4JWFA

Crystal structure of sptrm10(74)-sah complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
Knots found
sequence length
187
structure length
187
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 61
structure length 187
sequence length 187
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jwfA00
4JWGA 4JWFA 4JWJA 4JWHA 4FMWA
chains in the Genus database with same CATH superfamily
4YQJA 3BBEA 3N4KA 3AIAA 3KTYA 3ILKA 3BBDA 4YQCA 4YQDA 5GMBA 4X3LA 4YQIA 4YVGA 4MCCA 1X7OA 4FMWA 2EGVA 4H3ZA 4YVHA 4YPXA 2O3AA 3NK6A 4YQ1A 2V3JA 1VHKA 3OIJA 3NK7A 4YQ4A 1OY5A 4CNGA 4YQGA 4IG6A 4YPWA 3KW2A 1GZ0A 3ONPA 4YQTA 1NXZA 3AI9X 1P9PA 3IEFA 5GM8A 3L8UA 3QUVA 4YQSA 4YQRA 4YVJA 4PZKA 1K3RA 3OINA 2QMMA 5GMCA 4KDZA 4YQ0A 4YQBA 2I6DA 4YQ8A 1IPAA 3O7BA 4YQKA 4JALA 4YQ3A 4JAKA 4XBOA 5D9FA 4YQPA 5FAIA 1J85A 1Z85A 4CNEA 2HA8A 1V2XA 4YQ2A 4YVIA 4JWFA 4H3YA 4CNFA 4YPZA 4J3CA 1O6DA 1UAKA 4E8BA 4JWJA 4MCBA 3GYQA 1VHYA 2EGWA 3DCMX 3BBHA 3KNUA 2Z0YA 4YQ7A 4FAKA 4YQNA 3OIIA 1ZJRA 4YQOA 1UAJA 1UALA 4YQAA 4L69A 4JWHA 2QWVA 2YY8A 4YVKA 3AXZA 4YPYA 4YQ6A 1VH0A 3E5YA 4YQQA 4MCDA 1MXIA 2CX8A 4KGNA 4X3MA 4RG1A 4YQ5A 4YQLA 5CO4A 1TO0A 4YQ9A 2V3KA 1UAMA 3KY7A 1X7PA 4CNDA 3N4JA 4JWGA 3IC6A 1V6ZA 1NS5A
chains in the Genus database with same CATH topology
4YQJA 3BBEA 3N4KA 3AIAA 3KTYA 3ILKA 3BBDA 4YQCA 4YQDA 5GMBA 4X3LA 4YQIA 4YVGA 4MCCA 1X7OA 4FMWA 2EGVA 4H3ZA 4YVHA 4YPXA 2O3AA 3NK6A 4YQ1A 2V3JA 1VHKA 3OIJA 3NK7A 4YQ4A 1OY5A 4CNGA 4YQGA 4IG6A 4YPWA 3KW2A 1GZ0A 3ONPA 4YQTA 1NXZA 3AI9X 1P9PA 3IEFA 5GM8A 3L8UA 3QUVA 4YQSA 4YQRA 4YVJA 4PZKA 1K3RA 3OINA 2QMMA 5GMCA 4KDZA 4YQ0A 4YQBA 2I6DA 4YQ8A 1IPAA 3O7BA 4YQKA 4JALA 4YQ3A 4JAKA 4XBOA 5D9FA 4YQPA 5FAIA 1J85A 1Z85A 4CNEA 2HA8A 1V2XA 4YQ2A 4YVIA 4JWFA 4H3YA 4CNFA 4YPZA 4J3CA 1O6DA 1UAKA 4E8BA 4JWJA 4MCBA 3GYQA 1VHYA 2EGWA 3DCMX 3BBHA 3KNUA 2Z0YA 4YQ7A 4FAKA 4YQNA 3OIIA 1ZJRA 4YQOA 1UAJA 1UALA 4YQAA 4L69A 4JWHA 2QWVA 2YY8A 4YVKA 3AXZA 4YPYA 4YQ6A 1VH0A 3E5YA 4YQQA 4MCDA 1MXIA 2CX8A 4KGNA 4X3MA 4RG1A 4YQ5A 4YQLA 5CO4A 1TO0A 4YQ9A 2V3KA 1UAMA 3KY7A 1X7PA 4CNDA 3N4JA 4JWGA 3IC6A 1V6ZA 1NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWG A;  4JWF A;  4JWJ A;  4JWH A;  4FMW A; 
#chains in the Genus database with same CATH topology
