4JALA

Crystal structure of trna (um34/cm34) methyltransferase trml from escherichia coli with sah
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
Knots found
sequence length
156
structure length
156
Chain Sequence
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
molecule tags Transferase
source organism Escherichia coli
total genus 48
structure length 156
sequence length 156
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2013-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4jalA00
1V2XA 3IEFA 4YQBA 3NK7A 3BBHA 4FAKA 3QUVA 4JAKA 4IG6A 1OY5A 4YQPA 4YQOA 3KW2A 3ONPA 4CNGA 3BBDA 4YQ5A 1VHKA 1GZ0A 1Z85A 4YQ6A 3AI9X 5FAIA 4YPZA 4RG1A 4YQ0A 4YQNA 4H3YA 4CNFA 1O6DA 4H3ZA 4MCBA 1MXIA 1ZJRA 4YQKA 5CO4A 2EGVA 3NK6A 4YPXA 4YQLA 2EGWA 3AIAA 3BBEA 2O3AA 2V3JA 4MCDA 4YQJA 4YVIA 4L69A 1X7PA 1K3RA 1X7OA 1NXZA 3GYQA 4KDZA 4YQAA 4YQIA 4JALA 3E5YA 2HA8A 3AXZA 3N4JA 2V3KA 4YPYA 3KY7A 3DCMX 4YVKA 4YQ4A 3KNUA 1UAJA 2QWVA 4CNEA 4YQ8A 4YQ3A 4YQCA 3IC6A 1J85A 3L8UA 1IPAA 4CNDA 3KTYA 1NS5A 5GMBA 4YPWA 4YQQA 1V6ZA 1UAKA 4KGNA 2QMMA 1VH0A 4YQSA 5GMCA 4J3CA 4X3MA 4YQGA 4X3LA 4PZKA 4YQ1A 4YQ9A 1UAMA 4YVGA 4MCCA 4YQRA 1VHYA 1UALA 4YQ7A 2I6DA 1P9PA 4YQTA 1TO0A 2Z0YA 4YVHA 3O7BA 2YY8A 3ILKA 4E8BA 3OINA 3OIIA 4YVJA 4XBOA 4YQ2A 5GM8A 2CX8A 4YQDA 3OIJA 5D9FA 3N4KA
chains in the Genus database with same CATH superfamily
1V2XA 3IEFA 4YQBA 3NK7A 3BBHA 4FAKA 3QUVA 4JAKA 4IG6A 1OY5A 4YQPA 4YQOA 3KW2A 3ONPA 4CNGA 3BBDA 4YQ5A 4JWFA 1VHKA 1GZ0A 1Z85A 4YQ6A 3AI9X 5FAIA 4YPZA 4RG1A 4YQ0A 4YQNA 4H3YA 4CNFA 1O6DA 4H3ZA 4MCBA 1MXIA 1ZJRA 4YQKA 5CO4A 2EGVA 3NK6A 4YPXA 4YQLA 2EGWA 3AIAA 3BBEA 2O3AA 2V3JA 4MCDA 4YQJA 4YVIA 4L69A 1X7PA 4JWJA 1K3RA 1X7OA 1NXZA 3GYQA 4KDZA 4YQAA 4YQIA 4JALA 3E5YA 2HA8A 3AXZA 3N4JA 2V3KA 4YPYA 3KY7A 3DCMX 4YVKA 4YQ4A 3KNUA 1UAJA 2QWVA 4CNEA 4YQ8A 4YQ3A 4YQCA 4FMWA 3IC6A 1J85A 3L8UA 1IPAA 4CNDA 3KTYA 1NS5A 5GMBA 4YPWA 4YQQA 1V6ZA 1UAKA 4KGNA 2QMMA 1VH0A 4JWHA 4YQSA 5GMCA 4J3CA 4X3MA 4YQGA 4X3LA 4PZKA 4YQ1A 4YQ9A 1UAMA 4YVGA 4MCCA 4YQRA 1VHYA 1UALA 4YQ7A 2I6DA 4JWGA 1P9PA 4YQTA 1TO0A 2Z0YA 4YVHA 3O7BA 2YY8A 3ILKA 4E8BA 3OINA 3OIIA 4YVJA 4XBOA 4YQ2A 5GM8A 2CX8A 4YQDA 3OIJA 5D9FA 3N4KA
chains in the Genus database with same CATH topology
