5GMCA

Methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
Knots found
sequence length
174
structure length
174
Chain Sequence
NLYFQSMMLDRIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARASGATDILDAARVVDTLEEALSGCSVVLGTSARDRRIPWPLLDPRECATTCLEHLEANGEVALVFGREYAGLTNEELQRCQFHVHIPSDPEFGSLNLAAAVQVLTYEVRMAWLAAQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
publication title Methylation at position 32 of tRNA catalyzed by TrmJ alters oxidative stress response in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 174
sequence length 174
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 5gmcA01
2EGWA 4YVKA 4E8BA 3N4JA 5GM8A 1NS5A 2QMMA 3OIJA 1VH0A 5GMBA 1UAJA 4YVGA 1OY5A 4FAKA 5GMCA 4YVJA 4YQSA 1V2XA 4YQDA 1TO0A 4MCBA 3L8UA 4YQ2A 4X3LA 4JALA 4YQTA 2I6DA 3NK6A 1GZ0A 4KGNA 1K3RA 3OINA 4YPXA 4MCDA 3AI9X 4YVIA 4YQ3A 3GYQA 4L69A 4YQIA 4J3CA 2O3AA 4YQ7A 3DCMX 1MXIA 4YQCA 5FAIA 4YQ4A 4YQRA 2Z0YA 3AXZA 3BBHA 4YQNA 4CNGA 4YQPA 1J85A 3KW2A 1IPAA 1V6ZA 5D9FA 1P9PA 4YQQA 4YQJA 2YY8A 4MCCA 1X7PA 4YQKA 4YQ0A 1VHYA 1Z85A 4IG6A 3ILKA 4CNFA 1UAKA 3KY7A 1UALA 2V3JA 3BBDA 4YQGA 3QUVA 4YQOA 4YQ8A 1UAMA 2QWVA 3ONPA 3AIAA 3KTYA 1VHKA 4YPYA 4RG1A 4YQ9A 3OIIA 3KNUA 3N4KA 4H3ZA 3IC6A 4H3YA 4YPWA 3O7BA 4YQ1A 3NK7A 4YPZA 4CNEA 4YVHA 4YQ6A 1X7OA 4CNDA 2EGVA 2V3KA 4X3MA 1ZJRA 4YQBA 1NXZA 1O6DA 4YQ5A 3E5YA 4JAKA 4YQLA 4XBOA 3BBEA 4YQAA 2HA8A 4PZKA 3IEFA 4KDZA 5CO4A 2CX8A
chains in the Genus database with same CATH superfamily
2EGWA 4YVKA 4E8BA 3N4JA 5GM8A 1NS5A 2QMMA 3OIJA 1VH0A 5GMBA 1UAJA 4YVGA 1OY5A 4FAKA 5GMCA 4YVJA 4YQSA 1V2XA 4JWFA 4YQDA 1TO0A 4MCBA 3L8UA 4YQ2A 4X3LA 4JALA 4YQTA 2I6DA 4JWGA 3NK6A 1GZ0A 4KGNA 1K3RA 3OINA 4YPXA 4MCDA 3AI9X 4YVIA 4YQ3A 4FMWA 3GYQA 4L69A 4YQIA 4J3CA 2O3AA 4YQ7A 3DCMX 1MXIA 4YQCA 5FAIA 4YQ4A 4YQRA 2Z0YA 3AXZA 3BBHA 4YQNA 4CNGA 4YQPA 1J85A 3KW2A 1IPAA 1V6ZA 5D9FA 1P9PA 4YQQA 4YQJA 2YY8A 1X7PA 4MCCA 4YQKA 4YQ0A 1VHYA 1Z85A 4IG6A 3ILKA 4CNFA 1UAKA 3KY7A 1UALA 2V3JA 3BBDA 4YQGA 3QUVA 4YQOA 4YQ8A 1UAMA 4JWJA 2QWVA 3ONPA 3AIAA 3KTYA 1VHKA 4YPYA 4RG1A 4YQ9A 3OIIA 3KNUA 3N4KA 4H3ZA 3IC6A 4H3YA 4YPWA 3O7BA 4YQ1A 3NK7A 4YPZA 4CNEA 4YVHA 4YQ6A 1X7OA 4CNDA 2EGVA 2V3KA 4X3MA 1ZJRA 4YQBA 1NXZA 1O6DA 4YQ5A 3E5YA 4JAKA 4YQLA 4XBOA 3BBEA 4YQAA 2HA8A 4PZKA 3IEFA 4JWHA 4KDZA 5CO4A 2CX8A
chains in the Genus database with same CATH topology
