4JALA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli with sah
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
Knots found
sequence length
156
structure length
156
Chain Sequence
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 48
structure length 156
sequence length 156
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jalA00
4YQQA 3BBDA 1UALA 2EGWA 4YQRA 4YQBA 4KDZA 4YQAA 3NK7A 1VHYA 1GZ0A 4CNEA 1UAKA 3DCMX 2HA8A 1NS5A 1J85A 5GMCA 3ILKA 5GMBA 4YVKA 3OIIA 1NXZA 4CNFA 1VHKA 4YQ0A 2I6DA 4CNGA 5CO4A 2V3JA 4YQOA 3IC6A 4E8BA 4YQSA 3AIAA 4YVJA 3O7BA 4YPZA 1K3RA 3NK6A 4YQGA 4MCBA 4YPWA 3AXZA 3OIJA 4CNDA 1UAJA 2O3AA 3N4JA 4X3MA 4L69A 1OY5A 4YQKA 4YQ7A 1X7OA 4YQIA 1UAMA 1P9PA 4JAKA 5FAIA 3KTYA 4KGNA 3ONPA 3BBEA 3GYQA 4YQCA 4YQPA 2YY8A 4YQ5A 4YQLA 4H3YA 4YQ1A 3KY7A 4YQ9A 4YQDA 4YQ3A 4YQTA 4YPYA 4XBOA 4MCCA 3KW2A 3KNUA 1V2XA 2Z0YA 3QUVA 1X7PA 1Z85A 2QWVA 4YQ2A 4YVIA 4JALA 1MXIA 3E5YA 4YVGA 4YQ8A 4PZKA 4J3CA 4YQ6A 2CX8A 3L8UA 1IPAA 1TO0A 4YPXA 2V3KA 3IEFA 4YQ4A 2QMMA 3OINA 4MCDA 5D9FA 1V6ZA 3BBHA 1VH0A 4X3LA 1ZJRA 2EGVA 4YVHA 4YQNA 3N4KA 4YQJA 4FAKA 4IG6A 5GM8A 1O6DA 4RG1A 4H3ZA 3AI9X
chains in the Genus database with same CATH superfamily
4YQQA 3BBDA 1UALA 2EGWA 4YQRA 4YQBA 4KDZA 4YQAA 3NK7A 1VHYA 1GZ0A 4CNEA 1UAKA 3DCMX 2HA8A 1NS5A 1J85A 5GMCA 3ILKA 5GMBA 4YVKA 3OIIA 1NXZA 4CNFA 1VHKA 4YQ0A 2I6DA 4CNGA 5CO4A 2V3JA 4YQOA 3IC6A 4E8BA 4YQSA 3AIAA 4YVJA 3O7BA 4YPZA 1K3RA 3NK6A 4YQGA 4MCBA 4YPWA 3AXZA 3OIJA 4CNDA 1UAJA 2O3AA 3N4JA 4X3MA 4JWJA 4L69A 1OY5A 4YQKA 4YQ7A 1X7OA 4YQIA 1UAMA 1P9PA 4JAKA 5FAIA 3KTYA 4KGNA 4JWGA 4FMWA 3ONPA 3BBEA 3GYQA 4YQCA 4YQPA 2YY8A 4YQ5A 4YQLA 4H3YA 4YQ1A 3KY7A 4YQ9A 4YQDA 4YQ3A 4YQTA 4YPYA 4JWHA 4XBOA 4MCCA 3KW2A 3KNUA 1V2XA 2Z0YA 3QUVA 1X7PA 1Z85A 2QWVA 4YQ2A 4YVIA 4JALA 1MXIA 3E5YA 4YVGA 4YQ8A 4PZKA 4J3CA 4YQ6A 2CX8A 4JWFA 3L8UA 1IPAA 1TO0A 4YPXA 2V3KA 3IEFA 4YQ4A 2QMMA 3OINA 4MCDA 5D9FA 1V6ZA 3BBHA 1VH0A 4X3LA 1ZJRA 2EGVA 4YVHA 4YQNA 3N4KA 4YQJA 4FAKA 4IG6A 5GM8A 1O6DA 4RG1A 4H3ZA 3AI9X
chains in the Genus database with same CATH topology
