4JALA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli with sah
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
Knots found
sequence length
156
structure length
156
Chain Sequence
b'MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 48
structure length 156
sequence length 156
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jalA00
5CO4A 1UALA 3NK7A 4X3LA 4YVJA 4MCCA 3KW2A 4JAKA 4YQGA 4CNFA 1VHYA 3AI9X 3NK6A 4YVGA 4YQIA 4PZKA 3N4KA 2QMMA 4YVIA 1TO0A 4YQ1A 3OINA 3ONPA 3ILKA 4YQ3A 3OIJA 4YQ9A 4YQAA 1NS5A 2V3KA 1UAKA 1J85A 4CNEA 1Z85A 4MCDA 4YPZA 5FAIA 3E5YA 3AXZA 3OIIA 4YQOA 4RG1A 2Z0YA 3BBEA 4YQ8A 1VH0A 4YQTA 1IPAA 4YQJA 2EGVA 1GZ0A 3AIAA 4YVHA 5GMBA 3KY7A 4KGNA 5GMCA 4YQLA 4FAKA 2QWVA 3DCMX 4YQDA 4YQKA 4YQ7A 1O6DA 1V2XA 5GM8A 4YQBA 2I6DA 3IEFA 3L8UA 4H3ZA 1NXZA 4H3YA 4CNDA 2CX8A 4J3CA 5D9FA 3GYQA 4YQ4A 2EGWA 2O3AA 4E8BA 1OY5A 1X7PA 1UAJA 4YQSA 3QUVA 2V3JA 4YQ5A 3O7BA 1K3RA 4CNGA 4MCBA 1X7OA 1P9PA 4YVKA 4YPYA 4XBOA 4YQCA 4JALA 3IC6A 4L69A 3KNUA 4YQQA 4YQPA 4YQ6A 1V6ZA 1ZJRA 4YQ0A 4IG6A 4YQNA 4YPWA 3KTYA 1MXIA 4YQRA 2HA8A 1UAMA 3BBHA 4YPXA 3BBDA 1VHKA 2YY8A 3N4JA 4X3MA 4KDZA 4YQ2A
chains in the Genus database with same CATH superfamily
5CO4A 1UALA 3NK7A 4X3LA 4YVJA 4MCCA 3KW2A 4JAKA 4YQGA 4CNFA 1VHYA 3AI9X 3NK6A 4YVGA 4YQIA 4PZKA 3N4KA 2QMMA 4YVIA 1TO0A 4JWJA 4YQ1A 3OINA 3ONPA 3ILKA 4YQ3A 3OIJA 4YQ9A 4YQAA 1NS5A 2V3KA 4JWFA 1UAKA 1J85A 4CNEA 1Z85A 4MCDA 4YPZA 5FAIA 3E5YA 3AXZA 3OIIA 4YQOA 4RG1A 4FMWA 2Z0YA 3BBEA 4YQ8A 1VH0A 4YQTA 1IPAA 4YQJA 2EGVA 1GZ0A 3AIAA 4YVHA 5GMBA 3KY7A 4KGNA 5GMCA 4YQLA 4FAKA 2QWVA 3DCMX 4YQDA 4YQKA 4YQ7A 1O6DA 1V2XA 5GM8A 4YQBA 2I6DA 3IEFA 4JWHA 3L8UA 4H3ZA 1NXZA 4H3YA 4CNDA 2CX8A 4J3CA 5D9FA 3GYQA 4YQ4A 2EGWA 2O3AA 4E8BA 1OY5A 1X7PA 1UAJA 4YQSA 3QUVA 2V3JA 4YQ5A 3O7BA 1K3RA 4CNGA 4MCBA 1X7OA 1P9PA 4YVKA 4YPYA 4XBOA 4YQCA 4JALA 3IC6A 4L69A 3KNUA 4YQQA 4YQPA 4YQ6A 1V6ZA 1ZJRA 4YQ0A 4IG6A 4YQNA 4YPWA 3KTYA 1MXIA 4YQRA 4JWGA 2HA8A 1UAMA 3BBHA 4YPXA 3BBDA 1VHKA 2YY8A 3N4JA 4X3MA 4KDZA 4YQ2A
chains in the Genus database with same CATH topology
