3AI9X

Crystal structure of duf358 protein reveals a putative spout-class rrna methyltransferase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
Knots found
sequence length
211
structure length
211
Chain Sequence
GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKKRICEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UPF0217 protein MJ1640
publication title Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 64
structure length 211
sequence length 211
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.257: tRNA (pseudouridine(54)-N(1))-methyltransferase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF04013 Methyltrn_RNA_2 Putative SAM-dependent RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ai9X00
4IG6A 3L8UA 4CNGA 2HA8A 4CNEA 1ZJRA 4J3CA 3ONPA 4YQ4A 4YQGA 1TO0A 4YPYA 2CX8A 4YQKA 5GMBA 1NXZA 4YVKA 5FAIA 1K3RA 5CO4A 3AXZA 4YQ6A 1Z85A 1V6ZA 4MCCA 3E5YA 4YQ2A 1VH0A 5GM8A 4YQPA 4YQCA 1IPAA 3NK7A 4YQAA 1VHKA 4YQ9A 3DCMX 4YQ5A 3OINA 1GZ0A 4YQ1A 1X7OA 2QWVA 4X3MA 4CNFA 4MCDA 1NS5A 4YQ0A 4YPZA 2QMMA 4YQTA 4YQNA 3NK6A 1OY5A 3IC6A 1O6DA 4X3LA 4YVJA 4YQOA 4H3ZA 5GMCA 4YVIA 3BBHA 3BBDA 3IEFA 4XBOA 4YQRA 4MCBA 4E8BA 3KY7A 1UAKA 1V2XA 3BBEA 4L69A 4YPWA 1VHYA 4JALA 3GYQA 4YVHA 1X7PA 4YQ3A 4FAKA 2Z0YA 2EGVA 1J85A 3O7BA 3KTYA 4YQ8A 4YQDA 2O3AA 2YY8A 5D9FA 2V3KA 4YQBA 3N4JA 2I6DA 4RG1A 1UALA 3AI9X 3KW2A 4CNDA 3QUVA 3ILKA 3AIAA 4PZKA 4JAKA 1P9PA 4KDZA 4YQJA 4YQSA 1UAJA 4KGNA 4YVGA 2EGWA 4H3YA 3OIIA 4YQQA 4YQ7A 3OIJA 4YQLA 2V3JA 4YQIA 1UAMA 3N4KA 1MXIA 4YPXA 3KNUA
chains in the Genus database with same CATH superfamily
4IG6A 3L8UA 4CNGA 2HA8A 4CNEA 1ZJRA 4J3CA 3ONPA 4YQ4A 4YQGA 1TO0A 4YPYA 2CX8A 4YQKA 5GMBA 1NXZA 4YVKA 5FAIA 1K3RA 5CO4A 3AXZA 4YQ6A 1Z85A 1V6ZA 4MCCA 3E5YA 4YQ2A 4JWHA 1VH0A 5GM8A 4YQPA 4YQCA 1IPAA 3NK7A 4YQAA 4JWJA 1VHKA 4YQ9A 3DCMX 4YQ5A 3OINA 1GZ0A 4JWGA 4YQ1A 1X7OA 2QWVA 4X3MA 4CNFA 4MCDA 1NS5A 4YQ0A 4YPZA 2QMMA 4YQTA 4YQNA 3NK6A 1OY5A 3IC6A 1O6DA 4X3LA 4YVJA 4YQOA 4H3ZA 5GMCA 4YVIA 3BBHA 3BBDA 3IEFA 4XBOA 4YQRA 4MCBA 4FMWA 4E8BA 3KY7A 1UAKA 1V2XA 3BBEA 4L69A 4YPWA 1VHYA 4JALA 3GYQA 4YVHA 1X7PA 4YQ3A 4FAKA 2Z0YA 2EGVA 1J85A 3O7BA 3KTYA 4YQ8A 4JWFA 4YQDA 2O3AA 2YY8A 5D9FA 2V3KA 4YQBA 3N4JA 2I6DA 4RG1A 1UALA 3AI9X 3KW2A 4CNDA 3QUVA 3ILKA 3AIAA 4PZKA 4JAKA 1P9PA 4KDZA 4YQJA 4YQSA 1UAJA 4KGNA 4YVGA 2EGWA 4H3YA 3OIIA 4YQQA 4YQ7A 3OIJA 4YQLA 2V3JA 4YQIA 1UAMA 3N4KA 1MXIA 4YPXA 3KNUA