4YQQA 3BBDA 1UALA 2EGWA 4YQRA 4YQBA 4KDZA 4YQAA 3NK7A 1VHYA 1GZ0A 4CNEA 1UAKA 3DCMX 2HA8A 1NS5A 1J85A 5GMCA 3ILKA 5GMBA 4YVKA 3OIIA 1NXZA 4CNFA 1VHKA 4YQ0A 2I6DA 4CNGA 5CO4A 2V3JA 4YQOA 3IC6A 4E8BA 4YQSA 3AIAA 4YVJA 3O7BA 4YPZA 1K3RA 3NK6A 4YQGA 4MCBA 4YPWA 3AXZA 3OIJA 4CNDA 1UAJA 2O3AA 3N4JA 4X3MA 4JWJA 4L69A 1OY5A 4YQKA 4YQ7A 1X7OA 4YQIA 1UAMA 1P9PA 4JAKA 5FAIA 3KTYA 4KGNA 4JWGA 4FMWA 3ONPA 3BBEA 3GYQA 4YQCA 4YQPA 2YY8A 4YQ5A 4YQLA 4H3YA 4YQ1A 3KY7A 4YQ9A 4YQDA 4YQ3A 4YQTA 4YPYA 4JWHA 4XBOA 4MCCA 3KW2A 3KNUA 1V2XA 2Z0YA 3QUVA 1X7PA 1Z85A 2QWVA 4YQ2A 4YVIA 4JALA 1MXIA 3E5YA 4YVGA 4YQ8A 4PZKA 4J3CA 4YQ6A 2CX8A 4JWFA 3L8UA 1IPAA 1TO0A 4YPXA 2V3KA 3IEFA 4YQ4A 2QMMA 3OINA 4MCDA 5D9FA 1V6ZA 3BBHA 1VH0A 4X3LA 1ZJRA 2EGVA 4YVHA 4YQNA 3N4KA 4YQJA 4FAKA 4IG6A 5GM8A 1O6DA 4RG1A 4H3ZA 3AI9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQQ A;  3BBD A;  1UAL A;  2EGW A;  4YQR A;  4YQB A;  4KDZ A;  4YQA A;  3NK7 A;  1VHY A;  1GZ0 A;  4CNE A;  1UAK A;  3DCM X;  2HA8 A;  1NS5 A;  1J85 A;  5GMC A;  3ILK A;  5GMB A;  4YVK A;  3OII A;  1NXZ A;  4CNF A;  1VHK A;  4YQ0 A;  2I6D A;  4CNG A;  5CO4 A;  2V3J A;  4YQO A;  3IC6 A;  4E8B A;  4YQS A;  3AIA A;  4YVJ A;  3O7B A;  4YPZ A;  1K3R A;  3NK6 A;  4YQG A;  4MCB A;  4YPW A;  3AXZ A;  3OIJ A;  4CND A;  1UAJ A;  2O3A A;  3N4J A;  4X3M A;  4L69 A;  1OY5 A;  4YQK A;  4YQ7 A;  1X7O A;  4YQI A;  1UAM A;  1P9P A;  4JAK A;  5FAI A;  3KTY A;  4KGN A;  3ONP A;  3BBE A;  3GYQ A;  4YQC A;  4YQP A;  2YY8 A;  4YQ5 A;  4YQL A;  4H3Y A;  4YQ1 A;  3KY7 A;  4YQ9 A;  4YQD A;  4YQ3 A;  4YQT A;  4YPY A;  4XBO A;  4MCC A;  3KW2 A;  3KNU A;  1V2X A;  2Z0Y A;  3QUV A;  1X7P A;  1Z85 A;  2QWV A;  4YQ2 A;  4YVI A;  4JAL A;  1MXI A;  3E5Y A;  4YVG A;  4YQ8 A;  4PZK A;  4J3C A;  4YQ6 A;  2CX8 A;  3L8U A;  1IPA A;  1TO0 A;  4YPX A;  2V3K A;  3IEF A;  4YQ4 A;  2QMM A;  3OIN A;  4MCD A;  5D9F A;  1V6Z A;  3BBH A;  1VH0 A;  4X3L A;  1ZJR A;  2EGV A;  4YVH A;  4YQN A;  3N4K A;  4YQJ A;  4FAK A;  4IG6 A;  5GM8 A;  1O6D A;  4RG1 A;  4H3Z A;  3AI9 X; 
#chains in the Genus database with same CATH topology
