4JWFA

Crystal structure of sptrm10(74)-sah complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
Knots found
sequence length
187
structure length
187
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 61
structure length 187
sequence length 187
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwfA00
4FMWA 4JWFA 4JWJA 4JWHA 4JWGA
chains in the Genus database with same CATH superfamily
4YQPA 3O7BA 2QWVA 4YQQA 2CX8A 2Z0YA 4X3LA 3KNUA 4YQ9A 1Z85A 5GM8A 4YQ0A 3KW2A 4H3YA 4YQDA 4YVKA 4YVJA 3NK7A 4KDZA 3AI9X 1UALA 3NK6A 4RG1A 4FMWA 4CNDA 4YQBA 4JWHA 2EGWA 1V6ZA 1VHYA 4YQIA 1V2XA 3E5YA 4FAKA 4YQTA 2V3JA 3KY7A 4YQSA 4PZKA 4YVHA 3KTYA 5D9FA 4X3MA 5FAIA 4YQOA 1UAJA 4XBOA 1NS5A 1NXZA 2O3AA 4J3CA 4YQJA 3QUVA 4YQCA 5GMBA 4CNEA 4YPWA 1ZJRA 4YQ6A 4JWGA 4IG6A 3GYQA 3ILKA 4YQAA 2QMMA 1VHKA 4MCDA 1GZ0A 4JAKA 2EGVA 4YQ4A 1UAKA 3AXZA 4YQ1A 4YQ7A 1P9PA 1K3RA 4YQNA 4YVIA 4CNFA 4YPZA 5GMCA 4JWFA 2V3KA 2I6DA 4YQGA 1J85A 4YQLA 3IC6A 4E8BA 3N4JA 2YY8A 3OIIA 4MCBA 4YQ5A 3AIAA 4MCCA 4L69A 1IPAA 3BBDA 3N4KA 4H3ZA 4JALA 3L8UA 4YPXA 3BBHA 3BBEA 1X7OA 1MXIA 1VH0A 4YQ2A 4CNGA 4JWJA 4YQRA 3ONPA 4YQ8A 4YQKA 3OIJA 1UAMA 3DCMX 4KGNA 1X7PA 4YQ3A 4YVGA 1O6DA 1OY5A 4YPYA 1TO0A 3OINA 5CO4A 3IEFA 2HA8A
chains in the Genus database with same CATH topology
4YQPA 3O7BA 2QWVA 4YQQA 2CX8A 2Z0YA 4X3LA 3KNUA 4YQ9A 1Z85A 5GM8A 4YQ0A 3KW2A 4H3YA 4YQDA 4YVKA 4YVJA 3NK7A 4KDZA 3AI9X 1UALA 3NK6A 4RG1A 4FMWA 4CNDA 4YQBA 4JWHA 2EGWA 1V6ZA 1VHYA 4YQIA 1V2XA 3E5YA 4FAKA 4YQTA 2V3JA 3KY7A 4YQSA 4PZKA 4YVHA 3KTYA 5D9FA 4X3MA 5FAIA 4YQOA 1UAJA 4XBOA 1NS5A 1NXZA 2O3AA 4J3CA 4YQJA 3QUVA 4YQCA 5GMBA 4CNEA 4YPWA 1ZJRA 4YQ6A 4JWGA 4IG6A 3GYQA 3ILKA 4YQAA 2QMMA 1VHKA 4MCDA 1GZ0A 4JAKA 2EGVA 4YQ4A 1UAKA 3AXZA 4YQ1A 4YQ7A 1P9PA 1K3RA 4YQNA 4YVIA 4CNFA 4YPZA 5GMCA 4JWFA 2V3KA 2I6DA 4YQGA 1J85A 4YQLA 3IC6A 4E8BA 3N4JA 2YY8A 3OIIA 4MCBA 4YQ5A 3AIAA 4MCCA 4L69A 1IPAA 3BBDA 3N4KA 4H3ZA 4JALA 3L8UA 4YPXA 3BBHA 3BBEA 1X7OA 1MXIA 1VH0A 4YQ2A 4CNGA 4JWJA 4YQRA 3ONPA 4YQ8A 4YQKA 3OIJA 1UAMA 3DCMX 4KGNA 1X7PA 4YQ3A 4YVGA 1O6DA 1OY5A 4YPYA 1TO0A 3OINA 5CO4A 3IEFA 2HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMW A;  4JWF A;  4JWJ A;  4JWH A;  4JWG A; 
#chains in the Genus database with same CATH topology
