3AI9X

Crystal structure of duf358 protein reveals a putative spout-class rrna methyltransferase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
Knots found
sequence length
211
structure length
211
Chain Sequence
b'GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKKRICEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0217 protein MJ1640
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 64
structure length 211
sequence length 211
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ai9X00
3E5YA 3BBHA 5GMBA 1TO0A 2Z0YA 3N4KA 1P9PA 4YQ7A 4YQIA 2YY8A 4YVJA 1IPAA 4YQ1A 3QUVA 1V2XA 1Z85A 3GYQA 1K3RA 4YQQA 1UALA 3OIJA 4YQPA 3IEFA 4H3YA 3O7BA 2HA8A 4YQRA 4X3MA 2EGVA 1VH0A 4CNDA 2V3JA 5D9FA 1VHYA 4YPZA 1GZ0A 4JAKA 4IG6A 2QWVA 4CNEA 2QMMA 3NK6A 4YPYA 4YQ0A 3AI9X 3IC6A 2I6DA 4YVIA 4YQNA 1X7PA 3KY7A 3ONPA 5CO4A 4YQAA 4RG1A 4L69A 4H3ZA 2V3KA 3N4JA 4YVGA 4YQOA 4MCBA 5GMCA 3AIAA 4PZKA 4CNGA 1J85A 4FAKA 4XBOA 1UAMA 4YQ5A 1NXZA 4X3LA 4YVKA 1OY5A 4YPWA 4YQ6A 4CNFA 3L8UA 4YQLA 2CX8A 3BBEA 4E8BA 3ILKA 1NS5A 4JALA 4YQTA 4YPXA 5FAIA 2EGWA 4YQDA 4YQ3A 3AXZA 4YQKA 4YQGA 1X7OA 4YQJA 1ZJRA 3KW2A 4MCDA 3DCMX 5GM8A 4YVHA 1MXIA 3KTYA 4YQ8A 3KNUA 1VHKA 3OINA 1V6ZA 4YQCA 4KGNA 4YQ4A 4YQ9A 1UAJA 4YQSA 3OIIA 3BBDA 4KDZA 4J3CA 4MCCA 2O3AA 3NK7A 1UAKA 4YQBA 4YQ2A 1O6DA
chains in the Genus database with same CATH superfamily
3E5YA 3BBHA 5GMBA 1TO0A 2Z0YA 3N4KA 1P9PA 4JWJA 4YQ7A 4YQIA 2YY8A 4YVJA 1IPAA 4YQ1A 3QUVA 1V2XA 1Z85A 3GYQA 1K3RA 4JWGA 4YQQA 1UALA 3OIJA 4YQPA 3IEFA 4H3YA 3O7BA 2HA8A 4YQRA 4X3MA 2EGVA 1VH0A 4CNDA 2V3JA 5D9FA 1VHYA 4YPZA 1GZ0A 4JAKA 4IG6A 2QWVA 4CNEA 2QMMA 3NK6A 4YPYA 4YQ0A 3AI9X 3IC6A 2I6DA 4YVIA 4YQNA 1X7PA 3KY7A 3ONPA 5CO4A 4YQAA 4RG1A 4L69A 4H3ZA 4FMWA 2V3KA 3N4JA 4YVGA 4YQOA 4MCBA 5GMCA 3AIAA 4PZKA 4CNGA 1J85A 4FAKA 4XBOA 1UAMA 4YQ5A 1NXZA 4X3LA 4YVKA 1OY5A 4YPWA 4YQ6A 4CNFA 3L8UA 4YQLA 2CX8A 3BBEA 4E8BA 4JWHA 3ILKA 1NS5A 4JALA 4YQTA 4YPXA 5FAIA 2EGWA 4YQDA 4YQ3A 3AXZA 4YQKA 4YQGA 1X7OA 4YQJA 1ZJRA 3KW2A 4JWFA 4MCDA 3DCMX 5GM8A 4YVHA 1MXIA 3KTYA 4YQ8A 3KNUA 1VHKA 3OINA 1V6ZA 4YQCA 4KGNA 4YQ4A 4YQ9A 1UAJA 4YQSA 3OIIA 3BBDA 4KDZA 4J3CA 4MCCA 2O3AA 3NK7A 1UAKA 4YQBA 4YQ2A 1O6DA
chains in the Genus database with same CATH topology
