3BBHA

M. jannaschii nep1 complexed with sinefungin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
204
structure length
204
Chain Sequence
TYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosome biogenesis protein NEP1-like
publication title The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 69
structure length 204
sequence length 204
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3bbhA00
2EGVA 1X7OA 1VHYA 4YQIA 4YQ0A 5D9FA 3KY7A 1O6DA 3N4KA 4CNEA 4YQCA 2YY8A 2V3JA 4CNGA 4YQSA 4YQBA 4YPXA 4E8BA 3OIIA 3AXZA 3AIAA 4YPYA 4YQJA 2EGWA 3KNUA 4YQQA 4YQ8A 1UAKA 4J3CA 2Z0YA 1UAJA 4RG1A 4YVHA 4MCBA 3DCMX 4YQLA 3AI9X 2I6DA 4YVKA 1UALA 1K3RA 4CNDA 1NS5A 4X3LA 1X7PA 1Z85A 4YQDA 4YQ2A 4MCDA 3BBHA 5GMCA 4CNFA 4H3ZA 4KDZA 3ONPA 4YQRA 4KGNA 4YQNA 4YQ6A 1TO0A 1VHKA 4YQ7A 4FAKA 1VH0A 3NK7A 3O7BA 3OINA 2V3KA 3L8UA 2QWVA 4L69A 3E5YA 1GZ0A 1IPAA 4PZKA 1J85A 2HA8A 4X3MA 4YQPA 2O3AA 1V6ZA 3KTYA 4YPWA 4YQAA 1ZJRA 3N4JA 4YQTA 1V2XA 4MCCA 1P9PA 1UAMA 4YQ9A 4IG6A 4YQKA 4H3YA 5GM8A 4YVJA 4YQ4A 4YQ5A 3IC6A 4YPZA 1MXIA 5GMBA 4YQ1A 1NXZA 5FAIA 3OIJA 1OY5A 4YVGA 5CO4A 3KW2A 2QMMA 4YQ3A 4JAKA 4JALA 3IEFA 3QUVA 4XBOA 4YQGA 3GYQA 3BBDA 3NK6A 3ILKA 3BBEA 4YVIA 4YQOA 2CX8A
chains in the Genus database with same CATH superfamily
2EGVA 1X7OA 1VHYA 4YQIA 4YQ0A 5D9FA 3KY7A 1O6DA 3N4KA 4CNEA 4YQCA 2YY8A 2V3JA 4CNGA 4YQSA 4YQBA 4YPXA 4E8BA 3OIIA 3AXZA 3AIAA 4YPYA 4YQJA 2EGWA 3KNUA 4YQQA 4YQ8A 1UAKA 4J3CA 2Z0YA 4JWGA 1UAJA 4RG1A 4YVHA 4MCBA 3DCMX 4YQLA 3AI9X 2I6DA 4YVKA 1UALA 1K3RA 4CNDA 1NS5A 4X3LA 1X7PA 1Z85A 4YQDA 4YQ2A 4MCDA 3BBHA 5GMCA 4CNFA 4H3ZA 4KDZA 3ONPA 4YQRA 4KGNA 4JWHA 4YQNA 4YQ6A 4FMWA 1TO0A 1VHKA 4YQ7A 4FAKA 1VH0A 3NK7A 3O7BA 3OINA 2V3KA 3L8UA 4JWJA 2QWVA 4L69A 3E5YA 1GZ0A 1IPAA 4PZKA 1J85A 2HA8A 4X3MA 4YQPA 2O3AA 4JWFA 1V6ZA 3KTYA 4YPWA 4YQAA 1ZJRA 3N4JA 4YQTA 1V2XA 4MCCA 1P9PA 1UAMA 4YQ9A 4IG6A 4YQKA 4H3YA 5GM8A 4YVJA 4YQ4A 4YQ5A 3IC6A 4YPZA 1MXIA 5GMBA 4YQ1A 1NXZA 5FAIA 3OIJA 1OY5A 4YVGA 5CO4A 3KW2A 2QMMA 4YQ3A 4JAKA 4JALA 3IEFA 3QUVA 4XBOA 4YQGA 3GYQA 3BBDA 3NK6A 3ILKA 3BBEA 4YVIA 4YQOA 2CX8A
chains in the Genus database with same CATH topology