2EGWA 4YVKA 4E8BA 3N4JA 5GM8A 1NS5A 2QMMA 3OIJA 1VH0A 5GMBA 1UAJA 4YVGA 1OY5A 4FAKA 5GMCA 4YVJA 4YQSA 1V2XA 4JWFA 4YQDA 1TO0A 4MCBA 3L8UA 4YQ2A 4X3LA 4JALA 4YQTA 2I6DA 4JWGA 3NK6A 1GZ0A 4KGNA 1K3RA 3OINA 4YPXA 4MCDA 3AI9X 4YVIA 4YQ3A 4FMWA 3GYQA 4L69A 4YQIA 4J3CA 2O3AA 4YQ7A 3DCMX 1MXIA 4YQCA 5FAIA 4YQ4A 4YQRA 2Z0YA 3AXZA 3BBHA 4YQNA 4CNGA 4YQPA 1J85A 3KW2A 1IPAA 1V6ZA 5D9FA 1P9PA 4YQQA 4YQJA 2YY8A 1X7PA 4MCCA 4YQKA 4YQ0A 1VHYA 1Z85A 4IG6A 3ILKA 4CNFA 1UAKA 3KY7A 1UALA 2V3JA 3BBDA 4YQGA 3QUVA 4YQOA 4YQ8A 1UAMA 4JWJA 2QWVA 3ONPA 3AIAA 3KTYA 1VHKA 4YPYA 4RG1A 4YQ9A 3OIIA 3KNUA 3N4KA 4H3ZA 3IC6A 4H3YA 4YPWA 3O7BA 4YQ1A 3NK7A 4YPZA 4CNEA 4YVHA 4YQ6A 1X7OA 4CNDA 2EGVA 2V3KA 4X3MA 1ZJRA 4YQBA 1NXZA 1O6DA 4YQ5A 3E5YA 4JAKA 4YQLA 4XBOA 3BBEA 4YQAA 2HA8A 4PZKA 3IEFA 4JWHA 4KDZA 5CO4A 2CX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGW A;  4YVK A;  4E8B A;  3N4J A;  5GM8 A;  1NS5 A;  2QMM A;  3OIJ A;  1VH0 A;  5GMB A;  1UAJ A;  4YVG A;  1OY5 A;  4FAK A;  5GMC A;  4YVJ A;  4YQS A;  1V2X A;  4YQD A;  1TO0 A;  4MCB A;  3L8U A;  4YQ2 A;  4X3L A;  4JAL A;  4YQT A;  2I6D A;  3NK6 A;  1GZ0 A;  4KGN A;  1K3R A;  3OIN A;  4YPX A;  4MCD A;  3AI9 X;  4YVI A;  4YQ3 A;  3GYQ A;  4L69 A;  4YQI A;  4J3C A;  2O3A A;  4YQ7 A;  3DCM X;  1MXI A;  4YQC A;  5FAI A;  4YQ4 A;  4YQR A;  2Z0Y A;  3AXZ A;  3BBH A;  4YQN A;  4CNG A;  4YQP A;  1J85 A;  3KW2 A;  1IPA A;  1V6Z A;  5D9F A;  1P9P A;  4YQQ A;  4YQJ A;  2YY8 A;  4MCC A;  1X7P A;  4YQK A;  4YQ0 A;  1VHY A;  1Z85 A;  4IG6 A;  3ILK A;  4CNF A;  1UAK A;  3KY7 A;  1UAL A;  2V3J A;  3BBD A;  4YQG A;  3QUV A;  4YQO A;  4YQ8 A;  1UAM A;  2QWV A;  3ONP A;  3AIA A;  3KTY A;  1VHK A;  4YPY A;  4RG1 A;  4YQ9 A;  3OII A;  3KNU A;  3N4K A;  4H3Z A;  3IC6 A;  4H3Y A;  4YPW A;  3O7B A;  4YQ1 A;  3NK7 A;  4YPZ A;  4CNE A;  4YVH A;  4YQ6 A;  1X7O A;  4CND A;  2EGV A;  2V3K A;  4X3M A;  1ZJR A;  4YQB A;  1NXZ A;  1O6D A;  4YQ5 A;  3E5Y A;  4JAK A;  4YQL A;  4XBO A;  3BBE A;  4YQA A;  2HA8 A;  4PZK A;  3IEF A;  4KDZ A;  5CO4 A;  2CX8 A; 
#chains in the Genus database with same CATH topology
