4FMWA

Crystal structure of methyltransferase domain of human rna (guanine-9-) methyltransferase domain containing protein 2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
182
structure length
178
Chain Sequence
RDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVRKVLAVNHVFEIILEYLETRDWQEAFFTILPQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA (guanine-9-)-methyltransferase domain-containing protein
publication title Crystal structure of methyltransferase domain of human RNA (guanine-9-) methyltransferase domain containing protein 2
rcsb
source organism Homo sapiens
total genus 58
structure length 178
sequence length 182
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.30 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4fmwA00
4FMWA 4JWFA 4JWHA 4JWGA 4JWJA
chains in the Genus database with same CATH superfamily
5GMCA 4E8BA 4L69A 3KNUA 3O7BA 2Z0YA 4YQ7A 4H3ZA 4CNFA 4YQNA 3NK6A 4YQTA 2EGVA 4CNDA 1UAMA 1V6ZA 1TO0A 2YY8A 3AXZA 4X3LA 4YQSA 4YQDA 4YQRA 5FAIA 4YPZA 3ONPA 3IEFA 1UAKA 1VHYA 1VH0A 1NS5A 4YQ9A 4YQCA 3ILKA 3OIIA 4RG1A 4YQJA 1IPAA 3AIAA 1MXIA 1P9PA 2V3JA 2QMMA 5GM8A 3BBDA 4YQ4A 4J3CA 4FAKA 3KY7A 3DCMX 2V3KA 3AI9X 3IC6A 4YQAA 4YQBA 3NK7A 1X7PA 3OIJA 1VHKA 5GMBA 1J85A 3N4JA 4MCCA 4JWJA 4YQGA 4MCBA 4YVIA 4YQ8A 4YVJA 2I6DA 2O3AA 3L8UA 4YVGA 4YQLA 4CNGA 4YPYA 4YQ5A 2CX8A 3KTYA 4YVHA 4H3YA 4YQOA 3BBHA 3N4KA 4CNEA 4KDZA 5CO4A 4YQ0A 1UAJA 4FMWA 4YQ3A 4IG6A 4JALA 4KGNA 4PZKA 4MCDA 1NXZA 4XBOA 4YQ2A 3BBEA 1GZ0A 1X7OA 1OY5A 4JWFA 4YQ6A 4JWHA 5D9FA 4YPXA 4YQ1A 1UALA 3GYQA 4X3MA 4YQPA 4YVKA 4JWGA 2QWVA 3QUVA 4YQIA 2HA8A 3KW2A 4YQQA 1K3RA 2EGWA 4YPWA 1ZJRA 1V2XA 4YQKA 3OINA 1O6DA 1Z85A 4JAKA 3E5YA
chains in the Genus database with same CATH topology
5GMCA 4E8BA 4L69A 3KNUA 3O7BA 2Z0YA 4YQ7A 4H3ZA 4CNFA 4YQNA 3NK6A 4YQTA 2EGVA 4CNDA 1UAMA 1V6ZA 1TO0A 2YY8A 3AXZA 4X3LA 4YQSA 4YQDA 4YQRA 5FAIA 4YPZA 3ONPA 3IEFA 1UAKA 1VHYA 1VH0A 1NS5A 4YQ9A 4YQCA 3ILKA 3OIIA 4RG1A 4YQJA 1IPAA 3AIAA 1MXIA 1P9PA 2V3JA 2QMMA 5GM8A 3BBDA 4YQ4A 4J3CA 4FAKA 3KY7A 3DCMX 2V3KA 3AI9X 3IC6A 4YQAA 4YQBA 3NK7A 1X7PA 3OIJA 1VHKA 5GMBA 1J85A 3N4JA 4MCCA 4JWJA 4YQGA 4MCBA 4YVIA 4YQ8A 4YVJA 2I6DA 2O3AA 3L8UA 4YVGA 4YQLA 4CNGA 4YPYA 4YQ5A 2CX8A 3KTYA 4YVHA 4H3YA 4YQOA 3BBHA 3N4KA 4CNEA 4KDZA 5CO4A 4YQ0A 1UAJA 4FMWA 4YQ3A 4IG6A 4JALA 4KGNA 4PZKA 4MCDA 1NXZA 4XBOA 4YQ2A 3BBEA 1GZ0A 1X7OA 1OY5A 4JWFA 4YQ6A 4JWHA 5D9FA 4YPXA 4YQ1A 1UALA 3GYQA 4X3MA 4YQPA 4YVKA 4JWGA 2QWVA 3QUVA 4YQIA 2HA8A 3KW2A 4YQQA 1K3RA 2EGWA 4YPWA 1ZJRA 1V2XA 4YQKA 3OINA 1O6DA 1Z85A 4JAKA 3E5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMW A;  4JWF A;  4JWH A;  4JWG A;  4JWJ A; 