2EGVA 1X7OA 1VHYA 4YQIA 4YQ0A 5D9FA 3KY7A 1O6DA 3N4KA 4CNEA 4YQCA 2YY8A 2V3JA 4CNGA 4YQSA 4YQBA 4YPXA 4E8BA 3OIIA 3AXZA 3AIAA 4YPYA 4YQJA 2EGWA 3KNUA 4YQQA 4YQ8A 1UAKA 4J3CA 2Z0YA 4JWGA 1UAJA 4RG1A 4YVHA 4MCBA 3DCMX 4YQLA 3AI9X 2I6DA 4YVKA 1UALA 1K3RA 4CNDA 1NS5A 4X3LA 1X7PA 1Z85A 4YQDA 4YQ2A 4MCDA 3BBHA 5GMCA 4CNFA 4H3ZA 4KDZA 3ONPA 4YQRA 4KGNA 4JWHA 4YQNA 4YQ6A 4FMWA 1TO0A 1VHKA 4YQ7A 4FAKA 1VH0A 3NK7A 3O7BA 3OINA 2V3KA 3L8UA 4JWJA 2QWVA 4L69A 3E5YA 1GZ0A 1IPAA 4PZKA 1J85A 2HA8A 4X3MA 4YQPA 2O3AA 4JWFA 1V6ZA 3KTYA 4YPWA 4YQAA 1ZJRA 3N4JA 4YQTA 1V2XA 4MCCA 1P9PA 1UAMA 4YQ9A 4IG6A 4YQKA 4H3YA 5GM8A 4YVJA 4YQ4A 4YQ5A 3IC6A 4YPZA 1MXIA 5GMBA 4YQ1A 1NXZA 5FAIA 3OIJA 1OY5A 4YVGA 5CO4A 3KW2A 2QMMA 4YQ3A 4JAKA 4JALA 3IEFA 3QUVA 4XBOA 4YQGA 3GYQA 3BBDA 3NK6A 3ILKA 3BBEA 4YVIA 4YQOA 2CX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGV A;  1X7O A;  1VHY A;  4YQI A;  4YQ0 A;  5D9F A;  3KY7 A;  1O6D A;  3N4K A;  4CNE A;  4YQC A;  2YY8 A;  2V3J A;  4CNG A;  4YQS A;  4YQB A;  4YPX A;  4E8B A;  3OII A;  3AXZ A;  3AIA A;  4YPY A;  4YQJ A;  2EGW A;  3KNU A;  4YQQ A;  4YQ8 A;  1UAK A;  4J3C A;  2Z0Y A;  1UAJ A;  4RG1 A;  4YVH A;  4MCB A;  3DCM X;  4YQL A;  3AI9 X;  2I6D A;  4YVK A;  1UAL A;  1K3R A;  4CND A;  1NS5 A;  4X3L A;  1X7P A;  1Z85 A;  4YQD A;  4YQ2 A;  4MCD A;  3BBH A;  5GMC A;  4CNF A;  4H3Z A;  4KDZ A;  3ONP A;  4YQR A;  4KGN A;  4YQN A;  4YQ6 A;  1TO0 A;  1VHK A;  4YQ7 A;  4FAK A;  1VH0 A;  3NK7 A;  3O7B A;  3OIN A;  2V3K A;  3L8U A;  2QWV A;  4L69 A;  3E5Y A;  1GZ0 A;  1IPA A;  4PZK A;  1J85 A;  2HA8 A;  4X3M A;  4YQP A;  2O3A A;  1V6Z A;  3KTY A;  4YPW A;  4YQA A;  1ZJR A;  3N4J A;  4YQT A;  1V2X A;  4MCC A;  1P9P A;  1UAM A;  4YQ9 A;  4IG6 A;  4YQK A;  4H3Y A;  5GM8 A;  4YVJ A;  4YQ4 A;  4YQ5 A;  3IC6 A;  4YPZ A;  1MXI A;  5GMB A;  4YQ1 A;  1NXZ A;  5FAI A;  3OIJ A;  1OY5 A;  4YVG A;  5CO4 A;  3KW2 A;  2QMM A;  4YQ3 A;  4JAK A;  4JAL A;  3IEF A;  3QUV A;  4XBO A;  4YQG A;  3GYQ A;  3BBD A;  3NK6 A;  3ILK A;  3BBE A;  4YVI A;  4YQO A;  2CX8 A; 
#chains in the Genus database with same CATH topology