1V2XA 3IEFA 4YQBA 3NK7A 3BBHA 4FAKA 3QUVA 4JAKA 4IG6A 1OY5A 4YQPA 4YQOA 3KW2A 3ONPA 4CNGA 3BBDA 4YQ5A 4JWFA 1VHKA 1GZ0A 1Z85A 4YQ6A 3AI9X 5FAIA 4YPZA 4RG1A 4YQ0A 4YQNA 4H3YA 4CNFA 1O6DA 4H3ZA 4MCBA 1MXIA 1ZJRA 4YQKA 5CO4A 2EGVA 3NK6A 4YPXA 4YQLA 2EGWA 3AIAA 3BBEA 2O3AA 2V3JA 4MCDA 4YQJA 4YVIA 4L69A 1X7PA 4JWJA 1K3RA 1X7OA 1NXZA 3GYQA 4KDZA 4YQAA 4YQIA 4JALA 3E5YA 2HA8A 3AXZA 3N4JA 2V3KA 4YPYA 3KY7A 3DCMX 4YVKA 4YQ4A 3KNUA 1UAJA 2QWVA 4CNEA 4YQ8A 4YQ3A 4YQCA 4FMWA 3IC6A 1J85A 3L8UA 1IPAA 4CNDA 3KTYA 1NS5A 5GMBA 4YPWA 4YQQA 1V6ZA 1UAKA 4KGNA 2QMMA 1VH0A 4JWHA 4YQSA 5GMCA 4J3CA 4X3MA 4YQGA 4X3LA 4PZKA 4YQ1A 4YQ9A 1UAMA 4YVGA 4MCCA 4YQRA 1VHYA 1UALA 4YQ7A 2I6DA 4JWGA 1P9PA 4YQTA 1TO0A 2Z0YA 4YVHA 3O7BA 2YY8A 3ILKA 4E8BA 3OINA 3OIIA 4YVJA 4XBOA 4YQ2A 5GM8A 2CX8A 4YQDA 3OIJA 5D9FA 3N4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V2X A;  3IEF A;  4YQB A;  3NK7 A;  3BBH A;  4FAK A;  3QUV A;  4JAK A;  4IG6 A;  1OY5 A;  4YQP A;  4YQO A;  3KW2 A;  3ONP A;  4CNG A;  3BBD A;  4YQ5 A;  1VHK A;  1GZ0 A;  1Z85 A;  4YQ6 A;  3AI9 X;  5FAI A;  4YPZ A;  4RG1 A;  4YQ0 A;  4YQN A;  4H3Y A;  4CNF A;  1O6D A;  4H3Z A;  4MCB A;  1MXI A;  1ZJR A;  4YQK A;  5CO4 A;  2EGV A;  3NK6 A;  4YPX A;  4YQL A;  2EGW A;  3AIA A;  3BBE A;  2O3A A;  2V3J A;  4MCD A;  4YQJ A;  4YVI A;  4L69 A;  1X7P A;  1K3R A;  1X7O A;  1NXZ A;  3GYQ A;  4KDZ A;  4YQA A;  4YQI A;  4JAL A;  3E5Y A;  2HA8 A;  3AXZ A;  3N4J A;  2V3K A;  4YPY A;  3KY7 A;  3DCM X;  4YVK A;  4YQ4 A;  3KNU A;  1UAJ A;  2QWV A;  4CNE A;  4YQ8 A;  4YQ3 A;  4YQC A;  3IC6 A;  1J85 A;  3L8U A;  1IPA A;  4CND A;  3KTY A;  1NS5 A;  5GMB A;  4YPW A;  4YQQ A;  1V6Z A;  1UAK A;  4KGN A;  2QMM A;  1VH0 A;  4YQS A;  5GMC A;  4J3C A;  4X3M A;  4YQG A;  4X3L A;  4PZK A;  4YQ1 A;  4YQ9 A;  1UAM A;  4YVG A;  4MCC A;  4YQR A;  1VHY A;  1UAL A;  4YQ7 A;  2I6D A;  1P9P A;  4YQT A;  1TO0 A;  2Z0Y A;  4YVH A;  3O7B A;  2YY8 A;  3ILK A;  4E8B A;  3OIN A;  3OII A;  4YVJ A;  4XBO A;  4YQ2 A;  5GM8 A;  2CX8 A;  4YQD A;  3OIJ A;  5D9F A;  3N4K A; 
#chains in the Genus database with same CATH topology