5CO4A 1UALA 3NK7A 4X3LA 4YVJA 4MCCA 3KW2A 4JAKA 4YQGA 4CNFA 1VHYA 3AI9X 3NK6A 4YVGA 4YQIA 4PZKA 3N4KA 2QMMA 4YVIA 1TO0A 4JWJA 4YQ1A 3OINA 3ONPA 3ILKA 4YQ3A 3OIJA 4YQ9A 4YQAA 1NS5A 2V3KA 4JWFA 1UAKA 1J85A 4CNEA 1Z85A 4MCDA 4YPZA 5FAIA 3E5YA 3AXZA 3OIIA 4YQOA 4RG1A 4FMWA 2Z0YA 3BBEA 4YQ8A 1VH0A 4YQTA 1IPAA 4YQJA 2EGVA 1GZ0A 3AIAA 4YVHA 5GMBA 3KY7A 4KGNA 5GMCA 4YQLA 4FAKA 2QWVA 3DCMX 4YQDA 4YQKA 4YQ7A 1O6DA 1V2XA 5GM8A 4YQBA 2I6DA 3IEFA 4JWHA 3L8UA 4H3ZA 1NXZA 4H3YA 4CNDA 2CX8A 4J3CA 5D9FA 3GYQA 4YQ4A 2EGWA 2O3AA 4E8BA 1OY5A 1X7PA 1UAJA 4YQSA 3QUVA 2V3JA 4YQ5A 3O7BA 1K3RA 4CNGA 4MCBA 1X7OA 1P9PA 4YVKA 4YPYA 4XBOA 4YQCA 4JALA 3IC6A 4L69A 3KNUA 4YQQA 4YQPA 4YQ6A 1V6ZA 1ZJRA 4YQ0A 4IG6A 4YQNA 4YPWA 3KTYA 1MXIA 4YQRA 4JWGA 2HA8A 1UAMA 3BBHA 4YPXA 3BBDA 1VHKA 2YY8A 3N4JA 4X3MA 4KDZA 4YQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO4 A;  1UAL A;  3NK7 A;  4X3L A;  4YVJ A;  4MCC A;  3KW2 A;  4JAK A;  4YQG A;  4CNF A;  1VHY A;  3AI9 X;  3NK6 A;  4YVG A;  4YQI A;  4PZK A;  3N4K A;  2QMM A;  4YVI A;  1TO0 A;  4YQ1 A;  3OIN A;  3ONP A;  3ILK A;  4YQ3 A;  3OIJ A;  4YQ9 A;  4YQA A;  1NS5 A;  2V3K A;  1UAK A;  1J85 A;  4CNE A;  1Z85 A;  4MCD A;  4YPZ A;  5FAI A;  3E5Y A;  3AXZ A;  3OII A;  4YQO A;  4RG1 A;  2Z0Y A;  3BBE A;  4YQ8 A;  1VH0 A;  4YQT A;  1IPA A;  4YQJ A;  2EGV A;  1GZ0 A;  3AIA A;  4YVH A;  5GMB A;  3KY7 A;  4KGN A;  5GMC A;  4YQL A;  4FAK A;  2QWV A;  3DCM X;  4YQD A;  4YQK A;  4YQ7 A;  1O6D A;  1V2X A;  5GM8 A;  4YQB A;  2I6D A;  3IEF A;  3L8U A;  4H3Z A;  1NXZ A;  4H3Y A;  4CND A;  2CX8 A;  4J3C A;  5D9F A;  3GYQ A;  4YQ4 A;  2EGW A;  2O3A A;  4E8B A;  1OY5 A;  1X7P A;  1UAJ A;  4YQS A;  3QUV A;  2V3J A;  4YQ5 A;  3O7B A;  1K3R A;  4CNG A;  4MCB A;  1X7O A;  1P9P A;  4YVK A;  4YPY A;  4XBO A;  4YQC A;  4JAL A;  3IC6 A;  4L69 A;  3KNU A;  4YQQ A;  4YQP A;  4YQ6 A;  1V6Z A;  1ZJR A;  4YQ0 A;  4IG6 A;  4YQN A;  4YPW A;  3KTY A;  1MXI A;  4YQR A;  2HA8 A;  1UAM A;  3BBH A;  4YPX A;  3BBD A;  1VHK A;  2YY8 A;  3N4J A;  4X3M A;  4KDZ A;  4YQ2 A; 
#chains in the Genus database with same CATH topology
