1A1ZA

Fadd death effector domain, f25g mutant, nmr minimized average structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
MDPFLVLLHSVSSSLSSSELTELKGLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure and mutagenesis of the FADD (Mort1) death-effector domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords FADD PROTEIN
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1997-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1a1zA00
1YGOA 2KN6A 3EZQB 2M5VA 4A2WA 4E9MA 4N1LA 4M9SA 4LWDA 4IZ7B 2DO9A 2O71A 3MOPA 4QOBA 4N1KA 2L6AA 1Z6TA 2N1FA 1C15A 2YU0A 4N1JA 2MB9A 4F44A 2YQFA 4ZBWA 2BBZA 2LS7A 3YGSC 4D8OA 2F1SA 4NQKA 2DBHA 2BBRA 2MS8A 4O6XA 3MOPK 1D2ZB 1N3KA 2OF5A 3J63A 4IZ5E 4RHWA 4M9ZA 2KM6A 2YGSA 4JUPA 2MPCA 2MS7A 3EZQA 1WH4A 2DBGA 1CWWA 4P4HA 3KATA 1DDFA 2A5YB 4FH0A 3QF2A 2B1WA 2HM2Q 2LWEA 2MN4A 1DGNA 1PN5A 1UCPA 2G7RA 2IB1A 4DWNA 4A2QA 4I16A 1A1ZA 1E3YA 2L9MA 4UZ0A 4EWIA 1WXPA 4O7QA 4O9FA 4O9LA 1WMGA 4IZAB 2N97A 2P1HA 3MOPG 2A9IA 2OF5H 1NGRA 3CL3A 3CRDA 1ICHA 2NZ7A 2D96A 2N80A 1A1WA 2DBDA 3LQQA 1E41A 1FADA 3T6PA 2N00A 2N7ZA 4M9XA 2YVIA 4P4HI 1D2ZA 4JQWA 3LQRA 1CY5A 2NSNA 2N83A 2VGQA 2DBFA 4RHWE 3J6JA 2GF5A 4F42A 2LWDA 2NAQA 3YGSP
chains in the Genus database with same CATH superfamily
1YGOA 2KN6A 3EZQB 2M5VA 4A2WA 4E9MA 4N1LA 4M9SA 4LWDA 4IZ7B 2DO9A 2O71A 3MOPA 4QOBA 4N1KA 2L6AA 1Z6TA 2N1FA 2XV9A 1C15A 2YU0A 4N1JA 2MB9A 4F44A 2YQFA 4ZBWA 2BBZA 2LS7A 3YGSC 4D8OA 2F1SA 4NQKA 2DBHA 2BBRA 2MS8A 4O6XA 3MOPK 1D2ZB 1N3KA 2OF5A 3J63A 4IZ5E 4RHWA 4M9ZA 2KM6A 2YGSA 4JUPA 2MPCA 2MS7A 3EZQA 1WH4A 2DBGA 1CWWA 4P4HA 3KATA 1DDFA 2A5YB 4FH0A 3QF2A 2B1WA 2HM2Q 2LWEA 2MN4A 1DGNA 1PN5A 1UCPA 2G7RA 2IB1A 4DWNA 4A2QA 4I16A 2MJMA 1A1ZA 1E3YA 2L9MA 4UZ0A 4EWIA 1WXPA 4O7QA 4O9FA 4O9LA 1WMGA 4IZAB 2N97A 2P1HA 3MOPG 2A9IA 2OF5H 1NGRA 3CL3A 3CRDA 1ICHA 2NZ7A 2D96A 2N80A 1A1WA 2DBDA 3LQQA 1E41A 1FADA 3T6PA 2N00A 2N7ZA 4M9XA 2YVIA 4P4HI 1D2ZA 4JQWA 3LQRA 1CY5A 2NSNA 2N83A 2VGQA 2DBFA 4RHWE 3J6JA 2GF5A 4F42A 2LWDA 2NAQA 3YGSP
chains in the Genus database with same CATH topology
