4O9LA

Crystal structure of horse mavs card domain mutant e26r
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
PHMTVAEDKTFQYIRQHHSNFSRIHVLRILPYLSCLTTSDQDRLRATYERWGNQDTLLELFTSLRRRNGWVHSLIGALRACELSGLADEVARIYHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the prion-like MAVS filaments in antiviral innate immunity.
pubmed rcsb
source organism Equus caballus
molecule tags Antiviral protein
molecule keywords mitochondrial antiviral signaling protein (MAVS)
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4o9lA00
1D2ZB 4QOBA 4P4HA 4UZ0A 1WXPA 3EZQB 1E41A 1WMGA 1ICHA 3YGSP 2N80A 2LWDA 4NQKA 3T6PA 4O9FA 2BBZA 1CWWA 4IZ5E 1E3YA 4E9MA 4DWNA 2BBRA 4A2WA 3CL3A 4N1KA 1A1ZA 2YVIA 4I16A 4O7QA 1YGOA 4F44A 4D8OA 1UCPA 4A2QA 3CRDA 3MOPA 4RHWE 2N83A 4RHWA 1NGRA 2OF5H 4LWDA 1DGNA 4O6XA 4N1LA 4N1JA 2D96A 3QF2A 4M9ZA 3EZQA 1Z6TA 1N3KA 2MS7A 4P4HI 1A1WA 3J6JA 2KN6A 2HM2Q 2LWEA 3MOPK 2M5VA 4EWIA 2LS7A 4IZ7B 2N00A 2VGQA 2N1FA 2DO9A 4IZAB 3KATA 3LQRA 1WH4A 2B1WA 2DBDA 2OF5A 4M9SA 2A5YB 2N7ZA 2A9IA 2N97A 2MN4A 4FH0A 4ZBWA 3LQQA 4JQWA 2IB1A 1DDFA 1FADA 2L9MA 2GF5A 2NSNA 2F1SA 2YU0A 2YGSA 2MB9A 2NAQA 2DBHA 2YQFA 1D2ZA 2G7RA 2KM6A 2NZ7A 2DBGA 2P1HA 1CY5A 3J63A 2O71A 2MS8A 1C15A 4JUPA 4F42A 4O9LA 3YGSC 4M9XA 2L6AA 1PN5A 2DBFA 2MPCA 3MOPG
chains in the Genus database with same CATH superfamily
1D2ZB 4QOBA 4P4HA 4UZ0A 1WXPA 3EZQB 1E41A 1WMGA 1ICHA 3YGSP 2N80A 2LWDA 4NQKA 3T6PA 4O9FA 2BBZA 1CWWA 4IZ5E 1E3YA 4E9MA 4DWNA 2BBRA 4A2WA 3CL3A 4N1KA 1A1ZA 2YVIA 4I16A 4O7QA 1YGOA 4F44A 4D8OA 1UCPA 4A2QA 3CRDA 3MOPA 4RHWE 2N83A 4RHWA 1NGRA 2OF5H 4LWDA 1DGNA 4O6XA 4N1LA 4N1JA 2D96A 3QF2A 4M9ZA 3EZQA 1Z6TA 1N3KA 2MS7A 4P4HI 1A1WA 3J6JA 2KN6A 2HM2Q 2LWEA 3MOPK 2M5VA 4EWIA 2LS7A 4IZ7B 2N00A 2VGQA 2N1FA 2DO9A 2MJMA 4IZAB 3KATA 3LQRA 1WH4A 2B1WA 2DBDA 2OF5A 4M9SA 2A5YB 2N7ZA 2A9IA 2N97A 2MN4A 4FH0A 4ZBWA 3LQQA 4JQWA 2IB1A 1DDFA 1FADA 2L9MA 2GF5A 2NSNA 2F1SA 2YU0A 2YGSA 2MB9A 2NAQA 2XV9A 2DBHA 2YQFA 1D2ZA 2G7RA 2KM6A 2NZ7A 2DBGA 2P1HA 1CY5A 3J63A 2O71A 2MS8A 1C15A 4JUPA 4F42A 4O9LA 3YGSC 4M9XA 2L6AA 1PN5A 2DBFA 2MPCA 3MOPG
chains in the Genus database with same CATH topology
