4JWHA

Crystal structure of sptrm10(full length)-sah complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
189
structure length
185
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKKILTVNQVFEILSLWLEYRDWEKAFMEVIPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 62
structure length 185
sequence length 189
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwhA00
4JWJA 4FMWA 4JWGA 4JWFA 4JWHA
chains in the Genus database with same CATH superfamily
4YQLA 3DCMX 4YQAA 1UALA 2QWVA 1V6ZA 2EGWA 4YPXA 1UAMA 3N4KA 1UAKA 2Z0YA 4KDZA 4YPWA 4YQKA 4YQDA 4YQQA 3AI9X 4PZKA 4YQ5A 4YQSA 5D9FA 4YQRA 4YQGA 2EGVA 2QMMA 1VHKA 2V3KA 4MCBA 4FMWA 3IEFA 4YQ4A 1VHYA 4CNGA 3E5YA 3AXZA 1P9PA 3QUVA 4YQ7A 2CX8A 4YQ6A 4YQ0A 4KGNA 1J85A 4RG1A 4YVHA 3IC6A 4YQIA 4YQJA 3N4JA 4CNEA 4JALA 4JWHA 1Z85A 4J3CA 4YQOA 4XBOA 1NXZA 1O6DA 4YQ3A 4X3MA 2YY8A 4H3ZA 3OIJA 3ILKA 4FAKA 3NK7A 3OINA 3KNUA 3KW2A 4YQCA 1ZJRA 4YVKA 1V2XA 3ONPA 3BBHA 5GM8A 4MCCA 4YQTA 1X7OA 3AIAA 4YPZA 1X7PA 4L69A 4YVIA 4YQ9A 3BBDA 1TO0A 1NS5A 4YQ2A 1K3RA 4YVJA 2HA8A 4H3YA 4YVGA 5FAIA 2O3AA 4E8BA 4JWGA 4YQ8A 2V3JA 1GZ0A 3L8UA 3KTYA 3NK6A 5GMCA 4YQPA 4YQNA 4CNFA 3BBEA 5GMBA 4YQ1A 5CO4A 1UAJA 1IPAA 3KY7A 4X3LA 4IG6A 4YPYA 4YQBA 4JAKA 3GYQA 3OIIA 4JWFA 1MXIA 4MCDA 4JWJA 2I6DA 4CNDA 3O7BA 1OY5A 1VH0A
chains in the Genus database with same CATH topology
4YQLA 3DCMX 4YQAA 1UALA 2QWVA 1V6ZA 2EGWA 4YPXA 1UAMA 3N4KA 1UAKA 2Z0YA 4KDZA 4YPWA 4YQKA 4YQDA 4YQQA 3AI9X 4PZKA 4YQ5A 4YQSA 5D9FA 4YQRA 4YQGA 2EGVA 2QMMA 1VHKA 2V3KA 4MCBA 4FMWA 3IEFA 4YQ4A 1VHYA 4CNGA 3E5YA 3AXZA 1P9PA 3QUVA 4YQ7A 2CX8A 4YQ6A 4YQ0A 4KGNA 1J85A 4RG1A 4YVHA 3IC6A 4YQIA 4YQJA 3N4JA 4CNEA 4JALA 4JWHA 1Z85A 4J3CA 4YQOA 4XBOA 1NXZA 1O6DA 4YQ3A 4X3MA 2YY8A 4H3ZA 3OIJA 3ILKA 4FAKA 3NK7A 3OINA 3KNUA 3KW2A 4YQCA 1ZJRA 4YVKA 1V2XA 3ONPA 3BBHA 5GM8A 4MCCA 4YQTA 1X7OA 3AIAA 4YPZA 1X7PA 4L69A 4YVIA 4YQ9A 3BBDA 1TO0A 1NS5A 4YQ2A 1K3RA 4YVJA 2HA8A 4H3YA 4YVGA 5FAIA 2O3AA 4E8BA 4JWGA 4YQ8A 2V3JA 1GZ0A 3L8UA 3KTYA 3NK6A 5GMCA 4YQPA 4YQNA 4CNFA 3BBEA 5GMBA 4YQ1A 5CO4A 1UAJA 1IPAA 3KY7A 4X3LA 4IG6A 4YPYA 4YQBA 4JAKA 3GYQA 3OIIA 4JWFA 1MXIA 4MCDA 4JWJA 2I6DA 4CNDA 3O7BA 1OY5A 1VH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWJ A;  4FMW A;  4JWG A;  4JWF A;  4JWH A; 
#chains in the Genus database with same CATH topology
