3BBDA

M. jannaschii nep1 complexed with s-adenosyl-homocysteine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
Knots found
sequence length
204
structure length
204
Chain Sequence
TYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosome biogenesis protein NEP1-like
publication title The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 64
structure length 204
sequence length 204
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3bbdA00
4YPXA 4YQOA 1UAMA 1P9PA 4JAKA 4YQ1A 3ONPA 4YQ3A 2CX8A 1UAKA 4X3LA 4JALA 4YVHA 1MXIA 4MCCA 4YQNA 3E5YA 4YQ0A 4CNGA 1X7PA 4YPZA 4YQ9A 3NK7A 5FAIA 1VHKA 4YQ8A 3NK6A 4YQLA 1V2XA 1IPAA 1GZ0A 2V3KA 3OIIA 4FAKA 3GYQA 4YPYA 3OINA 1NS5A 4YQDA 3ILKA 4YQ7A 2YY8A 4YQTA 4YQKA 3KTYA 2QWVA 1K3RA 2O3AA 3AIAA 4IG6A 4XBOA 2EGWA 1NXZA 3BBEA 4YQ6A 3L8UA 3IEFA 3KNUA 1ZJRA 4YQ2A 4MCDA 4E8BA 5GM8A 1VHYA 3BBDA 2Z0YA 3N4JA 4YQSA 4MCBA 4X3MA 3BBHA 4CNDA 4PZKA 4YVJA 4YQIA 4J3CA 1UALA 5GMBA 4YQBA 4YQGA 4CNEA 1VH0A 3N4KA 4YQRA 3OIJA 4YQJA 4H3YA 2HA8A 4YQQA 4YQ5A 1UAJA 3DCMX 4YVGA 4H3ZA 3KW2A 3QUVA 2I6DA 4YPWA 2V3JA 1X7OA 4YQ4A 3KY7A 5GMCA 4YQAA 1V6ZA 1TO0A 1J85A 4YVKA 1OY5A 1O6DA 2EGVA 1Z85A 4RG1A 5CO4A 3AI9X 4KGNA 4L69A 2QMMA 4YQCA 3O7BA 5D9FA 4CNFA 4YVIA 3AXZA 4KDZA 3IC6A 4YQPA
chains in the Genus database with same CATH superfamily
4YPXA 4YQOA 1UAMA 1P9PA 4JAKA 4YQ1A 3ONPA 4YQ3A 2CX8A 4JWGA 1UAKA 4X3LA 4JALA 4YVHA 1MXIA 4MCCA 4YQNA 3E5YA 4YQ0A 4CNGA 1X7PA 4YPZA 4YQ9A 3NK7A 5FAIA 1VHKA 4YQ8A 3NK6A 4YQLA 1V2XA 1IPAA 1GZ0A 2V3KA 3OIIA 4FAKA 3GYQA 4YPYA 3OINA 1NS5A 4YQDA 3ILKA 4YQ7A 2YY8A 4YQTA 4YQKA 3KTYA 2QWVA 1K3RA 2O3AA 3AIAA 4IG6A 4XBOA 2EGWA 1NXZA 3BBEA 4YQ6A 3L8UA 3IEFA 3KNUA 1ZJRA 4FMWA 4YQ2A 4MCDA 4E8BA 5GM8A 1VHYA 3BBDA 2Z0YA 3N4JA 4YQSA 4MCBA 4X3MA 3BBHA 4CNDA 4PZKA 4YVJA 4YQIA 4J3CA 1UALA 5GMBA 4YQBA 4YQGA 4CNEA 1VH0A 3N4KA 4YQRA 3OIJA 4YQJA 4H3YA 2HA8A 4YQQA 4YQ5A 1UAJA 3DCMX 4YVGA 4H3ZA 3KW2A 4JWFA 3QUVA 2I6DA 4YPWA 2V3JA 1X7OA 4YQ4A 3KY7A 5GMCA 4YQAA 1V6ZA 1TO0A 1J85A 4YVKA 1OY5A 1O6DA 2EGVA 1Z85A 4JWHA 4RG1A 5CO4A 3AI9X 4KGNA 4L69A 2QMMA 4YQCA 3O7BA 5D9FA 4CNFA 4YVIA 3AXZA 4JWJA 4KDZA 3IC6A 4YQPA
chains in the Genus database with same CATH topology
