4JWHA

Crystal structure of sptrm10(full length)-sah complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
189
structure length
185
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKKILTVNQVFEILSLWLEYRDWEKAFMEVIPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 62
structure length 185
sequence length 189
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwhA00
4JWHA 4JWFA 4JWJA 4FMWA 4JWGA
chains in the Genus database with same CATH superfamily
2V3KA 4RG1A 3L8UA 5GMCA 1J85A 3DCMX 4YQ5A 2I6DA 1MXIA 1V6ZA 4KGNA 4YQBA 4KDZA 5GMBA 1NS5A 3GYQA 3NK6A 5CO4A 4L69A 2O3AA 4H3YA 3KW2A 4PZKA 4YVHA 2Z0YA 3IEFA 2HA8A 4J3CA 1X7OA 3BBEA 4YQ4A 4YQDA 4MCBA 4YQ9A 4YVIA 1X7PA 4YPZA 1UAJA 4YQNA 4YQ0A 4YQRA 4CNDA 4JALA 4JWJA 4YQSA 1UAKA 3KY7A 3O7BA 1VHYA 2EGVA 4YQ8A 1IPAA 1UALA 5FAIA 3KTYA 3ONPA 3AIAA 4E8BA 4YVGA 4YVJA 3IC6A 4YQ2A 3QUVA 2YY8A 2QMMA 4MCDA 1P9PA 1OY5A 2EGWA 3BBDA 1VH0A 3OINA 3OIJA 4CNGA 3AXZA 4YQ7A 4YQQA 3BBHA 4YQOA 5GM8A 4CNEA 4YPWA 4H3ZA 1V2XA 4X3LA 4YQ6A 4JWFA 4YQPA 4FMWA 3N4JA 2CX8A 1O6DA 2V3JA 3N4KA 4YQKA 3E5YA 4JWHA 1GZ0A 4YQCA 4JAKA 1UAMA 4CNFA 1NXZA 4JWGA 4XBOA 4IG6A 4YQLA 1TO0A 3KNUA 4YPYA 4YQAA 4X3MA 4YQTA 2QWVA 4YQ1A 4YQJA 4MCCA 1VHKA 4YQ3A 4YQGA 4YPXA 4YQIA 3ILKA 4YVKA 1ZJRA 4FAKA 5D9FA 3OIIA 1Z85A 1K3RA 3AI9X 3NK7A
chains in the Genus database with same CATH topology
2V3KA 4RG1A 3L8UA 5GMCA 1J85A 3DCMX 4YQ5A 2I6DA 1MXIA 1V6ZA 4KGNA 4YQBA 4KDZA 5GMBA 1NS5A 3GYQA 3NK6A 5CO4A 4L69A 2O3AA 4H3YA 3KW2A 4PZKA 4YVHA 2Z0YA 3IEFA 2HA8A 4J3CA 1X7OA 3BBEA 4YQ4A 4YQDA 4MCBA 4YQ9A 4YVIA 1X7PA 4YPZA 1UAJA 4YQNA 4YQ0A 4YQRA 4CNDA 4JALA 4JWJA 4YQSA 1UAKA 3KY7A 3O7BA 1VHYA 2EGVA 4YQ8A 1IPAA 1UALA 5FAIA 3KTYA 3ONPA 3AIAA 4E8BA 4YVGA 4YVJA 3IC6A 4YQ2A 3QUVA 2YY8A 2QMMA 4MCDA 1P9PA 1OY5A 2EGWA 3BBDA 1VH0A 3OINA 3OIJA 4CNGA 3AXZA 4YQ7A 4YQQA 3BBHA 4YQOA 5GM8A 4CNEA 4YPWA 4H3ZA 1V2XA 4X3LA 4YQ6A 4JWFA 4YQPA 4FMWA 3N4JA 2CX8A 1O6DA 2V3JA 3N4KA 4YQKA 3E5YA 4JWHA 1GZ0A 4YQCA 4JAKA 1UAMA 4CNFA 1NXZA 4JWGA 4XBOA 4IG6A 4YQLA 1TO0A 3KNUA 4YPYA 4YQAA 4X3MA 4YQTA 2QWVA 4YQ1A 4YQJA 4MCCA 1VHKA 4YQ3A 4YQGA 4YPXA 4YQIA 3ILKA 4YVKA 1ZJRA 4FAKA 5D9FA 3OIIA 1Z85A 1K3RA 3AI9X 3NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWH A;  4JWF A;  4JWJ A;  4FMW A;  4JWG A; 
#chains in the Genus database with same CATH topology
