2F1SA

Crystal structure of a viral flip mc159
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
VPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Viral FLIP: INSIGHTS INTO FLIP-MEDIATED INHIBITION OF DEATH RECEPTOR SIGNALING.
pubmed doi rcsb
source organism Molluscum contagiosum virus subtype 1
molecule tags Apoptosis
molecule keywords Viral CASP8 and FADD-like apoptosis regulator
total genus 71
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2f1sA02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2f1sA01
4JQWA 1UCPA 2YQFA 2MB9A 2L9MA 1C15A 1DDFA 4M9ZA 1A1WA 2LWDA 4FH0A 2DBDA 1NGRA 2N1FA 2N00A 2OF5H 4IZ5E 2B1WA 2DBHA 4N1KA 2NAQA 4RHWE 4D8OA 4M9SA 2G7RA 2F1SA 4F44A 3J63A 3LQQA 4EWIA 4A2QA 2MN4A 2OF5A 2VGQA 2BBRA 4A2WA 2YU0A 3KATA 1WXPA 1ICHA 1CY5A 4ZBWA 4DWNA 4E9MA 1E41A 2O71A 1A1ZA 2MS7A 4NQKA 1D2ZB 2BBZA 2A5YB 2A9IA 1WH4A 2HM2Q 4IZAB 4P4HA 4QOBA 3QF2A 2DBFA 3EZQA 4N1JA 1E3YA 3CL3A 3MOPA 4JUPA 2P1HA 4RHWA 2GF5A 2MS8A 3LQRA 1CWWA 4O9FA 1N3KA 1PN5A 3EZQB 4O7QA 2YVIA 2DO9A 3MOPK 4O6XA 2NSNA 2N97A 4N1LA 3J6JA 1Z6TA 4M9XA 1DGNA 3YGSP 3CRDA 2N7ZA 2M5VA 2D96A 2L6AA 2IB1A 4IZ7B 2LWEA 3YGSC 1WMGA 4I16A 2DBGA 4O9LA 1YGOA 2YGSA 2MPCA 4UZ0A 3T6PA 1D2ZA 2NZ7A 4P4HI 4F42A 2KM6A 2N80A 2N83A 1FADA 2KN6A 2LS7A 3MOPG 4LWDA
chains in the Genus database with same CATH superfamily
4JQWA 1UCPA 2YQFA 2MB9A 2L9MA 1C15A 1DDFA 4M9ZA 1A1WA 2LWDA 4FH0A 2DBDA 1NGRA 2N1FA 2N00A 2OF5H 4IZ5E 2B1WA 2DBHA 4N1KA 2NAQA 4RHWE 4D8OA 4M9SA 2G7RA 2F1SA 4F44A 3J63A 3LQQA 4EWIA 4A2QA 2MN4A 2OF5A 2VGQA 2BBRA 4A2WA 2YU0A 3KATA 1WXPA 1ICHA 1CY5A 4ZBWA 4DWNA 4E9MA 1E41A 2O71A 1A1ZA 2MS7A 4NQKA 1D2ZB 2BBZA 2A5YB 2A9IA 1WH4A 2HM2Q 4IZAB 4P4HA 4QOBA 3QF2A 2DBFA 3EZQA 4N1JA 1E3YA 3CL3A 3MOPA 4JUPA 2P1HA 4RHWA 2GF5A 2MS8A 3LQRA 1CWWA 4O9FA 1N3KA 1PN5A 3EZQB 4O7QA 2YVIA 2DO9A 3MOPK 2MJMA 4O6XA 2NSNA 2N97A 4N1LA 3J6JA 1Z6TA 4M9XA 1DGNA 3YGSP 3CRDA 2N7ZA 2M5VA 2D96A 2L6AA 2XV9A 2IB1A 4IZ7B 2LWEA 3YGSC 1WMGA 4I16A 2DBGA 4O9LA 1YGOA 2YGSA 2MPCA 4UZ0A 3T6PA 1D2ZA 2NZ7A 4P4HI 4F42A 2KM6A 2N80A 2N83A 1FADA 2KN6A 2LS7A 3MOPG 4LWDA
chains in the Genus database with same CATH topology
