4JALA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli with sah
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
Knots found
sequence length
156
structure length
156
Chain Sequence
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 156
sequence length 156
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jalA00
1K3RA 4YPXA 4YQKA 4YQOA 4YQNA 1VHYA 2I6DA 4YQ7A 5GM8A 2V3JA 1V6ZA 4YQ4A 4YVIA 3N4JA 4YQCA 3AXZA 5GMBA 2CX8A 1UAMA 4YQPA 4JALA 4YQ0A 4YQGA 2EGVA 4PZKA 5FAIA 5GMCA 2HA8A 1TO0A 4H3YA 4FAKA 4YQAA 4YQJA 1ZJRA 4YQIA 1J85A 4J3CA 4YQ1A 2YY8A 4YQRA 3GYQA 4MCDA 4YQSA 3KTYA 4CNFA 1VHKA 4IG6A 2V3KA 4MCCA 4YVJA 3KW2A 4YQTA 4YQ2A 3AI9X 3IEFA 4RG1A 5CO4A 4CNGA 4YQ6A 3L8UA 4MCBA 4KGNA 4YVKA 4JAKA 1X7PA 1IPAA 3N4KA 2QWVA 2EGWA 4YPWA 4YQQA 1VH0A 1GZ0A 3O7BA 3OIIA 3OINA 3E5YA 1P9PA 3BBDA 4X3MA 2O3AA 1O6DA 3DCMX 4YVGA 4YQLA 4X3LA 3KY7A 4H3ZA 1X7OA 3AIAA 4L69A 3NK6A 4KDZA 4YQ3A 4YPYA 1UALA 4CNDA 4YVHA 4E8BA 1UAKA 3IC6A 1UAJA 3ILKA 3QUVA 4YQ8A 4YPZA 4XBOA 4CNEA 1NS5A 3KNUA 1NXZA 4YQ5A 1OY5A 4YQ9A 4YQDA 2QMMA 2Z0YA 3ONPA 1V2XA 1MXIA 3OIJA 4YQBA 3BBHA 1Z85A 5D9FA 3BBEA 3NK7A
chains in the Genus database with same CATH superfamily
4JWHA 1K3RA 4YPXA 4YQKA 4YQOA 4YQNA 1VHYA 2I6DA 4YQ7A 5GM8A 2V3JA 1V6ZA 4YQ4A 4YVIA 3N4JA 4YQCA 3AXZA 5GMBA 2CX8A 1UAMA 4YQPA 4JALA 4YQ0A 4JWGA 4YQGA 2EGVA 4PZKA 5FAIA 5GMCA 2HA8A 1TO0A 4H3YA 4FAKA 4YQAA 4YQJA 1ZJRA 4YQIA 1J85A 4J3CA 4YQ1A 4JWFA 4FMWA 2YY8A 4YQRA 3GYQA 4MCDA 4YQSA 3KTYA 4CNFA 1VHKA 4IG6A 2V3KA 4MCCA 4YVJA 3KW2A 4YQTA 4YQ2A 3AI9X 3IEFA 4RG1A 5CO4A 4CNGA 4YQ6A 3L8UA 4MCBA 4KGNA 4YVKA 4JAKA 1X7PA 1IPAA 3N4KA 2QWVA 2EGWA 4YPWA 4YQQA 1VH0A 1GZ0A 3O7BA 3OIIA 3OINA 3E5YA 1P9PA 3BBDA 4X3MA 2O3AA 1O6DA 3DCMX 4YVGA 4YQLA 4X3LA 3KY7A 4H3ZA 1X7OA 3AIAA 4L69A 3NK6A 4KDZA 4YQ3A 4YPYA 1UALA 4CNDA 4YVHA 4E8BA 1UAKA 3IC6A 1UAJA 3ILKA 3QUVA 4YQ8A 4YPZA 4XBOA 4CNEA 1NS5A 3KNUA 1NXZA 4YQ5A 1OY5A 4YQ9A 4YQDA 2QMMA 2Z0YA 3ONPA 1V2XA 1MXIA 3OIJA 4YQBA 3BBHA 1Z85A 4JWJA 5D9FA 3BBEA 3NK7A
chains in the Genus database with same CATH topology