chains in the Genus database with same CATH topology
4IG6A 3L8UA 4CNGA 2HA8A 4CNEA 1ZJRA 4J3CA 3ONPA 4YQ4A 4YQGA 1TO0A 4YPYA 2CX8A 4YQKA 5GMBA 1NXZA 4YVKA 5FAIA 1K3RA 5CO4A 3AXZA 4YQ6A 1Z85A 1V6ZA 4MCCA 3E5YA 4YQ2A 4JWHA 1VH0A 5GM8A 4YQPA 4YQCA 1IPAA 3NK7A 4YQAA 4JWJA 1VHKA 4YQ9A 3DCMX 4YQ5A 3OINA 1GZ0A 4JWGA 4YQ1A 1X7OA 2QWVA 4X3MA 4CNFA 4MCDA 1NS5A 4YQ0A 4YPZA 2QMMA 4YQTA 4YQNA 3NK6A 1OY5A 3IC6A 1O6DA 4X3LA 4YVJA 4YQOA 4H3ZA 5GMCA 4YVIA 3BBHA 3BBDA 3IEFA 4XBOA 4YQRA 4MCBA 4FMWA 4E8BA 3KY7A 1UAKA 1V2XA 3BBEA 4L69A 4YPWA 1VHYA 4JALA 3GYQA 4YVHA 1X7PA 4YQ3A 4FAKA 2Z0YA 2EGVA 1J85A 3O7BA 3KTYA 4YQ8A 4JWFA 4YQDA 2O3AA 2YY8A 5D9FA 2V3KA 4YQBA 3N4JA 2I6DA 4RG1A 1UALA 3AI9X 3KW2A 4CNDA 3QUVA 3ILKA 3AIAA 4PZKA 4JAKA 1P9PA 4KDZA 4YQJA 4YQSA 1UAJA 4KGNA 4YVGA 2EGWA 4H3YA 3OIIA 4YQQA 4YQ7A 3OIJA 4YQLA 2V3JA 4YQIA 1UAMA 3N4KA 1MXIA 4YPXA 3KNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IG6 A;  3L8U A;  4CNG A;  2HA8 A;  4CNE A;  1ZJR A;  4J3C A;  3ONP A;  4YQ4 A;  4YQG A;  1TO0 A;  4YPY A;  2CX8 A;  4YQK A;  5GMB A;  1NXZ A;  4YVK A;  5FAI A;  1K3R A;  5CO4 A;  3AXZ A;  4YQ6 A;  1Z85 A;  1V6Z A;  4MCC A;  3E5Y A;  4YQ2 A;  1VH0 A;  5GM8 A;  4YQP A;  4YQC A;  1IPA A;  3NK7 A;  4YQA A;  1VHK A;  4YQ9 A;  3DCM X;  4YQ5 A;  3OIN A;  1GZ0 A;  4YQ1 A;  1X7O A;  2QWV A;  4X3M A;  4CNF A;  4MCD A;  1NS5 A;  4YQ0 A;  4YPZ A;  2QMM A;  4YQT A;  4YQN A;  3NK6 A;  1OY5 A;  3IC6 A;  1O6D A;  4X3L A;  4YVJ A;  4YQO A;  4H3Z A;  5GMC A;  4YVI A;  3BBH A;  3BBD A;  3IEF A;  4XBO A;  4YQR A;  4MCB A;  4E8B A;  3KY7 A;  1UAK A;  1V2X A;  3BBE A;  4L69 A;  4YPW A;  1VHY A;  4JAL A;  3GYQ A;  4YVH A;  1X7P A;  4YQ3 A;  4FAK A;  2Z0Y A;  2EGV A;  1J85 A;  3O7B A;  3KTY A;  4YQ8 A;  4YQD A;  2O3A A;  2YY8 A;  5D9F A;  2V3K A;  4YQB A;  3N4J A;  2I6D A;  4RG1 A;  1UAL A;  3AI9 X;  3KW2 A;  4CND A;  3QUV A;  3ILK A;  3AIA A;  4PZK A;  4JAK A;  1P9P A;  4KDZ A;  4YQJ A;  4YQS A;  1UAJ A;  4KGN A;  4YVG A;  2EGW A;  4H3Y A;  3OII A;  4YQQ A;  4YQ7 A;  3OIJ A;  4YQL A;  2V3J A;  4YQI A;  1UAM A;  3N4K A;  1MXI A;  4YPX A;  3KNU A; 
#chains in the Genus database with same CATH topology