4JQWA 1UCPA 2YQFA 2MB9A 2L9MA 1C15A 1DDFA 4M9ZA 1A1WA 2LWDA 4FH0A 2DBDA 1NGRA 2N1FA 2N00A 2OF5H 4IZ5E 2B1WA 2DBHA 4N1KA 2NAQA 4RHWE 4D8OA 4M9SA 2G7RA 2F1SA 4F44A 3J63A 3LQQA 4EWIA 4A2QA 2MN4A 2OF5A 2VGQA 2BBRA 4A2WA 2YU0A 3KATA 1WXPA 1ICHA 1CY5A 4ZBWA 4DWNA 4E9MA 1E41A 2O71A 1A1ZA 2MS7A 4NQKA 1D2ZB 2BBZA 2A5YB 2A9IA 1WH4A 2HM2Q 4IZAB 4P4HA 4QOBA 3QF2A 2DBFA 3EZQA 4N1JA 1E3YA 3CL3A 3MOPA 4JUPA 2P1HA 4RHWA 2GF5A 2MS8A 3LQRA 1CWWA 4O9FA 1N3KA 1PN5A 3EZQB 4O7QA 2YVIA 2DO9A 3MOPK 2MJMA 4O6XA 2NSNA 2N97A 4N1LA 3J6JA 1Z6TA 4M9XA 1DGNA 3YGSP 3CRDA 2N7ZA 2M5VA 2D96A 2L6AA 2XV9A 2IB1A 4IZ7B 2LWEA 3YGSC 1WMGA 4I16A 2DBGA 4O9LA 1YGOA 2YGSA 2MPCA 4UZ0A 3T6PA 1D2ZA 2NZ7A 4P4HI 4F42A 2KM6A 2N80A 2N83A 1FADA 2KN6A 2LS7A 3MOPG 4LWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JQW A;  1UCP A;  2YQF A;  2MB9 A;  2L9M A;  1C15 A;  1DDF A;  4M9Z A;  1A1W A;  2LWD A;  4FH0 A;  2DBD A;  1NGR A;  2N1F A;  2N00 A;  2OF5 H;  4IZ5 E;  2B1W A;  2DBH A;  4N1K A;  2NAQ A;  4RHW E;  4D8O A;  4M9S A;  2G7R A;  2F1S A;  4F44 A;  3J63 A;  3LQQ A;  4EWI A;  4A2Q A;  2MN4 A;  2OF5 A;  2VGQ A;  2BBR A;  4A2W A;  2YU0 A;  3KAT A;  1WXP A;  1ICH A;  1CY5 A;  4ZBW A;  4DWN A;  4E9M A;  1E41 A;  2O71 A;  1A1Z A;  2MS7 A;  4NQK A;  1D2Z B;  2BBZ A;  2A5Y B;  2A9I A;  1WH4 A;  2HM2 Q;  4IZA B;  4P4H A;  4QOB A;  3QF2 A;  2DBF A;  3EZQ A;  4N1J A;  1E3Y A;  3CL3 A;  3MOP A;  4JUP A;  2P1H A;  4RHW A;  2GF5 A;  2MS8 A;  3LQR A;  1CWW A;  4O9F A;  1N3K A;  1PN5 A;  3EZQ B;  4O7Q A;  2YVI A;  2DO9 A;  3MOP K;  4O6X A;  2NSN A;  2N97 A;  4N1L A;  3J6J A;  1Z6T A;  4M9X A;  1DGN A;  3YGS P;  3CRD A;  2N7Z A;  2M5V A;  2D96 A;  2L6A A;  2IB1 A;  4IZ7 B;  2LWE A;  3YGS C;  1WMG A;  4I16 A;  2DBG A;  4O9L A;  1YGO A;  2YGS A;  2MPC A;  4UZ0 A;  3T6P A;  1D2Z A;  2NZ7 A;  4P4H I;  4F42 A;  2KM6 A;  2N80 A;  2N83 A;  1FAD A;  2KN6 A;  2LS7 A;  3MOP G;  4LWD A; 
#chains in the Genus database with same CATH topology