 4YQJ A;  3BBE A;  3N4K A;  3AIA A;  3KTY A;  3ILK A;  3BBD A;  4YQC A;  4YQD A;  5GMB A;  4X3L A;  4YQI A;  4YVG A;  4MCC A;  1X7O A;  4FMW A;  2EGV A;  4H3Z A;  4YVH A;  4YPX A;  2O3A A;  3NK6 A;  4YQ1 A;  2V3J A;  1VHK A;  3OIJ A;  3NK7 A;  4YQ4 A;  1OY5 A;  4CNG A;  4YQG A;  4IG6 A;  4YPW A;  3KW2 A;  1GZ0 A;  3ONP A;  4YQT A;  1NXZ A;  3AI9 X;  1P9P A;  3IEF A;  5GM8 A;  3L8U A;  3QUV A;  4YQS A;  4YQR A;  4YVJ A;  4PZK A;  1K3R A;  3OIN A;  2QMM A;  5GMC A;  4KDZ A;  4YQ0 A;  4YQB A;  2I6D A;  4YQ8 A;  1IPA A;  3O7B A;  4YQK A;  4JAL A;  4YQ3 A;  4JAK A;  4XBO A;  5D9F A;  4YQP A;  5FAI A;  1J85 A;  1Z85 A;  4CNE A;  2HA8 A;  1V2X A;  4YQ2 A;  4YVI A;  4JWF A;  4H3Y A;  4CNF A;  4YPZ A;  4J3C A;  1O6D A;  1UAK A;  4E8B A;  4JWJ A;  4MCB A;  3GYQ A;  1VHY A;  2EGW A;  3DCM X;  3BBH A;  3KNU A;  2Z0Y A;  4YQ7 A;  4FAK A;  4YQN A;  3OII A;  1ZJR A;  4YQO A;  1UAJ A;  1UAL A;  4YQA A;  4L69 A;  4JWH A;  2QWV A;  2YY8 A;  4YVK A;  3AXZ A;  4YPY A;  4YQ6 A;  1VH0 A;  3E5Y A;  4YQQ A;  4MCD A;  1MXI A;  2CX8 A;  4KGN A;  4X3M A;  4RG1 A;  4YQ5 A;  4YQL A;  5CO4 A;  1TO0 A;  4YQ9 A;  2V3K A;  1UAM A;  3KY7 A;  1X7P A;  4CND A;  3N4J A;  4JWG A;  3IC6 A;  1V6Z A;  1NS5 A; 
#chains in the Genus database with same CATH homology
 4YQJ A;  3BBE A;  3N4K A;  3AIA A;  3KTY A;  3ILK A;  3BBD A;  4YQC A;  4YQD A;  5GMB A;  4X3L A;  4YQI A;  4YVG A;  4MCC A;  1X7O A;  4FMW A;  2EGV A;  4H3Z A;  4YVH A;  4YPX A;  2O3A A;  3NK6 A;  4YQ1 A;  2V3J A;  1VHK A;  3OIJ A;  3NK7 A;  4YQ4 A;  1OY5 A;  4CNG A;  4YQG A;  4IG6 A;  4YPW A;  3KW2 A;  1GZ0 A;  3ONP A;  4YQT A;  1NXZ A;  3AI9 X;  1P9P A;  3IEF A;  5GM8 A;  3L8U A;  3QUV A;  4YQS A;  4YQR A;  4YVJ A;  4PZK A;  1K3R A;  3OIN A;  2QMM A;  5GMC A;  4KDZ A;  4YQ0 A;  4YQB A;  2I6D A;  4YQ8 A;  1IPA A;  3O7B A;  4YQK A;  4JAL A;  4YQ3 A;  4JAK A;  4XBO A;  5D9F A;  4YQP A;  5FAI A;  1J85 A;  1Z85 A;  4CNE A;  2HA8 A;  1V2X A;  4YQ2 A;  4YVI A;  4JWF A;  4H3Y A;  4CNF A;  4YPZ A;  4J3C A;  1O6D A;  1UAK A;  4E8B A;  4JWJ A;  4MCB A;  3GYQ A;  1VHY A;  2EGW A;  3DCM X;  3BBH A;  3KNU A;  2Z0Y A;  4YQ7 A;  4FAK A;  4YQN A;  3OII A;  1ZJR A;  4YQO A;  1UAJ A;  1UAL A;  4YQA A;  4L69 A;  4JWH A;  2QWV A;  2YY8 A;  4YVK A;  3AXZ A;  4YPY A;  4YQ6 A;  1VH0 A;  3E5Y A;  4YQQ A;  4MCD A;  1MXI A;  2CX8 A;  4KGN A;  4X3M A;  4RG1 A;  4YQ5 A;  4YQL A;  5CO4 A;  1TO0 A;  4YQ9 A;  2V3K A;  1UAM A;  3KY7 A;  1X7P A;  4CND A;  3N4J A;  4JWG A;  3IC6 A;  1V6Z A;  1NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...