4JWHA 1K3RA 4YPXA 4YQKA 4YQOA 4YQNA 1VHYA 2I6DA 4YQ7A 5GM8A 2V3JA 1V6ZA 4YQ4A 4YVIA 3N4JA 4YQCA 3AXZA 5GMBA 2CX8A 1UAMA 4YQPA 4JALA 4YQ0A 4JWGA 4YQGA 2EGVA 4PZKA 5FAIA 5GMCA 2HA8A 1TO0A 4H3YA 4FAKA 4YQAA 4YQJA 1ZJRA 4YQIA 1J85A 4J3CA 4YQ1A 4JWFA 4FMWA 2YY8A 4YQRA 3GYQA 4MCDA 4YQSA 3KTYA 4CNFA 1VHKA 4IG6A 2V3KA 4MCCA 4YVJA 3KW2A 4YQTA 4YQ2A 3AI9X 3IEFA 4RG1A 5CO4A 4CNGA 4YQ6A 3L8UA 4MCBA 4KGNA 4YVKA 4JAKA 1X7PA 1IPAA 3N4KA 2QWVA 2EGWA 4YPWA 4YQQA 1VH0A 1GZ0A 3O7BA 3OIIA 3OINA 3E5YA 1P9PA 3BBDA 4X3MA 2O3AA 1O6DA 3DCMX 4YVGA 4YQLA 4X3LA 3KY7A 4H3ZA 1X7OA 3AIAA 4L69A 3NK6A 4KDZA 4YQ3A 4YPYA 1UALA 4CNDA 4YVHA 4E8BA 1UAKA 3IC6A 1UAJA 3ILKA 3QUVA 4YQ8A 4YPZA 4XBOA 4CNEA 1NS5A 3KNUA 1NXZA 4YQ5A 1OY5A 4YQ9A 4YQDA 2QMMA 2Z0YA 3ONPA 1V2XA 1MXIA 3OIJA 4YQBA 3BBHA 1Z85A 4JWJA 5D9FA 3BBEA 3NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  4YPX A;  4YQK A;  4YQO A;  4YQN A;  1VHY A;  2I6D A;  4YQ7 A;  5GM8 A;  2V3J A;  1V6Z A;  4YQ4 A;  4YVI A;  3N4J A;  4YQC A;  3AXZ A;  5GMB A;  2CX8 A;  1UAM A;  4YQP A;  4JAL A;  4YQ0 A;  4YQG A;  2EGV A;  4PZK A;  5FAI A;  5GMC A;  2HA8 A;  1TO0 A;  4H3Y A;  4FAK A;  4YQA A;  4YQJ A;  1ZJR A;  4YQI A;  1J85 A;  4J3C A;  4YQ1 A;  2YY8 A;  4YQR A;  3GYQ A;  4MCD A;  4YQS A;  3KTY A;  4CNF A;  1VHK A;  4IG6 A;  2V3K A;  4MCC A;  4YVJ A;  3KW2 A;  4YQT A;  4YQ2 A;  3AI9 X;  3IEF A;  4RG1 A;  5CO4 A;  4CNG A;  4YQ6 A;  3L8U A;  4MCB A;  4KGN A;  4YVK A;  4JAK A;  1X7P A;  1IPA A;  3N4K A;  2QWV A;  2EGW A;  4YPW A;  4YQQ A;  1VH0 A;  1GZ0 A;  3O7B A;  3OII A;  3OIN A;  3E5Y A;  1P9P A;  3BBD A;  4X3M A;  2O3A A;  1O6D A;  3DCM X;  4YVG A;  4YQL A;  4X3L A;  3KY7 A;  4H3Z A;  1X7O A;  3AIA A;  4L69 A;  3NK6 A;  4KDZ A;  4YQ3 A;  4YPY A;  1UAL A;  4CND A;  4YVH A;  4E8B A;  1UAK A;  3IC6 A;  1UAJ A;  3ILK A;  3QUV A;  4YQ8 A;  4YPZ A;  4XBO A;  4CNE A;  1NS5 A;  3KNU A;  1NXZ A;  4YQ5 A;  1OY5 A;  4YQ9 A;  4YQD A;  2QMM A;  2Z0Y A;  3ONP A;  1V2X A;  1MXI A;  3OIJ A;  4YQB A;  3BBH A;  1Z85 A;  5D9F A;  3BBE A;  3NK7 A; 
#chains in the Genus database with same CATH topology