 4JQW A;  1UCP A;  2YQF A;  2MB9 A;  2L9M A;  1C15 A;  1DDF A;  4M9Z A;  1A1W A;  2LWD A;  4FH0 A;  2DBD A;  1NGR A;  2N1F A;  2N00 A;  2OF5 H;  4IZ5 E;  2B1W A;  2DBH A;  4N1K A;  2NAQ A;  4RHW E;  4D8O A;  4M9S A;  2G7R A;  2F1S A;  4F44 A;  3J63 A;  3LQQ A;  4EWI A;  4A2Q A;  2MN4 A;  2OF5 A;  2VGQ A;  2BBR A;  4A2W A;  2YU0 A;  3KAT A;  1WXP A;  1ICH A;  1CY5 A;  4ZBW A;  4DWN A;  4E9M A;  1E41 A;  2O71 A;  1A1Z A;  2MS7 A;  4NQK A;  1D2Z B;  2BBZ A;  2A5Y B;  2A9I A;  1WH4 A;  2HM2 Q;  4IZA B;  4P4H A;  4QOB A;  3QF2 A;  2DBF A;  3EZQ A;  4N1J A;  1E3Y A;  3CL3 A;  3MOP A;  4JUP A;  2P1H A;  4RHW A;  2GF5 A;  2MS8 A;  3LQR A;  1CWW A;  4O9F A;  1N3K A;  1PN5 A;  3EZQ B;  4O7Q A;  2YVI A;  2DO9 A;  3MOP K;  2MJM A;  4O6X A;  2NSN A;  2N97 A;  4N1L A;  3J6J A;  1Z6T A;  4M9X A;  1DGN A;  3YGS P;  3CRD A;  2N7Z A;  2M5V A;  2D96 A;  2L6A A;  2XV9 A;  2IB1 A;  4IZ7 B;  2LWE A;  3YGS C;  1WMG A;  4I16 A;  2DBG A;  4O9L A;  1YGO A;  2YGS A;  2MPC A;  4UZ0 A;  3T6P A;  1D2Z A;  2NZ7 A;  4P4H I;  4F42 A;  2KM6 A;  2N80 A;  2N83 A;  1FAD A;  2KN6 A;  2LS7 A;  3MOP G;  4LWD A; 
#chains in the Genus database with same CATH homology
 4JQW A;  1UCP A;  2YQF A;  2MB9 A;  2L9M A;  1C15 A;  1DDF A;  4M9Z A;  1A1W A;  2LWD A;  4FH0 A;  2DBD A;  1NGR A;  2N1F A;  2N00 A;  2OF5 H;  4IZ5 E;  2B1W A;  2DBH A;  4N1K A;  2NAQ A;  4RHW E;  4D8O A;  4M9S A;  2G7R A;  2F1S A;  4F44 A;  3J63 A;  3LQQ A;  4EWI A;  4A2Q A;  2MN4 A;  2OF5 A;  2VGQ A;  2BBR A;  4A2W A;  2YU0 A;  3KAT A;  1WXP A;  1ICH A;  1CY5 A;  4ZBW A;  4DWN A;  4E9M A;  1E41 A;  2O71 A;  1A1Z A;  2MS7 A;  4NQK A;  1D2Z B;  2BBZ A;  2A5Y B;  2A9I A;  1WH4 A;  2HM2 Q;  4IZA B;  4P4H A;  4QOB A;  3QF2 A;  2DBF A;  3EZQ A;  4N1J A;  1E3Y A;  3CL3 A;  3MOP A;  4JUP A;  2P1H A;  4RHW A;  2GF5 A;  2MS8 A;  3LQR A;  1CWW A;  4O9F A;  1N3K A;  1PN5 A;  3EZQ B;  4O7Q A;  2YVI A;  2DO9 A;  3MOP K;  2MJM A;  4O6X A;  2NSN A;  2N97 A;  4N1L A;  3J6J A;  1Z6T A;  4M9X A;  1DGN A;  3YGS P;  3CRD A;  2N7Z A;  2M5V A;  2D96 A;  2L6A A;  2XV9 A;  2IB1 A;  4IZ7 B;  2LWE A;  3YGS C;  1WMG A;  4I16 A;  2DBG A;  4O9L A;  1YGO A;  2YGS A;  2MPC A;  4UZ0 A;  3T6P A;  1D2Z A;  2NZ7 A;  4P4H I;  4F42 A;  2KM6 A;  2N80 A;  2N83 A;  1FAD A;  2KN6 A;  2LS7 A;  3MOP G;  4LWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...