4YPXA 4YQOA 1UAMA 1P9PA 4JAKA 4YQ1A 3ONPA 4YQ3A 2CX8A 4JWGA 1UAKA 4X3LA 4JALA 4YVHA 1MXIA 4MCCA 4YQNA 3E5YA 4YQ0A 4CNGA 1X7PA 4YPZA 4YQ9A 3NK7A 5FAIA 1VHKA 4YQ8A 3NK6A 4YQLA 1V2XA 1IPAA 1GZ0A 2V3KA 3OIIA 4FAKA 3GYQA 4YPYA 3OINA 1NS5A 4YQDA 3ILKA 4YQ7A 2YY8A 4YQTA 4YQKA 3KTYA 2QWVA 1K3RA 2O3AA 3AIAA 4IG6A 4XBOA 2EGWA 1NXZA 3BBEA 4YQ6A 3L8UA 3IEFA 3KNUA 1ZJRA 4FMWA 4YQ2A 4MCDA 4E8BA 5GM8A 1VHYA 3BBDA 2Z0YA 3N4JA 4YQSA 4MCBA 4X3MA 3BBHA 4CNDA 4PZKA 4YVJA 4YQIA 4J3CA 1UALA 5GMBA 4YQBA 4YQGA 4CNEA 1VH0A 3N4KA 4YQRA 3OIJA 4YQJA 4H3YA 2HA8A 4YQQA 4YQ5A 1UAJA 3DCMX 4YVGA 4H3ZA 3KW2A 4JWFA 3QUVA 2I6DA 4YPWA 2V3JA 1X7OA 4YQ4A 3KY7A 5GMCA 4YQAA 1V6ZA 1TO0A 1J85A 4YVKA 1OY5A 1O6DA 2EGVA 1Z85A 4JWHA 4RG1A 5CO4A 3AI9X 4KGNA 4L69A 2QMMA 4YQCA 3O7BA 5D9FA 4CNFA 4YVIA 3AXZA 4JWJA 4KDZA 3IC6A 4YQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPX A;  4YQO A;  1UAM A;  1P9P A;  4JAK A;  4YQ1 A;  3ONP A;  4YQ3 A;  2CX8 A;  1UAK A;  4X3L A;  4JAL A;  4YVH A;  1MXI A;  4MCC A;  4YQN A;  3E5Y A;  4YQ0 A;  4CNG A;  1X7P A;  4YPZ A;  4YQ9 A;  3NK7 A;  5FAI A;  1VHK A;  4YQ8 A;  3NK6 A;  4YQL A;  1V2X A;  1IPA A;  1GZ0 A;  2V3K A;  3OII A;  4FAK A;  3GYQ A;  4YPY A;  3OIN A;  1NS5 A;  4YQD A;  3ILK A;  4YQ7 A;  2YY8 A;  4YQT A;  4YQK A;  3KTY A;  2QWV A;  1K3R A;  2O3A A;  3AIA A;  4IG6 A;  4XBO A;  2EGW A;  1NXZ A;  3BBE A;  4YQ6 A;  3L8U A;  3IEF A;  3KNU A;  1ZJR A;  4YQ2 A;  4MCD A;  4E8B A;  5GM8 A;  1VHY A;  3BBD A;  2Z0Y A;  3N4J A;  4YQS A;  4MCB A;  4X3M A;  3BBH A;  4CND A;  4PZK A;  4YVJ A;  4YQI A;  4J3C A;  1UAL A;  5GMB A;  4YQB A;  4YQG A;  4CNE A;  1VH0 A;  3N4K A;  4YQR A;  3OIJ A;  4YQJ A;  4H3Y A;  2HA8 A;  4YQQ A;  4YQ5 A;  1UAJ A;  3DCM X;  4YVG A;  4H3Z A;  3KW2 A;  3QUV A;  2I6D A;  4YPW A;  2V3J A;  1X7O A;  4YQ4 A;  3KY7 A;  5GMC A;  4YQA A;  1V6Z A;  1TO0 A;  1J85 A;  4YVK A;  1OY5 A;  1O6D A;  2EGV A;  1Z85 A;  4RG1 A;  5CO4 A;  3AI9 X;  4KGN A;  4L69 A;  2QMM A;  4YQC A;  3O7B A;  5D9F A;  4CNF A;  4YVI A;  3AXZ A;  4KDZ A;  3IC6 A;  4YQP A; 
#chains in the Genus database with same CATH topology