 4YQP A;  3O7B A;  2QWV A;  4YQQ A;  2CX8 A;  2Z0Y A;  4X3L A;  3KNU A;  4YQ9 A;  1Z85 A;  5GM8 A;  4YQ0 A;  3KW2 A;  4H3Y A;  4YQD A;  4YVK A;  4YVJ A;  3NK7 A;  4KDZ A;  3AI9 X;  1UAL A;  3NK6 A;  4RG1 A;  4FMW A;  4CND A;  4YQB A;  4JWH A;  2EGW A;  1V6Z A;  1VHY A;  4YQI A;  1V2X A;  3E5Y A;  4FAK A;  4YQT A;  2V3J A;  3KY7 A;  4YQS A;  4PZK A;  4YVH A;  3KTY A;  5D9F A;  4X3M A;  5FAI A;  4YQO A;  1UAJ A;  4XBO A;  1NS5 A;  1NXZ A;  2O3A A;  4J3C A;  4YQJ A;  3QUV A;  4YQC A;  5GMB A;  4CNE A;  4YPW A;  1ZJR A;  4YQ6 A;  4JWG A;  4IG6 A;  3GYQ A;  3ILK A;  4YQA A;  2QMM A;  1VHK A;  4MCD A;  1GZ0 A;  4JAK A;  2EGV A;  4YQ4 A;  1UAK A;  3AXZ A;  4YQ1 A;  4YQ7 A;  1P9P A;  1K3R A;  4YQN A;  4YVI A;  4CNF A;  4YPZ A;  5GMC A;  4JWF A;  2V3K A;  2I6D A;  4YQG A;  1J85 A;  4YQL A;  3IC6 A;  4E8B A;  3N4J A;  2YY8 A;  3OII A;  4MCB A;  4YQ5 A;  3AIA A;  4MCC A;  4L69 A;  1IPA A;  3BBD A;  3N4K A;  4H3Z A;  4JAL A;  3L8U A;  4YPX A;  3BBH A;  3BBE A;  1X7O A;  1MXI A;  1VH0 A;  4YQ2 A;  4CNG A;  4JWJ A;  4YQR A;  3ONP A;  4YQ8 A;  4YQK A;  3OIJ A;  1UAM A;  3DCM X;  4KGN A;  1X7P A;  4YQ3 A;  4YVG A;  1O6D A;  1OY5 A;  4YPY A;  1TO0 A;  3OIN A;  5CO4 A;  3IEF A;  2HA8 A; 
#chains in the Genus database with same CATH homology
 4YQP A;  3O7B A;  2QWV A;  4YQQ A;  2CX8 A;  2Z0Y A;  4X3L A;  3KNU A;  4YQ9 A;  1Z85 A;  5GM8 A;  4YQ0 A;  3KW2 A;  4H3Y A;  4YQD A;  4YVK A;  4YVJ A;  3NK7 A;  4KDZ A;  3AI9 X;  1UAL A;  3NK6 A;  4RG1 A;  4FMW A;  4CND A;  4YQB A;  4JWH A;  2EGW A;  1V6Z A;  1VHY A;  4YQI A;  1V2X A;  3E5Y A;  4FAK A;  4YQT A;  2V3J A;  3KY7 A;  4YQS A;  4PZK A;  4YVH A;  3KTY A;  5D9F A;  4X3M A;  5FAI A;  4YQO A;  1UAJ A;  4XBO A;  1NS5 A;  1NXZ A;  2O3A A;  4J3C A;  4YQJ A;  3QUV A;  4YQC A;  5GMB A;  4CNE A;  4YPW A;  1ZJR A;  4YQ6 A;  4JWG A;  4IG6 A;  3GYQ A;  3ILK A;  4YQA A;  2QMM A;  1VHK A;  4MCD A;  1GZ0 A;  4JAK A;  2EGV A;  4YQ4 A;  1UAK A;  3AXZ A;  4YQ1 A;  4YQ7 A;  1P9P A;  1K3R A;  4YQN A;  4YVI A;  4CNF A;  4YPZ A;  5GMC A;  4JWF A;  2V3K A;  2I6D A;  4YQG A;  1J85 A;  4YQL A;  3IC6 A;  4E8B A;  3N4J A;  2YY8 A;  3OII A;  4MCB A;  4YQ5 A;  3AIA A;  4MCC A;  4L69 A;  1IPA A;  3BBD A;  3N4K A;  4H3Z A;  4JAL A;  3L8U A;  4YPX A;  3BBH A;  3BBE A;  1X7O A;  1MXI A;  1VH0 A;  4YQ2 A;  4CNG A;  4JWJ A;  4YQR A;  3ONP A;  4YQ8 A;  4YQK A;  3OIJ A;  1UAM A;  3DCM X;  4KGN A;  1X7P A;  4YQ3 A;  4YVG A;  1O6D A;  1OY5 A;  4YPY A;  1TO0 A;  3OIN A;  5CO4 A;  3IEF A;  2HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...