 4YQQ A;  3BBD A;  1UAL A;  2EGW A;  4YQR A;  4YQB A;  4KDZ A;  4YQA A;  3NK7 A;  1VHY A;  1GZ0 A;  4CNE A;  1UAK A;  3DCM X;  2HA8 A;  1NS5 A;  1J85 A;  5GMC A;  3ILK A;  5GMB A;  4YVK A;  3OII A;  1NXZ A;  4CNF A;  1VHK A;  4YQ0 A;  2I6D A;  4CNG A;  5CO4 A;  2V3J A;  4YQO A;  3IC6 A;  4E8B A;  4YQS A;  3AIA A;  4YVJ A;  3O7B A;  4YPZ A;  1K3R A;  3NK6 A;  4YQG A;  4MCB A;  4YPW A;  3AXZ A;  3OIJ A;  4CND A;  1UAJ A;  2O3A A;  3N4J A;  4X3M A;  4JWJ A;  4L69 A;  1OY5 A;  4YQK A;  4YQ7 A;  1X7O A;  4YQI A;  1UAM A;  1P9P A;  4JAK A;  5FAI A;  3KTY A;  4KGN A;  4JWG A;  4FMW A;  3ONP A;  3BBE A;  3GYQ A;  4YQC A;  4YQP A;  2YY8 A;  4YQ5 A;  4YQL A;  4H3Y A;  4YQ1 A;  3KY7 A;  4YQ9 A;  4YQD A;  4YQ3 A;  4YQT A;  4YPY A;  4JWH A;  4XBO A;  4MCC A;  3KW2 A;  3KNU A;  1V2X A;  2Z0Y A;  3QUV A;  1X7P A;  1Z85 A;  2QWV A;  4YQ2 A;  4YVI A;  4JAL A;  1MXI A;  3E5Y A;  4YVG A;  4YQ8 A;  4PZK A;  4J3C A;  4YQ6 A;  2CX8 A;  4JWF A;  3L8U A;  1IPA A;  1TO0 A;  4YPX A;  2V3K A;  3IEF A;  4YQ4 A;  2QMM A;  3OIN A;  4MCD A;  5D9F A;  1V6Z A;  3BBH A;  1VH0 A;  4X3L A;  1ZJR A;  2EGV A;  4YVH A;  4YQN A;  3N4K A;  4YQJ A;  4FAK A;  4IG6 A;  5GM8 A;  1O6D A;  4RG1 A;  4H3Z A;  3AI9 X; 
#chains in the Genus database with same CATH homology
 4YQQ A;  3BBD A;  1UAL A;  2EGW A;  4YQR A;  4YQB A;  4KDZ A;  4YQA A;  3NK7 A;  1VHY A;  1GZ0 A;  4CNE A;  1UAK A;  3DCM X;  2HA8 A;  1NS5 A;  1J85 A;  5GMC A;  3ILK A;  5GMB A;  4YVK A;  3OII A;  1NXZ A;  4CNF A;  1VHK A;  4YQ0 A;  2I6D A;  4CNG A;  5CO4 A;  2V3J A;  4YQO A;  3IC6 A;  4E8B A;  4YQS A;  3AIA A;  4YVJ A;  3O7B A;  4YPZ A;  1K3R A;  3NK6 A;  4YQG A;  4MCB A;  4YPW A;  3AXZ A;  3OIJ A;  4CND A;  1UAJ A;  2O3A A;  3N4J A;  4X3M A;  4JWJ A;  4L69 A;  1OY5 A;  4YQK A;  4YQ7 A;  1X7O A;  4YQI A;  1UAM A;  1P9P A;  4JAK A;  5FAI A;  3KTY A;  4KGN A;  4JWG A;  4FMW A;  3ONP A;  3BBE A;  3GYQ A;  4YQC A;  4YQP A;  2YY8 A;  4YQ5 A;  4YQL A;  4H3Y A;  4YQ1 A;  3KY7 A;  4YQ9 A;  4YQD A;  4YQ3 A;  4YQT A;  4YPY A;  4JWH A;  4XBO A;  4MCC A;  3KW2 A;  3KNU A;  1V2X A;  2Z0Y A;  3QUV A;  1X7P A;  1Z85 A;  2QWV A;  4YQ2 A;  4YVI A;  4JAL A;  1MXI A;  3E5Y A;  4YVG A;  4YQ8 A;  4PZK A;  4J3C A;  4YQ6 A;  2CX8 A;  4JWF A;  3L8U A;  1IPA A;  1TO0 A;  4YPX A;  2V3K A;  3IEF A;  4YQ4 A;  2QMM A;  3OIN A;  4MCD A;  5D9F A;  1V6Z A;  3BBH A;  1VH0 A;  4X3L A;  1ZJR A;  2EGV A;  4YVH A;  4YQN A;  3N4K A;  4YQJ A;  4FAK A;  4IG6 A;  5GM8 A;  1O6D A;  4RG1 A;  4H3Z A;  3AI9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...