 5CO4 A;  1UAL A;  3NK7 A;  4X3L A;  4YVJ A;  4MCC A;  3KW2 A;  4JAK A;  4YQG A;  4CNF A;  1VHY A;  3AI9 X;  3NK6 A;  4YVG A;  4YQI A;  4PZK A;  3N4K A;  2QMM A;  4YVI A;  1TO0 A;  4JWJ A;  4YQ1 A;  3OIN A;  3ONP A;  3ILK A;  4YQ3 A;  3OIJ A;  4YQ9 A;  4YQA A;  1NS5 A;  2V3K A;  4JWF A;  1UAK A;  1J85 A;  4CNE A;  1Z85 A;  4MCD A;  4YPZ A;  5FAI A;  3E5Y A;  3AXZ A;  3OII A;  4YQO A;  4RG1 A;  4FMW A;  2Z0Y A;  3BBE A;  4YQ8 A;  1VH0 A;  4YQT A;  1IPA A;  4YQJ A;  2EGV A;  1GZ0 A;  3AIA A;  4YVH A;  5GMB A;  3KY7 A;  4KGN A;  5GMC A;  4YQL A;  4FAK A;  2QWV A;  3DCM X;  4YQD A;  4YQK A;  4YQ7 A;  1O6D A;  1V2X A;  5GM8 A;  4YQB A;  2I6D A;  3IEF A;  4JWH A;  3L8U A;  4H3Z A;  1NXZ A;  4H3Y A;  4CND A;  2CX8 A;  4J3C A;  5D9F A;  3GYQ A;  4YQ4 A;  2EGW A;  2O3A A;  4E8B A;  1OY5 A;  1X7P A;  1UAJ A;  4YQS A;  3QUV A;  2V3J A;  4YQ5 A;  3O7B A;  1K3R A;  4CNG A;  4MCB A;  1X7O A;  1P9P A;  4YVK A;  4YPY A;  4XBO A;  4YQC A;  4JAL A;  3IC6 A;  4L69 A;  3KNU A;  4YQQ A;  4YQP A;  4YQ6 A;  1V6Z A;  1ZJR A;  4YQ0 A;  4IG6 A;  4YQN A;  4YPW A;  3KTY A;  1MXI A;  4YQR A;  4JWG A;  2HA8 A;  1UAM A;  3BBH A;  4YPX A;  3BBD A;  1VHK A;  2YY8 A;  3N4J A;  4X3M A;  4KDZ A;  4YQ2 A; 
#chains in the Genus database with same CATH homology
 5CO4 A;  1UAL A;  3NK7 A;  4X3L A;  4YVJ A;  4MCC A;  3KW2 A;  4JAK A;  4YQG A;  4CNF A;  1VHY A;  3AI9 X;  3NK6 A;  4YVG A;  4YQI A;  4PZK A;  3N4K A;  2QMM A;  4YVI A;  1TO0 A;  4JWJ A;  4YQ1 A;  3OIN A;  3ONP A;  3ILK A;  4YQ3 A;  3OIJ A;  4YQ9 A;  4YQA A;  1NS5 A;  2V3K A;  4JWF A;  1UAK A;  1J85 A;  4CNE A;  1Z85 A;  4MCD A;  4YPZ A;  5FAI A;  3E5Y A;  3AXZ A;  3OII A;  4YQO A;  4RG1 A;  4FMW A;  2Z0Y A;  3BBE A;  4YQ8 A;  1VH0 A;  4YQT A;  1IPA A;  4YQJ A;  2EGV A;  1GZ0 A;  3AIA A;  4YVH A;  5GMB A;  3KY7 A;  4KGN A;  5GMC A;  4YQL A;  4FAK A;  2QWV A;  3DCM X;  4YQD A;  4YQK A;  4YQ7 A;  1O6D A;  1V2X A;  5GM8 A;  4YQB A;  2I6D A;  3IEF A;  4JWH A;  3L8U A;  4H3Z A;  1NXZ A;  4H3Y A;  4CND A;  2CX8 A;  4J3C A;  5D9F A;  3GYQ A;  4YQ4 A;  2EGW A;  2O3A A;  4E8B A;  1OY5 A;  1X7P A;  1UAJ A;  4YQS A;  3QUV A;  2V3J A;  4YQ5 A;  3O7B A;  1K3R A;  4CNG A;  4MCB A;  1X7O A;  1P9P A;  4YVK A;  4YPY A;  4XBO A;  4YQC A;  4JAL A;  3IC6 A;  4L69 A;  3KNU A;  4YQQ A;  4YQP A;  4YQ6 A;  1V6Z A;  1ZJR A;  4YQ0 A;  4IG6 A;  4YQN A;  4YPW A;  3KTY A;  1MXI A;  4YQR A;  4JWG A;  2HA8 A;  1UAM A;  3BBH A;  4YPX A;  3BBD A;  1VHK A;  2YY8 A;  3N4J A;  4X3M A;  4KDZ A;  4YQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...