 4YPX A;  4YQO A;  1UAM A;  1P9P A;  4JAK A;  4YQ1 A;  3ONP A;  4YQ3 A;  2CX8 A;  4JWG A;  1UAK A;  4X3L A;  4JAL A;  4YVH A;  1MXI A;  4MCC A;  4YQN A;  3E5Y A;  4YQ0 A;  4CNG A;  1X7P A;  4YPZ A;  4YQ9 A;  3NK7 A;  5FAI A;  1VHK A;  4YQ8 A;  3NK6 A;  4YQL A;  1V2X A;  1IPA A;  1GZ0 A;  2V3K A;  3OII A;  4FAK A;  3GYQ A;  4YPY A;  3OIN A;  1NS5 A;  4YQD A;  3ILK A;  4YQ7 A;  2YY8 A;  4YQT A;  4YQK A;  3KTY A;  2QWV A;  1K3R A;  2O3A A;  3AIA A;  4IG6 A;  4XBO A;  2EGW A;  1NXZ A;  3BBE A;  4YQ6 A;  3L8U A;  3IEF A;  3KNU A;  1ZJR A;  4FMW A;  4YQ2 A;  4MCD A;  4E8B A;  5GM8 A;  1VHY A;  3BBD A;  2Z0Y A;  3N4J A;  4YQS A;  4MCB A;  4X3M A;  3BBH A;  4CND A;  4PZK A;  4YVJ A;  4YQI A;  4J3C A;  1UAL A;  5GMB A;  4YQB A;  4YQG A;  4CNE A;  1VH0 A;  3N4K A;  4YQR A;  3OIJ A;  4YQJ A;  4H3Y A;  2HA8 A;  4YQQ A;  4YQ5 A;  1UAJ A;  3DCM X;  4YVG A;  4H3Z A;  3KW2 A;  4JWF A;  3QUV A;  2I6D A;  4YPW A;  2V3J A;  1X7O A;  4YQ4 A;  3KY7 A;  5GMC A;  4YQA A;  1V6Z A;  1TO0 A;  1J85 A;  4YVK A;  1OY5 A;  1O6D A;  2EGV A;  1Z85 A;  4JWH A;  4RG1 A;  5CO4 A;  3AI9 X;  4KGN A;  4L69 A;  2QMM A;  4YQC A;  3O7B A;  5D9F A;  4CNF A;  4YVI A;  3AXZ A;  4JWJ A;  4KDZ A;  3IC6 A;  4YQP A; 
#chains in the Genus database with same CATH homology
 4YPX A;  4YQO A;  1UAM A;  1P9P A;  4JAK A;  4YQ1 A;  3ONP A;  4YQ3 A;  2CX8 A;  4JWG A;  1UAK A;  4X3L A;  4JAL A;  4YVH A;  1MXI A;  4MCC A;  4YQN A;  3E5Y A;  4YQ0 A;  4CNG A;  1X7P A;  4YPZ A;  4YQ9 A;  3NK7 A;  5FAI A;  1VHK A;  4YQ8 A;  3NK6 A;  4YQL A;  1V2X A;  1IPA A;  1GZ0 A;  2V3K A;  3OII A;  4FAK A;  3GYQ A;  4YPY A;  3OIN A;  1NS5 A;  4YQD A;  3ILK A;  4YQ7 A;  2YY8 A;  4YQT A;  4YQK A;  3KTY A;  2QWV A;  1K3R A;  2O3A A;  3AIA A;  4IG6 A;  4XBO A;  2EGW A;  1NXZ A;  3BBE A;  4YQ6 A;  3L8U A;  3IEF A;  3KNU A;  1ZJR A;  4FMW A;  4YQ2 A;  4MCD A;  4E8B A;  5GM8 A;  1VHY A;  3BBD A;  2Z0Y A;  3N4J A;  4YQS A;  4MCB A;  4X3M A;  3BBH A;  4CND A;  4PZK A;  4YVJ A;  4YQI A;  4J3C A;  1UAL A;  5GMB A;  4YQB A;  4YQG A;  4CNE A;  1VH0 A;  3N4K A;  4YQR A;  3OIJ A;  4YQJ A;  4H3Y A;  2HA8 A;  4YQQ A;  4YQ5 A;  1UAJ A;  3DCM X;  4YVG A;  4H3Z A;  3KW2 A;  4JWF A;  3QUV A;  2I6D A;  4YPW A;  2V3J A;  1X7O A;  4YQ4 A;  3KY7 A;  5GMC A;  4YQA A;  1V6Z A;  1TO0 A;  1J85 A;  4YVK A;  1OY5 A;  1O6D A;  2EGV A;  1Z85 A;  4JWH A;  4RG1 A;  5CO4 A;  3AI9 X;  4KGN A;  4L69 A;  2QMM A;  4YQC A;  3O7B A;  5D9F A;  4CNF A;  4YVI A;  3AXZ A;  4JWJ A;  4KDZ A;  3IC6 A;  4YQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...