 4IG6 A;  3L8U A;  4CNG A;  2HA8 A;  4CNE A;  1ZJR A;  4J3C A;  3ONP A;  4YQ4 A;  4YQG A;  1TO0 A;  4YPY A;  2CX8 A;  4YQK A;  5GMB A;  1NXZ A;  4YVK A;  5FAI A;  1K3R A;  5CO4 A;  3AXZ A;  4YQ6 A;  1Z85 A;  1V6Z A;  4MCC A;  3E5Y A;  4YQ2 A;  4JWH A;  1VH0 A;  5GM8 A;  4YQP A;  4YQC A;  1IPA A;  3NK7 A;  4YQA A;  4JWJ A;  1VHK A;  4YQ9 A;  3DCM X;  4YQ5 A;  3OIN A;  1GZ0 A;  4JWG A;  4YQ1 A;  1X7O A;  2QWV A;  4X3M A;  4CNF A;  4MCD A;  1NS5 A;  4YQ0 A;  4YPZ A;  2QMM A;  4YQT A;  4YQN A;  3NK6 A;  1OY5 A;  3IC6 A;  1O6D A;  4X3L A;  4YVJ A;  4YQO A;  4H3Z A;  5GMC A;  4YVI A;  3BBH A;  3BBD A;  3IEF A;  4XBO A;  4YQR A;  4MCB A;  4FMW A;  4E8B A;  3KY7 A;  1UAK A;  1V2X A;  3BBE A;  4L69 A;  4YPW A;  1VHY A;  4JAL A;  3GYQ A;  4YVH A;  1X7P A;  4YQ3 A;  4FAK A;  2Z0Y A;  2EGV A;  1J85 A;  3O7B A;  3KTY A;  4YQ8 A;  4JWF A;  4YQD A;  2O3A A;  2YY8 A;  5D9F A;  2V3K A;  4YQB A;  3N4J A;  2I6D A;  4RG1 A;  1UAL A;  3AI9 X;  3KW2 A;  4CND A;  3QUV A;  3ILK A;  3AIA A;  4PZK A;  4JAK A;  1P9P A;  4KDZ A;  4YQJ A;  4YQS A;  1UAJ A;  4KGN A;  4YVG A;  2EGW A;  4H3Y A;  3OII A;  4YQQ A;  4YQ7 A;  3OIJ A;  4YQL A;  2V3J A;  4YQI A;  1UAM A;  3N4K A;  1MXI A;  4YPX A;  3KNU A; 
#chains in the Genus database with same CATH homology
 4IG6 A;  3L8U A;  4CNG A;  2HA8 A;  4CNE A;  1ZJR A;  4J3C A;  3ONP A;  4YQ4 A;  4YQG A;  1TO0 A;  4YPY A;  2CX8 A;  4YQK A;  5GMB A;  1NXZ A;  4YVK A;  5FAI A;  1K3R A;  5CO4 A;  3AXZ A;  4YQ6 A;  1Z85 A;  1V6Z A;  4MCC A;  3E5Y A;  4YQ2 A;  4JWH A;  1VH0 A;  5GM8 A;  4YQP A;  4YQC A;  1IPA A;  3NK7 A;  4YQA A;  4JWJ A;  1VHK A;  4YQ9 A;  3DCM X;  4YQ5 A;  3OIN A;  1GZ0 A;  4JWG A;  4YQ1 A;  1X7O A;  2QWV A;  4X3M A;  4CNF A;  4MCD A;  1NS5 A;  4YQ0 A;  4YPZ A;  2QMM A;  4YQT A;  4YQN A;  3NK6 A;  1OY5 A;  3IC6 A;  1O6D A;  4X3L A;  4YVJ A;  4YQO A;  4H3Z A;  5GMC A;  4YVI A;  3BBH A;  3BBD A;  3IEF A;  4XBO A;  4YQR A;  4MCB A;  4FMW A;  4E8B A;  3KY7 A;  1UAK A;  1V2X A;  3BBE A;  4L69 A;  4YPW A;  1VHY A;  4JAL A;  3GYQ A;  4YVH A;  1X7P A;  4YQ3 A;  4FAK A;  2Z0Y A;  2EGV A;  1J85 A;  3O7B A;  3KTY A;  4YQ8 A;  4JWF A;  4YQD A;  2O3A A;  2YY8 A;  5D9F A;  2V3K A;  4YQB A;  3N4J A;  2I6D A;  4RG1 A;  1UAL A;  3AI9 X;  3KW2 A;  4CND A;  3QUV A;  3ILK A;  3AIA A;  4PZK A;  4JAK A;  1P9P A;  4KDZ A;  4YQJ A;  4YQS A;  1UAJ A;  4KGN A;  4YVG A;  2EGW A;  4H3Y A;  3OII A;  4YQQ A;  4YQ7 A;  3OIJ A;  4YQL A;  2V3J A;  4YQI A;  1UAM A;  3N4K A;  1MXI A;  4YPX A;  3KNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...