1D2ZB 4QOBA 4P4HA 4UZ0A 1WXPA 3EZQB 1E41A 1WMGA 1ICHA 3YGSP 2N80A 2LWDA 4NQKA 3T6PA 4O9FA 2BBZA 1CWWA 4IZ5E 1E3YA 4E9MA 4DWNA 2BBRA 4A2WA 3CL3A 4N1KA 1A1ZA 2YVIA 4I16A 4O7QA 1YGOA 4F44A 4D8OA 1UCPA 4A2QA 3CRDA 3MOPA 4RHWE 2N83A 4RHWA 1NGRA 2OF5H 4LWDA 1DGNA 4O6XA 4N1LA 4N1JA 2D96A 3QF2A 4M9ZA 3EZQA 1Z6TA 1N3KA 2MS7A 4P4HI 1A1WA 3J6JA 2KN6A 2HM2Q 2LWEA 3MOPK 2M5VA 4EWIA 2LS7A 4IZ7B 2N00A 2VGQA 2N1FA 2DO9A 2MJMA 4IZAB 3KATA 3LQRA 1WH4A 2B1WA 2DBDA 2OF5A 4M9SA 2A5YB 2N7ZA 2A9IA 2N97A 2MN4A 4FH0A 4ZBWA 3LQQA 4JQWA 2IB1A 1DDFA 1FADA 2L9MA 2GF5A 2NSNA 2F1SA 2YU0A 2YGSA 2MB9A 2NAQA 2XV9A 2DBHA 2YQFA 1D2ZA 2G7RA 2KM6A 2NZ7A 2DBGA 2P1HA 1CY5A 3J63A 2O71A 2MS8A 1C15A 4JUPA 4F42A 4O9LA 3YGSC 4M9XA 2L6AA 1PN5A 2DBFA 2MPCA 3MOPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2Z B;  4QOB A;  4P4H A;  4UZ0 A;  1WXP A;  3EZQ B;  1E41 A;  1WMG A;  1ICH A;  3YGS P;  2N80 A;  2LWD A;  4NQK A;  3T6P A;  4O9F A;  2BBZ A;  1CWW A;  4IZ5 E;  1E3Y A;  4E9M A;  4DWN A;  2BBR A;  4A2W A;  3CL3 A;  4N1K A;  1A1Z A;  2YVI A;  4I16 A;  4O7Q A;  1YGO A;  4F44 A;  4D8O A;  1UCP A;  4A2Q A;  3CRD A;  3MOP A;  4RHW E;  2N83 A;  4RHW A;  1NGR A;  2OF5 H;  4LWD A;  1DGN A;  4O6X A;  4N1L A;  4N1J A;  2D96 A;  3QF2 A;  4M9Z A;  3EZQ A;  1Z6T A;  1N3K A;  2MS7 A;  4P4H I;  1A1W A;  3J6J A;  2KN6 A;  2HM2 Q;  2LWE A;  3MOP K;  2M5V A;  4EWI A;  2LS7 A;  4IZ7 B;  2N00 A;  2VGQ A;  2N1F A;  2DO9 A;  4IZA B;  3KAT A;  3LQR A;  1WH4 A;  2B1W A;  2DBD A;  2OF5 A;  4M9S A;  2A5Y B;  2N7Z A;  2A9I A;  2N97 A;  2MN4 A;  4FH0 A;  4ZBW A;  3LQQ A;  4JQW A;  2IB1 A;  1DDF A;  1FAD A;  2L9M A;  2GF5 A;  2NSN A;  2F1S A;  2YU0 A;  2YGS A;  2MB9 A;  2NAQ A;  2DBH A;  2YQF A;  1D2Z A;  2G7R A;  2KM6 A;  2NZ7 A;  2DBG A;  2P1H A;  1CY5 A;  3J63 A;  2O71 A;  2MS8 A;  1C15 A;  4JUP A;  4F42 A;  4O9L A;  3YGS C;  4M9X A;  2L6A A;  1PN5 A;  2DBF A;  2MPC A;  3MOP G; 
#chains in the Genus database with same CATH topology