1YGOA 2KN6A 3EZQB 2M5VA 4A2WA 4E9MA 4N1LA 4M9SA 4LWDA 4IZ7B 2DO9A 2O71A 3MOPA 4QOBA 4N1KA 2L6AA 1Z6TA 2N1FA 2XV9A 1C15A 2YU0A 4N1JA 2MB9A 4F44A 2YQFA 4ZBWA 2BBZA 2LS7A 3YGSC 4D8OA 2F1SA 4NQKA 2DBHA 2BBRA 2MS8A 4O6XA 3MOPK 1D2ZB 1N3KA 2OF5A 3J63A 4IZ5E 4RHWA 4M9ZA 2KM6A 2YGSA 4JUPA 2MPCA 2MS7A 3EZQA 1WH4A 2DBGA 1CWWA 4P4HA 3KATA 1DDFA 2A5YB 4FH0A 3QF2A 2B1WA 2HM2Q 2LWEA 2MN4A 1DGNA 1PN5A 1UCPA 2G7RA 2IB1A 4DWNA 4A2QA 4I16A 2MJMA 1A1ZA 1E3YA 2L9MA 4UZ0A 4EWIA 1WXPA 4O7QA 4O9FA 4O9LA 1WMGA 4IZAB 2N97A 2P1HA 3MOPG 2A9IA 2OF5H 1NGRA 3CL3A 3CRDA 1ICHA 2NZ7A 2D96A 2N80A 1A1WA 2DBDA 3LQQA 1E41A 1FADA 3T6PA 2N00A 2N7ZA 4M9XA 2YVIA 4P4HI 1D2ZA 4JQWA 3LQRA 1CY5A 2NSNA 2N83A 2VGQA 2DBFA 4RHWE 3J6JA 2GF5A 4F42A 2LWDA 2NAQA 3YGSP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGO A;  2KN6 A;  3EZQ B;  2M5V A;  4A2W A;  4E9M A;  4N1L A;  4M9S A;  4LWD A;  4IZ7 B;  2DO9 A;  2O71 A;  3MOP A;  4QOB A;  4N1K A;  2L6A A;  1Z6T A;  2N1F A;  1C15 A;  2YU0 A;  4N1J A;  2MB9 A;  4F44 A;  2YQF A;  4ZBW A;  2BBZ A;  2LS7 A;  3YGS C;  4D8O A;  2F1S A;  4NQK A;  2DBH A;  2BBR A;  2MS8 A;  4O6X A;  3MOP K;  1D2Z B;  1N3K A;  2OF5 A;  3J63 A;  4IZ5 E;  4RHW A;  4M9Z A;  2KM6 A;  2YGS A;  4JUP A;  2MPC A;  2MS7 A;  3EZQ A;  1WH4 A;  2DBG A;  1CWW A;  4P4H A;  3KAT A;  1DDF A;  2A5Y B;  4FH0 A;  3QF2 A;  2B1W A;  2HM2 Q;  2LWE A;  2MN4 A;  1DGN A;  1PN5 A;  1UCP A;  2G7R A;  2IB1 A;  4DWN A;  4A2Q A;  4I16 A;  1A1Z A;  1E3Y A;  2L9M A;  4UZ0 A;  4EWI A;  1WXP A;  4O7Q A;  4O9F A;  4O9L A;  1WMG A;  4IZA B;  2N97 A;  2P1H A;  3MOP G;  2A9I A;  2OF5 H;  1NGR A;  3CL3 A;  3CRD A;  1ICH A;  2NZ7 A;  2D96 A;  2N80 A;  1A1W A;  2DBD A;  3LQQ A;  1E41 A;  1FAD A;  3T6P A;  2N00 A;  2N7Z A;  4M9X A;  2YVI A;  4P4H I;  1D2Z A;  4JQW A;  3LQR A;  1CY5 A;  2NSN A;  2N83 A;  2VGQ A;  2DBF A;  4RHW E;  3J6J A;  2GF5 A;  4F42 A;  2LWD A;  2NAQ A;  3YGS P; 
#chains in the Genus database with same CATH topology
