2Z0Y A;  4YVG A;  4YQJ A;  3QUV A;  1OY5 A;  1MXI A;  2CX8 A;  5CO4 A;  4YQ0 A;  4FMW A;  4L69 A;  3NK6 A;  4MCD A;  3KY7 A;  4YQP A;  4YQB A;  4H3Z A;  4JAL A;  3GYQ A;  5GMB A;  5D9F A;  3BBD A;  2O3A A;  3IEF A;  4E8B A;  3N4K A;  4YQQ A;  5GM8 A;  2HA8 A;  1ZJR A;  4YVH A;  3L8U A;  4YPY A;  4YQD A;  4JWF A;  3ILK A;  4CND A;  2QMM A;  4J3C A;  4YQG A;  4YQL A;  4YQI A;  4YQS A;  3BBE A;  4FAK A;  4YQ7 A;  4YPZ A;  4YQ3 A;  2QWV A;  4JWJ A;  4X3M A;  4XBO A;  4PZK A;  1P9P A;  4X3L A;  1X7P A;  1VHK A;  3DCM X;  4YQ2 A;  3OII A;  4YQA A;  2YY8 A;  5FAI A;  4RG1 A;  4YPX A;  1K3R A;  1O6D A;  4YVK A;  3AI9 X;  4KDZ A;  4H3Y A;  3BBH A;  4JAK A;  2I6D A;  1UAK A;  3KNU A;  1NXZ A;  4YVJ A;  3OIN A;  3KTY A;  4YVI A;  4MCC A;  1J85 A;  4YQK A;  1V2X A;  2EGW A; 
#chains in the Genus database with same CATH homology
 1GZ0 A;  3O7B A;  1VH0 A;  1V6Z A;  3NK7 A;  3ONP A;  4YQ6 A;  4YQ4 A;  3KW2 A;  4YQ9 A;  4MCB A;  4CNF A;  1VHY A;  1Z85 A;  2V3K A;  3E5Y A;  3N4J A;  4YQ5 A;  5GMC A;  4YQC A;  4YQ1 A;  1TO0 A;  4IG6 A;  1IPA A;  3AXZ A;  1NS5 A;  4KGN A;  4YQT A;  3OIJ A;  4JWH A;  4CNG A;  4YQN A;  4YPW A;  1UAJ A;  2EGV A;  1UAL A;  4YQ8 A;  4YQO A;  4CNE A;  2V3J A;  4JWG A;  1UAM A;  3AIA A;  4YQR A;  3IC6 A;  1X7O A;  2Z0Y A;  4YVG A;  4YQJ A;  3QUV A;  1OY5 A;  1MXI A;  2CX8 A;  5CO4 A;  4YQ0 A;  4FMW A;  4L69 A;  3NK6 A;  4MCD A;  3KY7 A;  4YQP A;  4YQB A;  4H3Z A;  4JAL A;  3GYQ A;  5GMB A;  5D9F A;  3BBD A;  2O3A A;  3IEF A;  4E8B A;  3N4K A;  4YQQ A;  5GM8 A;  2HA8 A;  1ZJR A;  4YVH A;  3L8U A;  4YPY A;  4YQD A;  4JWF A;  3ILK A;  4CND A;  2QMM A;  4J3C A;  4YQG A;  4YQL A;  4YQI A;  4YQS A;  3BBE A;  4FAK A;  4YQ7 A;  4YPZ A;  4YQ3 A;  2QWV A;  4JWJ A;  4X3M A;  4XBO A;  4PZK A;  1P9P A;  4X3L A;  1X7P A;  1VHK A;  3DCM X;  4YQ2 A;  3OII A;  4YQA A;  2YY8 A;  5FAI A;  4RG1 A;  4YPX A;  1K3R A;  1O6D A;  4YVK A;  3AI9 X;  4KDZ A;  4H3Y A;  3BBH A;  4JAK A;  2I6D A;  1UAK A;  3KNU A;  1NXZ A;  4YVJ A;  3OIN A;  3KTY A;  4YVI A;  4MCC A;  1J85 A;  4YQK A;  1V2X A;  2EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...