 2EGV A;  1X7O A;  1VHY A;  4YQI A;  4YQ0 A;  5D9F A;  3KY7 A;  1O6D A;  3N4K A;  4CNE A;  4YQC A;  2YY8 A;  2V3J A;  4CNG A;  4YQS A;  4YQB A;  4YPX A;  4E8B A;  3OII A;  3AXZ A;  3AIA A;  4YPY A;  4YQJ A;  2EGW A;  3KNU A;  4YQQ A;  4YQ8 A;  1UAK A;  4J3C A;  2Z0Y A;  4JWG A;  1UAJ A;  4RG1 A;  4YVH A;  4MCB A;  3DCM X;  4YQL A;  3AI9 X;  2I6D A;  4YVK A;  1UAL A;  1K3R A;  4CND A;  1NS5 A;  4X3L A;  1X7P A;  1Z85 A;  4YQD A;  4YQ2 A;  4MCD A;  3BBH A;  5GMC A;  4CNF A;  4H3Z A;  4KDZ A;  3ONP A;  4YQR A;  4KGN A;  4JWH A;  4YQN A;  4YQ6 A;  4FMW A;  1TO0 A;  1VHK A;  4YQ7 A;  4FAK A;  1VH0 A;  3NK7 A;  3O7B A;  3OIN A;  2V3K A;  3L8U A;  4JWJ A;  2QWV A;  4L69 A;  3E5Y A;  1GZ0 A;  1IPA A;  4PZK A;  1J85 A;  2HA8 A;  4X3M A;  4YQP A;  2O3A A;  4JWF A;  1V6Z A;  3KTY A;  4YPW A;  4YQA A;  1ZJR A;  3N4J A;  4YQT A;  1V2X A;  4MCC A;  1P9P A;  1UAM A;  4YQ9 A;  4IG6 A;  4YQK A;  4H3Y A;  5GM8 A;  4YVJ A;  4YQ4 A;  4YQ5 A;  3IC6 A;  4YPZ A;  1MXI A;  5GMB A;  4YQ1 A;  1NXZ A;  5FAI A;  3OIJ A;  1OY5 A;  4YVG A;  5CO4 A;  3KW2 A;  2QMM A;  4YQ3 A;  4JAK A;  4JAL A;  3IEF A;  3QUV A;  4XBO A;  4YQG A;  3GYQ A;  3BBD A;  3NK6 A;  3ILK A;  3BBE A;  4YVI A;  4YQO A;  2CX8 A; 
#chains in the Genus database with same CATH homology
 2EGV A;  1X7O A;  1VHY A;  4YQI A;  4YQ0 A;  5D9F A;  3KY7 A;  1O6D A;  3N4K A;  4CNE A;  4YQC A;  2YY8 A;  2V3J A;  4CNG A;  4YQS A;  4YQB A;  4YPX A;  4E8B A;  3OII A;  3AXZ A;  3AIA A;  4YPY A;  4YQJ A;  2EGW A;  3KNU A;  4YQQ A;  4YQ8 A;  1UAK A;  4J3C A;  2Z0Y A;  4JWG A;  1UAJ A;  4RG1 A;  4YVH A;  4MCB A;  3DCM X;  4YQL A;  3AI9 X;  2I6D A;  4YVK A;  1UAL A;  1K3R A;  4CND A;  1NS5 A;  4X3L A;  1X7P A;  1Z85 A;  4YQD A;  4YQ2 A;  4MCD A;  3BBH A;  5GMC A;  4CNF A;  4H3Z A;  4KDZ A;  3ONP A;  4YQR A;  4KGN A;  4JWH A;  4YQN A;  4YQ6 A;  4FMW A;  1TO0 A;  1VHK A;  4YQ7 A;  4FAK A;  1VH0 A;  3NK7 A;  3O7B A;  3OIN A;  2V3K A;  3L8U A;  4JWJ A;  2QWV A;  4L69 A;  3E5Y A;  1GZ0 A;  1IPA A;  4PZK A;  1J85 A;  2HA8 A;  4X3M A;  4YQP A;  2O3A A;  4JWF A;  1V6Z A;  3KTY A;  4YPW A;  4YQA A;  1ZJR A;  3N4J A;  4YQT A;  1V2X A;  4MCC A;  1P9P A;  1UAM A;  4YQ9 A;  4IG6 A;  4YQK A;  4H3Y A;  5GM8 A;  4YVJ A;  4YQ4 A;  4YQ5 A;  3IC6 A;  4YPZ A;  1MXI A;  5GMB A;  4YQ1 A;  1NXZ A;  5FAI A;  3OIJ A;  1OY5 A;  4YVG A;  5CO4 A;  3KW2 A;  2QMM A;  4YQ3 A;  4JAK A;  4JAL A;  3IEF A;  3QUV A;  4XBO A;  4YQG A;  3GYQ A;  3BBD A;  3NK6 A;  3ILK A;  3BBE A;  4YVI A;  4YQO A;  2CX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...