3E5YA 3BBHA 5GMBA 1TO0A 2Z0YA 3N4KA 1P9PA 4JWJA 4YQ7A 4YQIA 2YY8A 4YVJA 1IPAA 4YQ1A 3QUVA 1V2XA 1Z85A 3GYQA 1K3RA 4JWGA 4YQQA 1UALA 3OIJA 4YQPA 3IEFA 4H3YA 3O7BA 2HA8A 4YQRA 4X3MA 2EGVA 1VH0A 4CNDA 2V3JA 5D9FA 1VHYA 4YPZA 1GZ0A 4JAKA 4IG6A 2QWVA 4CNEA 2QMMA 3NK6A 4YPYA 4YQ0A 3AI9X 3IC6A 2I6DA 4YVIA 4YQNA 1X7PA 3KY7A 3ONPA 5CO4A 4YQAA 4RG1A 4L69A 4H3ZA 4FMWA 2V3KA 3N4JA 4YVGA 4YQOA 4MCBA 5GMCA 3AIAA 4PZKA 4CNGA 1J85A 4FAKA 4XBOA 1UAMA 4YQ5A 1NXZA 4X3LA 4YVKA 1OY5A 4YPWA 4YQ6A 4CNFA 3L8UA 4YQLA 2CX8A 3BBEA 4E8BA 4JWHA 3ILKA 1NS5A 4JALA 4YQTA 4YPXA 5FAIA 2EGWA 4YQDA 4YQ3A 3AXZA 4YQKA 4YQGA 1X7OA 4YQJA 1ZJRA 3KW2A 4JWFA 4MCDA 3DCMX 5GM8A 4YVHA 1MXIA 3KTYA 4YQ8A 3KNUA 1VHKA 3OINA 1V6ZA 4YQCA 4KGNA 4YQ4A 4YQ9A 1UAJA 4YQSA 3OIIA 3BBDA 4KDZA 4J3CA 4MCCA 2O3AA 3NK7A 1UAKA 4YQBA 4YQ2A 1O6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5Y A;  3BBH A;  5GMB A;  1TO0 A;  2Z0Y A;  3N4K A;  1P9P A;  4YQ7 A;  4YQI A;  2YY8 A;  4YVJ A;  1IPA A;  4YQ1 A;  3QUV A;  1V2X A;  1Z85 A;  3GYQ A;  1K3R A;  4YQQ A;  1UAL A;  3OIJ A;  4YQP A;  3IEF A;  4H3Y A;  3O7B A;  2HA8 A;  4YQR A;  4X3M A;  2EGV A;  1VH0 A;  4CND A;  2V3J A;  5D9F A;  1VHY A;  4YPZ A;  1GZ0 A;  4JAK A;  4IG6 A;  2QWV A;  4CNE A;  2QMM A;  3NK6 A;  4YPY A;  4YQ0 A;  3AI9 X;  3IC6 A;  2I6D A;  4YVI A;  4YQN A;  1X7P A;  3KY7 A;  3ONP A;  5CO4 A;  4YQA A;  4RG1 A;  4L69 A;  4H3Z A;  2V3K A;  3N4J A;  4YVG A;  4YQO A;  4MCB A;  5GMC A;  3AIA A;  4PZK A;  4CNG A;  1J85 A;  4FAK A;  4XBO A;  1UAM A;  4YQ5 A;  1NXZ A;  4X3L A;  4YVK A;  1OY5 A;  4YPW A;  4YQ6 A;  4CNF A;  3L8U A;  4YQL A;  2CX8 A;  3BBE A;  4E8B A;  3ILK A;  1NS5 A;  4JAL A;  4YQT A;  4YPX A;  5FAI A;  2EGW A;  4YQD A;  4YQ3 A;  3AXZ A;  4YQK A;  4YQG A;  1X7O A;  4YQJ A;  1ZJR A;  3KW2 A;  4MCD A;  3DCM X;  5GM8 A;  4YVH A;  1MXI A;  3KTY A;  4YQ8 A;  3KNU A;  1VHK A;  3OIN A;  1V6Z A;  4YQC A;  4KGN A;  4YQ4 A;  4YQ9 A;  1UAJ A;  4YQS A;  3OII A;  3BBD A;  4KDZ A;  4J3C A;  4MCC A;  2O3A A;  3NK7 A;  1UAK A;  4YQB A;  4YQ2 A;  1O6D A; 
#chains in the Genus database with same CATH topology