#chains in the Genus database with same CATH topology
 5GMC A;  4E8B A;  4L69 A;  3KNU A;  3O7B A;  2Z0Y A;  4YQ7 A;  4H3Z A;  4CNF A;  4YQN A;  3NK6 A;  4YQT A;  2EGV A;  4CND A;  1UAM A;  1V6Z A;  1TO0 A;  2YY8 A;  3AXZ A;  4X3L A;  4YQS A;  4YQD A;  4YQR A;  5FAI A;  4YPZ A;  3ONP A;  3IEF A;  1UAK A;  1VHY A;  1VH0 A;  1NS5 A;  4YQ9 A;  4YQC A;  3ILK A;  3OII A;  4RG1 A;  4YQJ A;  1IPA A;  3AIA A;  1MXI A;  1P9P A;  2V3J A;  2QMM A;  5GM8 A;  3BBD A;  4YQ4 A;  4J3C A;  4FAK A;  3KY7 A;  3DCM X;  2V3K A;  3AI9 X;  3IC6 A;  4YQA A;  4YQB A;  3NK7 A;  1X7P A;  3OIJ A;  1VHK A;  5GMB A;  1J85 A;  3N4J A;  4MCC A;  4JWJ A;  4YQG A;  4MCB A;  4YVI A;  4YQ8 A;  4YVJ A;  2I6D A;  2O3A A;  3L8U A;  4YVG A;  4YQL A;  4CNG A;  4YPY A;  4YQ5 A;  2CX8 A;  3KTY A;  4YVH A;  4H3Y A;  4YQO A;  3BBH A;  3N4K A;  4CNE A;  4KDZ A;  5CO4 A;  4YQ0 A;  1UAJ A;  4FMW A;  4YQ3 A;  4IG6 A;  4JAL A;  4KGN A;  4PZK A;  4MCD A;  1NXZ A;  4XBO A;  4YQ2 A;  3BBE A;  1GZ0 A;  1X7O A;  1OY5 A;  4JWF A;  4YQ6 A;  4JWH A;  5D9F A;  4YPX A;  4YQ1 A;  1UAL A;  3GYQ A;  4X3M A;  4YQP A;  4YVK A;  4JWG A;  2QWV A;  3QUV A;  4YQI A;  2HA8 A;  3KW2 A;  4YQQ A;  1K3R A;  2EGW A;  4YPW A;  1ZJR A;  1V2X A;  4YQK A;  3OIN A;  1O6D A;  1Z85 A;  4JAK A;  3E5Y A; 
#chains in the Genus database with same CATH homology
 5GMC A;  4E8B A;  4L69 A;  3KNU A;  3O7B A;  2Z0Y A;  4YQ7 A;  4H3Z A;  4CNF A;  4YQN A;  3NK6 A;  4YQT A;  2EGV A;  4CND A;  1UAM A;  1V6Z A;  1TO0 A;  2YY8 A;  3AXZ A;  4X3L A;  4YQS A;  4YQD A;  4YQR A;  5FAI A;  4YPZ A;  3ONP A;  3IEF A;  1UAK A;  1VHY A;  1VH0 A;  1NS5 A;  4YQ9 A;  4YQC A;  3ILK A;  3OII A;  4RG1 A;  4YQJ A;  1IPA A;  3AIA A;  1MXI A;  1P9P A;  2V3J A;  2QMM A;  5GM8 A;  3BBD A;  4YQ4 A;  4J3C A;  4FAK A;  3KY7 A;  3DCM X;  2V3K A;  3AI9 X;  3IC6 A;  4YQA A;  4YQB A;  3NK7 A;  1X7P A;  3OIJ A;  1VHK A;  5GMB A;  1J85 A;  3N4J A;  4MCC A;  4JWJ A;  4YQG A;  4MCB A;  4YVI A;  4YQ8 A;  4YVJ A;  2I6D A;  2O3A A;  3L8U A;  4YVG A;  4YQL A;  4CNG A;  4YPY A;  4YQ5 A;  2CX8 A;  3KTY A;  4YVH A;  4H3Y A;  4YQO A;  3BBH A;  3N4K A;  4CNE A;  4KDZ A;  5CO4 A;  4YQ0 A;  1UAJ A;  4FMW A;  4YQ3 A;  4IG6 A;  4JAL A;  4KGN A;  4PZK A;  4MCD A;  1NXZ A;  4XBO A;  4YQ2 A;  3BBE A;  1GZ0 A;  1X7O A;  1OY5 A;  4JWF A;  4YQ6 A;  4JWH A;  5D9F A;  4YPX A;  4YQ1 A;  1UAL A;  3GYQ A;  4X3M A;  4YQP A;  4YVK A;  4JWG A;  2QWV A;  3QUV A;  4YQI A;  2HA8 A;  3KW2 A;  4YQQ A;  1K3R A;  2EGW A;  4YPW A;  1ZJR A;  1V2X A;  4YQK A;  3OIN A;  1O6D A;  1Z85 A;  4JAK A;  3E5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...