 1D2Z B;  4QOB A;  4P4H A;  4UZ0 A;  1WXP A;  3EZQ B;  1E41 A;  1WMG A;  1ICH A;  3YGS P;  2N80 A;  2LWD A;  4NQK A;  3T6P A;  4O9F A;  2BBZ A;  1CWW A;  4IZ5 E;  1E3Y A;  4E9M A;  4DWN A;  2BBR A;  4A2W A;  3CL3 A;  4N1K A;  1A1Z A;  2YVI A;  4I16 A;  4O7Q A;  1YGO A;  4F44 A;  4D8O A;  1UCP A;  4A2Q A;  3CRD A;  3MOP A;  4RHW E;  2N83 A;  4RHW A;  1NGR A;  2OF5 H;  4LWD A;  1DGN A;  4O6X A;  4N1L A;  4N1J A;  2D96 A;  3QF2 A;  4M9Z A;  3EZQ A;  1Z6T A;  1N3K A;  2MS7 A;  4P4H I;  1A1W A;  3J6J A;  2KN6 A;  2HM2 Q;  2LWE A;  3MOP K;  2M5V A;  4EWI A;  2LS7 A;  4IZ7 B;  2N00 A;  2VGQ A;  2N1F A;  2DO9 A;  2MJM A;  4IZA B;  3KAT A;  3LQR A;  1WH4 A;  2B1W A;  2DBD A;  2OF5 A;  4M9S A;  2A5Y B;  2N7Z A;  2A9I A;  2N97 A;  2MN4 A;  4FH0 A;  4ZBW A;  3LQQ A;  4JQW A;  2IB1 A;  1DDF A;  1FAD A;  2L9M A;  2GF5 A;  2NSN A;  2F1S A;  2YU0 A;  2YGS A;  2MB9 A;  2NAQ A;  2XV9 A;  2DBH A;  2YQF A;  1D2Z A;  2G7R A;  2KM6 A;  2NZ7 A;  2DBG A;  2P1H A;  1CY5 A;  3J63 A;  2O71 A;  2MS8 A;  1C15 A;  4JUP A;  4F42 A;  4O9L A;  3YGS C;  4M9X A;  2L6A A;  1PN5 A;  2DBF A;  2MPC A;  3MOP G; 
#chains in the Genus database with same CATH homology
 1D2Z B;  4QOB A;  4P4H A;  4UZ0 A;  1WXP A;  3EZQ B;  1E41 A;  1WMG A;  1ICH A;  3YGS P;  2N80 A;  2LWD A;  4NQK A;  3T6P A;  4O9F A;  2BBZ A;  1CWW A;  4IZ5 E;  1E3Y A;  4E9M A;  4DWN A;  2BBR A;  4A2W A;  3CL3 A;  4N1K A;  1A1Z A;  2YVI A;  4I16 A;  4O7Q A;  1YGO A;  4F44 A;  4D8O A;  1UCP A;  4A2Q A;  3CRD A;  3MOP A;  4RHW E;  2N83 A;  4RHW A;  1NGR A;  2OF5 H;  4LWD A;  1DGN A;  4O6X A;  4N1L A;  4N1J A;  2D96 A;  3QF2 A;  4M9Z A;  3EZQ A;  1Z6T A;  1N3K A;  2MS7 A;  4P4H I;  1A1W A;  3J6J A;  2KN6 A;  2HM2 Q;  2LWE A;  3MOP K;  2M5V A;  4EWI A;  2LS7 A;  4IZ7 B;  2N00 A;  2VGQ A;  2N1F A;  2DO9 A;  2MJM A;  4IZA B;  3KAT A;  3LQR A;  1WH4 A;  2B1W A;  2DBD A;  2OF5 A;  4M9S A;  2A5Y B;  2N7Z A;  2A9I A;  2N97 A;  2MN4 A;  4FH0 A;  4ZBW A;  3LQQ A;  4JQW A;  2IB1 A;  1DDF A;  1FAD A;  2L9M A;  2GF5 A;  2NSN A;  2F1S A;  2YU0 A;  2YGS A;  2MB9 A;  2NAQ A;  2XV9 A;  2DBH A;  2YQF A;  1D2Z A;  2G7R A;  2KM6 A;  2NZ7 A;  2DBG A;  2P1H A;  1CY5 A;  3J63 A;  2O71 A;  2MS8 A;  1C15 A;  4JUP A;  4F42 A;  4O9L A;  3YGS C;  4M9X A;  2L6A A;  1PN5 A;  2DBF A;  2MPC A;  3MOP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...