 2EGW A;  4YVK A;  4E8B A;  3N4J A;  5GM8 A;  1NS5 A;  2QMM A;  3OIJ A;  1VH0 A;  5GMB A;  1UAJ A;  4YVG A;  1OY5 A;  4FAK A;  5GMC A;  4YVJ A;  4YQS A;  1V2X A;  4JWF A;  4YQD A;  1TO0 A;  4MCB A;  3L8U A;  4YQ2 A;  4X3L A;  4JAL A;  4YQT A;  2I6D A;  4JWG A;  3NK6 A;  1GZ0 A;  4KGN A;  1K3R A;  3OIN A;  4YPX A;  4MCD A;  3AI9 X;  4YVI A;  4YQ3 A;  4FMW A;  3GYQ A;  4L69 A;  4YQI A;  4J3C A;  2O3A A;  4YQ7 A;  3DCM X;  1MXI A;  4YQC A;  5FAI A;  4YQ4 A;  4YQR A;  2Z0Y A;  3AXZ A;  3BBH A;  4YQN A;  4CNG A;  4YQP A;  1J85 A;  3KW2 A;  1IPA A;  1V6Z A;  5D9F A;  1P9P A;  4YQQ A;  4YQJ A;  2YY8 A;  1X7P A;  4MCC A;  4YQK A;  4YQ0 A;  1VHY A;  1Z85 A;  4IG6 A;  3ILK A;  4CNF A;  1UAK A;  3KY7 A;  1UAL A;  2V3J A;  3BBD A;  4YQG A;  3QUV A;  4YQO A;  4YQ8 A;  1UAM A;  4JWJ A;  2QWV A;  3ONP A;  3AIA A;  3KTY A;  1VHK A;  4YPY A;  4RG1 A;  4YQ9 A;  3OII A;  3KNU A;  3N4K A;  4H3Z A;  3IC6 A;  4H3Y A;  4YPW A;  3O7B A;  4YQ1 A;  3NK7 A;  4YPZ A;  4CNE A;  4YVH A;  4YQ6 A;  1X7O A;  4CND A;  2EGV A;  2V3K A;  4X3M A;  1ZJR A;  4YQB A;  1NXZ A;  1O6D A;  4YQ5 A;  3E5Y A;  4JAK A;  4YQL A;  4XBO A;  3BBE A;  4YQA A;  2HA8 A;  4PZK A;  3IEF A;  4JWH A;  4KDZ A;  5CO4 A;  2CX8 A; 
#chains in the Genus database with same CATH homology
 2EGW A;  4YVK A;  4E8B A;  3N4J A;  5GM8 A;  1NS5 A;  2QMM A;  3OIJ A;  1VH0 A;  5GMB A;  1UAJ A;  4YVG A;  1OY5 A;  4FAK A;  5GMC A;  4YVJ A;  4YQS A;  1V2X A;  4JWF A;  4YQD A;  1TO0 A;  4MCB A;  3L8U A;  4YQ2 A;  4X3L A;  4JAL A;  4YQT A;  2I6D A;  4JWG A;  3NK6 A;  1GZ0 A;  4KGN A;  1K3R A;  3OIN A;  4YPX A;  4MCD A;  3AI9 X;  4YVI A;  4YQ3 A;  4FMW A;  3GYQ A;  4L69 A;  4YQI A;  4J3C A;  2O3A A;  4YQ7 A;  3DCM X;  1MXI A;  4YQC A;  5FAI A;  4YQ4 A;  4YQR A;  2Z0Y A;  3AXZ A;  3BBH A;  4YQN A;  4CNG A;  4YQP A;  1J85 A;  3KW2 A;  1IPA A;  1V6Z A;  5D9F A;  1P9P A;  4YQQ A;  4YQJ A;  2YY8 A;  1X7P A;  4MCC A;  4YQK A;  4YQ0 A;  1VHY A;  1Z85 A;  4IG6 A;  3ILK A;  4CNF A;  1UAK A;  3KY7 A;  1UAL A;  2V3J A;  3BBD A;  4YQG A;  3QUV A;  4YQO A;  4YQ8 A;  1UAM A;  4JWJ A;  2QWV A;  3ONP A;  3AIA A;  3KTY A;  1VHK A;  4YPY A;  4RG1 A;  4YQ9 A;  3OII A;  3KNU A;  3N4K A;  4H3Z A;  3IC6 A;  4H3Y A;  4YPW A;  3O7B A;  4YQ1 A;  3NK7 A;  4YPZ A;  4CNE A;  4YVH A;  4YQ6 A;  1X7O A;  4CND A;  2EGV A;  2V3K A;  4X3M A;  1ZJR A;  4YQB A;  1NXZ A;  1O6D A;  4YQ5 A;  3E5Y A;  4JAK A;  4YQL A;  4XBO A;  3BBE A;  4YQA A;  2HA8 A;  4PZK A;  3IEF A;  4JWH A;  4KDZ A;  5CO4 A;  2CX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...