 1V2X A;  3IEF A;  4YQB A;  3NK7 A;  3BBH A;  4FAK A;  3QUV A;  4JAK A;  4IG6 A;  1OY5 A;  4YQP A;  4YQO A;  3KW2 A;  3ONP A;  4CNG A;  3BBD A;  4YQ5 A;  4JWF A;  1VHK A;  1GZ0 A;  1Z85 A;  4YQ6 A;  3AI9 X;  5FAI A;  4YPZ A;  4RG1 A;  4YQ0 A;  4YQN A;  4H3Y A;  4CNF A;  1O6D A;  4H3Z A;  4MCB A;  1MXI A;  1ZJR A;  4YQK A;  5CO4 A;  2EGV A;  3NK6 A;  4YPX A;  4YQL A;  2EGW A;  3AIA A;  3BBE A;  2O3A A;  2V3J A;  4MCD A;  4YQJ A;  4YVI A;  4L69 A;  1X7P A;  4JWJ A;  1K3R A;  1X7O A;  1NXZ A;  3GYQ A;  4KDZ A;  4YQA A;  4YQI A;  4JAL A;  3E5Y A;  2HA8 A;  3AXZ A;  3N4J A;  2V3K A;  4YPY A;  3KY7 A;  3DCM X;  4YVK A;  4YQ4 A;  3KNU A;  1UAJ A;  2QWV A;  4CNE A;  4YQ8 A;  4YQ3 A;  4YQC A;  4FMW A;  3IC6 A;  1J85 A;  3L8U A;  1IPA A;  4CND A;  3KTY A;  1NS5 A;  5GMB A;  4YPW A;  4YQQ A;  1V6Z A;  1UAK A;  4KGN A;  2QMM A;  1VH0 A;  4JWH A;  4YQS A;  5GMC A;  4J3C A;  4X3M A;  4YQG A;  4X3L A;  4PZK A;  4YQ1 A;  4YQ9 A;  1UAM A;  4YVG A;  4MCC A;  4YQR A;  1VHY A;  1UAL A;  4YQ7 A;  2I6D A;  4JWG A;  1P9P A;  4YQT A;  1TO0 A;  2Z0Y A;  4YVH A;  3O7B A;  2YY8 A;  3ILK A;  4E8B A;  3OIN A;  3OII A;  4YVJ A;  4XBO A;  4YQ2 A;  5GM8 A;  2CX8 A;  4YQD A;  3OIJ A;  5D9F A;  3N4K A; 
#chains in the Genus database with same CATH homology
 1V2X A;  3IEF A;  4YQB A;  3NK7 A;  3BBH A;  4FAK A;  3QUV A;  4JAK A;  4IG6 A;  1OY5 A;  4YQP A;  4YQO A;  3KW2 A;  3ONP A;  4CNG A;  3BBD A;  4YQ5 A;  4JWF A;  1VHK A;  1GZ0 A;  1Z85 A;  4YQ6 A;  3AI9 X;  5FAI A;  4YPZ A;  4RG1 A;  4YQ0 A;  4YQN A;  4H3Y A;  4CNF A;  1O6D A;  4H3Z A;  4MCB A;  1MXI A;  1ZJR A;  4YQK A;  5CO4 A;  2EGV A;  3NK6 A;  4YPX A;  4YQL A;  2EGW A;  3AIA A;  3BBE A;  2O3A A;  2V3J A;  4MCD A;  4YQJ A;  4YVI A;  4L69 A;  1X7P A;  4JWJ A;  1K3R A;  1X7O A;  1NXZ A;  3GYQ A;  4KDZ A;  4YQA A;  4YQI A;  4JAL A;  3E5Y A;  2HA8 A;  3AXZ A;  3N4J A;  2V3K A;  4YPY A;  3KY7 A;  3DCM X;  4YVK A;  4YQ4 A;  3KNU A;  1UAJ A;  2QWV A;  4CNE A;  4YQ8 A;  4YQ3 A;  4YQC A;  4FMW A;  3IC6 A;  1J85 A;  3L8U A;  1IPA A;  4CND A;  3KTY A;  1NS5 A;  5GMB A;  4YPW A;  4YQQ A;  1V6Z A;  1UAK A;  4KGN A;  2QMM A;  1VH0 A;  4JWH A;  4YQS A;  5GMC A;  4J3C A;  4X3M A;  4YQG A;  4X3L A;  4PZK A;  4YQ1 A;  4YQ9 A;  1UAM A;  4YVG A;  4MCC A;  4YQR A;  1VHY A;  1UAL A;  4YQ7 A;  2I6D A;  4JWG A;  1P9P A;  4YQT A;  1TO0 A;  2Z0Y A;  4YVH A;  3O7B A;  2YY8 A;  3ILK A;  4E8B A;  3OIN A;  3OII A;  4YVJ A;  4XBO A;  4YQ2 A;  5GM8 A;  2CX8 A;  4YQD A;  3OIJ A;  5D9F A;  3N4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...