 1YGO A;  2KN6 A;  3EZQ B;  2M5V A;  4A2W A;  4E9M A;  4N1L A;  4M9S A;  4LWD A;  4IZ7 B;  2DO9 A;  2O71 A;  3MOP A;  4QOB A;  4N1K A;  2L6A A;  1Z6T A;  2N1F A;  2XV9 A;  1C15 A;  2YU0 A;  4N1J A;  2MB9 A;  4F44 A;  2YQF A;  4ZBW A;  2BBZ A;  2LS7 A;  3YGS C;  4D8O A;  2F1S A;  4NQK A;  2DBH A;  2BBR A;  2MS8 A;  4O6X A;  3MOP K;  1D2Z B;  1N3K A;  2OF5 A;  3J63 A;  4IZ5 E;  4RHW A;  4M9Z A;  2KM6 A;  2YGS A;  4JUP A;  2MPC A;  2MS7 A;  3EZQ A;  1WH4 A;  2DBG A;  1CWW A;  4P4H A;  3KAT A;  1DDF A;  2A5Y B;  4FH0 A;  3QF2 A;  2B1W A;  2HM2 Q;  2LWE A;  2MN4 A;  1DGN A;  1PN5 A;  1UCP A;  2G7R A;  2IB1 A;  4DWN A;  4A2Q A;  4I16 A;  2MJM A;  1A1Z A;  1E3Y A;  2L9M A;  4UZ0 A;  4EWI A;  1WXP A;  4O7Q A;  4O9F A;  4O9L A;  1WMG A;  4IZA B;  2N97 A;  2P1H A;  3MOP G;  2A9I A;  2OF5 H;  1NGR A;  3CL3 A;  3CRD A;  1ICH A;  2NZ7 A;  2D96 A;  2N80 A;  1A1W A;  2DBD A;  3LQQ A;  1E41 A;  1FAD A;  3T6P A;  2N00 A;  2N7Z A;  4M9X A;  2YVI A;  4P4H I;  1D2Z A;  4JQW A;  3LQR A;  1CY5 A;  2NSN A;  2N83 A;  2VGQ A;  2DBF A;  4RHW E;  3J6J A;  2GF5 A;  4F42 A;  2LWD A;  2NAQ A;  3YGS P; 
#chains in the Genus database with same CATH homology
 1YGO A;  2KN6 A;  3EZQ B;  2M5V A;  4A2W A;  4E9M A;  4N1L A;  4M9S A;  4LWD A;  4IZ7 B;  2DO9 A;  2O71 A;  3MOP A;  4QOB A;  4N1K A;  2L6A A;  1Z6T A;  2N1F A;  2XV9 A;  1C15 A;  2YU0 A;  4N1J A;  2MB9 A;  4F44 A;  2YQF A;  4ZBW A;  2BBZ A;  2LS7 A;  3YGS C;  4D8O A;  2F1S A;  4NQK A;  2DBH A;  2BBR A;  2MS8 A;  4O6X A;  3MOP K;  1D2Z B;  1N3K A;  2OF5 A;  3J63 A;  4IZ5 E;  4RHW A;  4M9Z A;  2KM6 A;  2YGS A;  4JUP A;  2MPC A;  2MS7 A;  3EZQ A;  1WH4 A;  2DBG A;  1CWW A;  4P4H A;  3KAT A;  1DDF A;  2A5Y B;  4FH0 A;  3QF2 A;  2B1W A;  2HM2 Q;  2LWE A;  2MN4 A;  1DGN A;  1PN5 A;  1UCP A;  2G7R A;  2IB1 A;  4DWN A;  4A2Q A;  4I16 A;  2MJM A;  1A1Z A;  1E3Y A;  2L9M A;  4UZ0 A;  4EWI A;  1WXP A;  4O7Q A;  4O9F A;  4O9L A;  1WMG A;  4IZA B;  2N97 A;  2P1H A;  3MOP G;  2A9I A;  2OF5 H;  1NGR A;  3CL3 A;  3CRD A;  1ICH A;  2NZ7 A;  2D96 A;  2N80 A;  1A1W A;  2DBD A;  3LQQ A;  1E41 A;  1FAD A;  3T6P A;  2N00 A;  2N7Z A;  4M9X A;  2YVI A;  4P4H I;  1D2Z A;  4JQW A;  3LQR A;  1CY5 A;  2NSN A;  2N83 A;  2VGQ A;  2DBF A;  4RHW E;  3J6J A;  2GF5 A;  4F42 A;  2LWD A;  2NAQ A;  3YGS P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...