 2V3K A;  4RG1 A;  3L8U A;  5GMC A;  1J85 A;  3DCM X;  4YQ5 A;  2I6D A;  1MXI A;  1V6Z A;  4KGN A;  4YQB A;  4KDZ A;  5GMB A;  1NS5 A;  3GYQ A;  3NK6 A;  5CO4 A;  4L69 A;  2O3A A;  4H3Y A;  3KW2 A;  4PZK A;  4YVH A;  2Z0Y A;  3IEF A;  2HA8 A;  4J3C A;  1X7O A;  3BBE A;  4YQ4 A;  4YQD A;  4MCB A;  4YQ9 A;  4YVI A;  1X7P A;  4YPZ A;  1UAJ A;  4YQN A;  4YQ0 A;  4YQR A;  4CND A;  4JAL A;  4JWJ A;  4YQS A;  1UAK A;  3KY7 A;  3O7B A;  1VHY A;  2EGV A;  4YQ8 A;  1IPA A;  1UAL A;  5FAI A;  3KTY A;  3ONP A;  3AIA A;  4E8B A;  4YVG A;  4YVJ A;  3IC6 A;  4YQ2 A;  3QUV A;  2YY8 A;  2QMM A;  4MCD A;  1P9P A;  1OY5 A;  2EGW A;  3BBD A;  1VH0 A;  3OIN A;  3OIJ A;  4CNG A;  3AXZ A;  4YQ7 A;  4YQQ A;  3BBH A;  4YQO A;  5GM8 A;  4CNE A;  4YPW A;  4H3Z A;  1V2X A;  4X3L A;  4YQ6 A;  4JWF A;  4YQP A;  4FMW A;  3N4J A;  2CX8 A;  1O6D A;  2V3J A;  3N4K A;  4YQK A;  3E5Y A;  4JWH A;  1GZ0 A;  4YQC A;  4JAK A;  1UAM A;  4CNF A;  1NXZ A;  4JWG A;  4XBO A;  4IG6 A;  4YQL A;  1TO0 A;  3KNU A;  4YPY A;  4YQA A;  4X3M A;  4YQT A;  2QWV A;  4YQ1 A;  4YQJ A;  4MCC A;  1VHK A;  4YQ3 A;  4YQG A;  4YPX A;  4YQI A;  3ILK A;  4YVK A;  1ZJR A;  4FAK A;  5D9F A;  3OII A;  1Z85 A;  1K3R A;  3AI9 X;  3NK7 A; 
#chains in the Genus database with same CATH homology
 2V3K A;  4RG1 A;  3L8U A;  5GMC A;  1J85 A;  3DCM X;  4YQ5 A;  2I6D A;  1MXI A;  1V6Z A;  4KGN A;  4YQB A;  4KDZ A;  5GMB A;  1NS5 A;  3GYQ A;  3NK6 A;  5CO4 A;  4L69 A;  2O3A A;  4H3Y A;  3KW2 A;  4PZK A;  4YVH A;  2Z0Y A;  3IEF A;  2HA8 A;  4J3C A;  1X7O A;  3BBE A;  4YQ4 A;  4YQD A;  4MCB A;  4YQ9 A;  4YVI A;  1X7P A;  4YPZ A;  1UAJ A;  4YQN A;  4YQ0 A;  4YQR A;  4CND A;  4JAL A;  4JWJ A;  4YQS A;  1UAK A;  3KY7 A;  3O7B A;  1VHY A;  2EGV A;  4YQ8 A;  1IPA A;  1UAL A;  5FAI A;  3KTY A;  3ONP A;  3AIA A;  4E8B A;  4YVG A;  4YVJ A;  3IC6 A;  4YQ2 A;  3QUV A;  2YY8 A;  2QMM A;  4MCD A;  1P9P A;  1OY5 A;  2EGW A;  3BBD A;  1VH0 A;  3OIN A;  3OIJ A;  4CNG A;  3AXZ A;  4YQ7 A;  4YQQ A;  3BBH A;  4YQO A;  5GM8 A;  4CNE A;  4YPW A;  4H3Z A;  1V2X A;  4X3L A;  4YQ6 A;  4JWF A;  4YQP A;  4FMW A;  3N4J A;  2CX8 A;  1O6D A;  2V3J A;  3N4K A;  4YQK A;  3E5Y A;  4JWH A;  1GZ0 A;  4YQC A;  4JAK A;  1UAM A;  4CNF A;  1NXZ A;  4JWG A;  4XBO A;  4IG6 A;  4YQL A;  1TO0 A;  3KNU A;  4YPY A;  4YQA A;  4X3M A;  4YQT A;  2QWV A;  4YQ1 A;  4YQJ A;  4MCC A;  1VHK A;  4YQ3 A;  4YQG A;  4YPX A;  4YQI A;  3ILK A;  4YVK A;  1ZJR A;  4FAK A;  5D9F A;  3OII A;  1Z85 A;  1K3R A;  3AI9 X;  3NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...