 4JWH A;  1K3R A;  4YPX A;  4YQK A;  4YQO A;  4YQN A;  1VHY A;  2I6D A;  4YQ7 A;  5GM8 A;  2V3J A;  1V6Z A;  4YQ4 A;  4YVI A;  3N4J A;  4YQC A;  3AXZ A;  5GMB A;  2CX8 A;  1UAM A;  4YQP A;  4JAL A;  4YQ0 A;  4JWG A;  4YQG A;  2EGV A;  4PZK A;  5FAI A;  5GMC A;  2HA8 A;  1TO0 A;  4H3Y A;  4FAK A;  4YQA A;  4YQJ A;  1ZJR A;  4YQI A;  1J85 A;  4J3C A;  4YQ1 A;  4JWF A;  4FMW A;  2YY8 A;  4YQR A;  3GYQ A;  4MCD A;  4YQS A;  3KTY A;  4CNF A;  1VHK A;  4IG6 A;  2V3K A;  4MCC A;  4YVJ A;  3KW2 A;  4YQT A;  4YQ2 A;  3AI9 X;  3IEF A;  4RG1 A;  5CO4 A;  4CNG A;  4YQ6 A;  3L8U A;  4MCB A;  4KGN A;  4YVK A;  4JAK A;  1X7P A;  1IPA A;  3N4K A;  2QWV A;  2EGW A;  4YPW A;  4YQQ A;  1VH0 A;  1GZ0 A;  3O7B A;  3OII A;  3OIN A;  3E5Y A;  1P9P A;  3BBD A;  4X3M A;  2O3A A;  1O6D A;  3DCM X;  4YVG A;  4YQL A;  4X3L A;  3KY7 A;  4H3Z A;  1X7O A;  3AIA A;  4L69 A;  3NK6 A;  4KDZ A;  4YQ3 A;  4YPY A;  1UAL A;  4CND A;  4YVH A;  4E8B A;  1UAK A;  3IC6 A;  1UAJ A;  3ILK A;  3QUV A;  4YQ8 A;  4YPZ A;  4XBO A;  4CNE A;  1NS5 A;  3KNU A;  1NXZ A;  4YQ5 A;  1OY5 A;  4YQ9 A;  4YQD A;  2QMM A;  2Z0Y A;  3ONP A;  1V2X A;  1MXI A;  3OIJ A;  4YQB A;  3BBH A;  1Z85 A;  4JWJ A;  5D9F A;  3BBE A;  3NK7 A; 
#chains in the Genus database with same CATH homology
 4JWH A;  1K3R A;  4YPX A;  4YQK A;  4YQO A;  4YQN A;  1VHY A;  2I6D A;  4YQ7 A;  5GM8 A;  2V3J A;  1V6Z A;  4YQ4 A;  4YVI A;  3N4J A;  4YQC A;  3AXZ A;  5GMB A;  2CX8 A;  1UAM A;  4YQP A;  4JAL A;  4YQ0 A;  4JWG A;  4YQG A;  2EGV A;  4PZK A;  5FAI A;  5GMC A;  2HA8 A;  1TO0 A;  4H3Y A;  4FAK A;  4YQA A;  4YQJ A;  1ZJR A;  4YQI A;  1J85 A;  4J3C A;  4YQ1 A;  4JWF A;  4FMW A;  2YY8 A;  4YQR A;  3GYQ A;  4MCD A;  4YQS A;  3KTY A;  4CNF A;  1VHK A;  4IG6 A;  2V3K A;  4MCC A;  4YVJ A;  3KW2 A;  4YQT A;  4YQ2 A;  3AI9 X;  3IEF A;  4RG1 A;  5CO4 A;  4CNG A;  4YQ6 A;  3L8U A;  4MCB A;  4KGN A;  4YVK A;  4JAK A;  1X7P A;  1IPA A;  3N4K A;  2QWV A;  2EGW A;  4YPW A;  4YQQ A;  1VH0 A;  1GZ0 A;  3O7B A;  3OII A;  3OIN A;  3E5Y A;  1P9P A;  3BBD A;  4X3M A;  2O3A A;  1O6D A;  3DCM X;  4YVG A;  4YQL A;  4X3L A;  3KY7 A;  4H3Z A;  1X7O A;  3AIA A;  4L69 A;  3NK6 A;  4KDZ A;  4YQ3 A;  4YPY A;  1UAL A;  4CND A;  4YVH A;  4E8B A;  1UAK A;  3IC6 A;  1UAJ A;  3ILK A;  3QUV A;  4YQ8 A;  4YPZ A;  4XBO A;  4CNE A;  1NS5 A;  3KNU A;  1NXZ A;  4YQ5 A;  1OY5 A;  4YQ9 A;  4YQD A;  2QMM A;  2Z0Y A;  3ONP A;  1V2X A;  1MXI A;  3OIJ A;  4YQB A;  3BBH A;  1Z85 A;  4JWJ A;  5D9F A;  3BBE A;  3NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...