 4YQL A;  3DCM X;  4YQA A;  1UAL A;  2QWV A;  1V6Z A;  2EGW A;  4YPX A;  1UAM A;  3N4K A;  1UAK A;  2Z0Y A;  4KDZ A;  4YPW A;  4YQK A;  4YQD A;  4YQQ A;  3AI9 X;  4PZK A;  4YQ5 A;  4YQS A;  5D9F A;  4YQR A;  4YQG A;  2EGV A;  2QMM A;  1VHK A;  2V3K A;  4MCB A;  4FMW A;  3IEF A;  4YQ4 A;  1VHY A;  4CNG A;  3E5Y A;  3AXZ A;  1P9P A;  3QUV A;  4YQ7 A;  2CX8 A;  4YQ6 A;  4YQ0 A;  4KGN A;  1J85 A;  4RG1 A;  4YVH A;  3IC6 A;  4YQI A;  4YQJ A;  3N4J A;  4CNE A;  4JAL A;  4JWH A;  1Z85 A;  4J3C A;  4YQO A;  4XBO A;  1NXZ A;  1O6D A;  4YQ3 A;  4X3M A;  2YY8 A;  4H3Z A;  3OIJ A;  3ILK A;  4FAK A;  3NK7 A;  3OIN A;  3KNU A;  3KW2 A;  4YQC A;  1ZJR A;  4YVK A;  1V2X A;  3ONP A;  3BBH A;  5GM8 A;  4MCC A;  4YQT A;  1X7O A;  3AIA A;  4YPZ A;  1X7P A;  4L69 A;  4YVI A;  4YQ9 A;  3BBD A;  1TO0 A;  1NS5 A;  4YQ2 A;  1K3R A;  4YVJ A;  2HA8 A;  4H3Y A;  4YVG A;  5FAI A;  2O3A A;  4E8B A;  4JWG A;  4YQ8 A;  2V3J A;  1GZ0 A;  3L8U A;  3KTY A;  3NK6 A;  5GMC A;  4YQP A;  4YQN A;  4CNF A;  3BBE A;  5GMB A;  4YQ1 A;  5CO4 A;  1UAJ A;  1IPA A;  3KY7 A;  4X3L A;  4IG6 A;  4YPY A;  4YQB A;  4JAK A;  3GYQ A;  3OII A;  4JWF A;  1MXI A;  4MCD A;  4JWJ A;  2I6D A;  4CND A;  3O7B A;  1OY5 A;  1VH0 A; 
#chains in the Genus database with same CATH homology
 4YQL A;  3DCM X;  4YQA A;  1UAL A;  2QWV A;  1V6Z A;  2EGW A;  4YPX A;  1UAM A;  3N4K A;  1UAK A;  2Z0Y A;  4KDZ A;  4YPW A;  4YQK A;  4YQD A;  4YQQ A;  3AI9 X;  4PZK A;  4YQ5 A;  4YQS A;  5D9F A;  4YQR A;  4YQG A;  2EGV A;  2QMM A;  1VHK A;  2V3K A;  4MCB A;  4FMW A;  3IEF A;  4YQ4 A;  1VHY A;  4CNG A;  3E5Y A;  3AXZ A;  1P9P A;  3QUV A;  4YQ7 A;  2CX8 A;  4YQ6 A;  4YQ0 A;  4KGN A;  1J85 A;  4RG1 A;  4YVH A;  3IC6 A;  4YQI A;  4YQJ A;  3N4J A;  4CNE A;  4JAL A;  4JWH A;  1Z85 A;  4J3C A;  4YQO A;  4XBO A;  1NXZ A;  1O6D A;  4YQ3 A;  4X3M A;  2YY8 A;  4H3Z A;  3OIJ A;  3ILK A;  4FAK A;  3NK7 A;  3OIN A;  3KNU A;  3KW2 A;  4YQC A;  1ZJR A;  4YVK A;  1V2X A;  3ONP A;  3BBH A;  5GM8 A;  4MCC A;  4YQT A;  1X7O A;  3AIA A;  4YPZ A;  1X7P A;  4L69 A;  4YVI A;  4YQ9 A;  3BBD A;  1TO0 A;  1NS5 A;  4YQ2 A;  1K3R A;  4YVJ A;  2HA8 A;  4H3Y A;  4YVG A;  5FAI A;  2O3A A;  4E8B A;  4JWG A;  4YQ8 A;  2V3J A;  1GZ0 A;  3L8U A;  3KTY A;  3NK6 A;  5GMC A;  4YQP A;  4YQN A;  4CNF A;  3BBE A;  5GMB A;  4YQ1 A;  5CO4 A;  1UAJ A;  1IPA A;  3KY7 A;  4X3L A;  4IG6 A;  4YPY A;  4YQB A;  4JAK A;  3GYQ A;  3OII A;  4JWF A;  1MXI A;  4MCD A;  4JWJ A;  2I6D A;  4CND A;  3O7B A;  1OY5 A;  1VH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...