 3E5Y A;  3BBH A;  5GMB A;  1TO0 A;  2Z0Y A;  3N4K A;  1P9P A;  4JWJ A;  4YQ7 A;  4YQI A;  2YY8 A;  4YVJ A;  1IPA A;  4YQ1 A;  3QUV A;  1V2X A;  1Z85 A;  3GYQ A;  1K3R A;  4JWG A;  4YQQ A;  1UAL A;  3OIJ A;  4YQP A;  3IEF A;  4H3Y A;  3O7B A;  2HA8 A;  4YQR A;  4X3M A;  2EGV A;  1VH0 A;  4CND A;  2V3J A;  5D9F A;  1VHY A;  4YPZ A;  1GZ0 A;  4JAK A;  4IG6 A;  2QWV A;  4CNE A;  2QMM A;  3NK6 A;  4YPY A;  4YQ0 A;  3AI9 X;  3IC6 A;  2I6D A;  4YVI A;  4YQN A;  1X7P A;  3KY7 A;  3ONP A;  5CO4 A;  4YQA A;  4RG1 A;  4L69 A;  4H3Z A;  4FMW A;  2V3K A;  3N4J A;  4YVG A;  4YQO A;  4MCB A;  5GMC A;  3AIA A;  4PZK A;  4CNG A;  1J85 A;  4FAK A;  4XBO A;  1UAM A;  4YQ5 A;  1NXZ A;  4X3L A;  4YVK A;  1OY5 A;  4YPW A;  4YQ6 A;  4CNF A;  3L8U A;  4YQL A;  2CX8 A;  3BBE A;  4E8B A;  4JWH A;  3ILK A;  1NS5 A;  4JAL A;  4YQT A;  4YPX A;  5FAI A;  2EGW A;  4YQD A;  4YQ3 A;  3AXZ A;  4YQK A;  4YQG A;  1X7O A;  4YQJ A;  1ZJR A;  3KW2 A;  4JWF A;  4MCD A;  3DCM X;  5GM8 A;  4YVH A;  1MXI A;  3KTY A;  4YQ8 A;  3KNU A;  1VHK A;  3OIN A;  1V6Z A;  4YQC A;  4KGN A;  4YQ4 A;  4YQ9 A;  1UAJ A;  4YQS A;  3OII A;  3BBD A;  4KDZ A;  4J3C A;  4MCC A;  2O3A A;  3NK7 A;  1UAK A;  4YQB A;  4YQ2 A;  1O6D A; 
#chains in the Genus database with same CATH homology
 3E5Y A;  3BBH A;  5GMB A;  1TO0 A;  2Z0Y A;  3N4K A;  1P9P A;  4JWJ A;  4YQ7 A;  4YQI A;  2YY8 A;  4YVJ A;  1IPA A;  4YQ1 A;  3QUV A;  1V2X A;  1Z85 A;  3GYQ A;  1K3R A;  4JWG A;  4YQQ A;  1UAL A;  3OIJ A;  4YQP A;  3IEF A;  4H3Y A;  3O7B A;  2HA8 A;  4YQR A;  4X3M A;  2EGV A;  1VH0 A;  4CND A;  2V3J A;  5D9F A;  1VHY A;  4YPZ A;  1GZ0 A;  4JAK A;  4IG6 A;  2QWV A;  4CNE A;  2QMM A;  3NK6 A;  4YPY A;  4YQ0 A;  3AI9 X;  3IC6 A;  2I6D A;  4YVI A;  4YQN A;  1X7P A;  3KY7 A;  3ONP A;  5CO4 A;  4YQA A;  4RG1 A;  4L69 A;  4H3Z A;  4FMW A;  2V3K A;  3N4J A;  4YVG A;  4YQO A;  4MCB A;  5GMC A;  3AIA A;  4PZK A;  4CNG A;  1J85 A;  4FAK A;  4XBO A;  1UAM A;  4YQ5 A;  1NXZ A;  4X3L A;  4YVK A;  1OY5 A;  4YPW A;  4YQ6 A;  4CNF A;  3L8U A;  4YQL A;  2CX8 A;  3BBE A;  4E8B A;  4JWH A;  3ILK A;  1NS5 A;  4JAL A;  4YQT A;  4YPX A;  5FAI A;  2EGW A;  4YQD A;  4YQ3 A;  3AXZ A;  4YQK A;  4YQG A;  1X7O A;  4YQJ A;  1ZJR A;  3KW2 A;  4JWF A;  4MCD A;  3DCM X;  5GM8 A;  4YVH A;  1MXI A;  3KTY A;  4YQ8 A;  3KNU A;  1VHK A;  3OIN A;  1V6Z A;  4YQC A;  4KGN A;  4YQ4 A;  4YQ9 A;  1UAJ A;  4YQS A;  3OII A;  3BBD A;  4KDZ A;  4J3C A;  4MCC A;  2O3A A;  3NK7 A;  1UAK A;  4YQB A;  4YQ2 A;  1O6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...