3MOPA

The ternary death domain complex of myd88, irak4, and irak2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYIAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, immune system
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 30
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3mopA00
3T6PA 4EWIA 2G7RA 4O9LA 2OF5A 2N83A 2MN4A 4IZAB 4UZ0A 1DDFA 3QF2A 4I16A 1CY5A 3EZQA 4M9SA 1WMGA 2A5YB 2DO9A 2L6AA 1D2ZA 1A1ZA 3CRDA 2LS7A 1A1WA 2N7ZA 4N1KA 4A2WA 2IB1A 2BBRA 4O6XA 2NZ7A 4JQWA 2OF5H 2MPCA 4QOBA 2N80A 1UCPA 2A9IA 2KM6A 2N97A 4JUPA 4NQKA 2VGQA 3KATA 2GF5A 4F44A 3J6JA 2YU0A 1DGNA 1YGOA 3YGSC 3MOPK 2LWDA 2F1SA 2N1FA 4RHWE 2NAQA 1E41A 4IZ5E 4FH0A 1WXPA 1D2ZB 2N00A 4DWNA 2BBZA 3YGSP 1C15A 2M5VA 2LWEA 2NSNA 4LWDA 3MOPA 4P4HA 2DBDA 4ZBWA 1PN5A 4O9FA 1N3KA 4E9MA 4N1JA 3EZQB 4M9ZA 3MOPG 2HM2Q 2MB9A 2MS7A 1NGRA 3LQQA 4M9XA 4A2QA 4F42A 1E3YA 2D96A 2DBGA 2B1WA 3CL3A 4O7QA 2L9MA 1WH4A 2P1HA 4N1LA 1CWWA 2YGSA 1Z6TA 4D8OA 2O71A 2DBFA 1FADA 3LQRA 4IZ7B 4P4HI 2DBHA 3J63A 2KN6A 2YQFA 1ICHA 2MS8A 4RHWA 2YVIA
chains in the Genus database with same CATH superfamily
3T6PA 4EWIA 2G7RA 4O9LA 2OF5A 2N83A 2MN4A 4IZAB 4UZ0A 1DDFA 3QF2A 4I16A 1CY5A 3EZQA 4M9SA 1WMGA 2A5YB 2DO9A 2L6AA 1D2ZA 1A1ZA 3CRDA 2LS7A 1A1WA 2N7ZA 4N1KA 4A2WA 2IB1A 2BBRA 2MJMA 4O6XA 2NZ7A 4JQWA 2OF5H 2MPCA 4QOBA 2N80A 1UCPA 2A9IA 2KM6A 2N97A 4JUPA 4NQKA 2VGQA 3KATA 2GF5A 4F44A 3J6JA 2YU0A 1DGNA 1YGOA 3YGSC 3MOPK 2LWDA 2F1SA 2N1FA 4RHWE 2NAQA 1E41A 2XV9A 4IZ5E 4FH0A 1WXPA 1D2ZB 2N00A 4DWNA 2BBZA 3YGSP 1C15A 2M5VA 2LWEA 2NSNA 4LWDA 3MOPA 4P4HA 2DBDA 4ZBWA 1PN5A 4O9FA 1N3KA 4E9MA 4N1JA 3EZQB 4M9ZA 3MOPG 2HM2Q 2MB9A 2MS7A 1NGRA 3LQQA 4M9XA 4A2QA 4F42A 1E3YA 2D96A 2DBGA 2B1WA 3CL3A 4O7QA 2L9MA 1WH4A 2P1HA 4N1LA 1CWWA 2YGSA 1Z6TA 4D8OA 2O71A 2DBFA 1FADA 3LQRA 4IZ7B 4P4HI 2DBHA 3J63A 2KN6A 2YQFA 1ICHA 2MS8A 4RHWA 2YVIA
chains in the Genus database with same CATH topology
3T6PA 4EWIA 2G7RA 4O9LA 2OF5A 2N83A 2MN4A 4IZAB 4UZ0A 1DDFA 3QF2A 4I16A 1CY5A 3EZQA 4M9SA 1WMGA 2A5YB 2DO9A 2L6AA 1D2ZA 1A1ZA 3CRDA 2LS7A 1A1WA 2N7ZA 4N1KA 4A2WA 2IB1A 2BBRA 2MJMA 4O6XA 2NZ7A 4JQWA 2OF5H 2MPCA 4QOBA 2N80A 1UCPA 2A9IA 2KM6A 2N97A 4JUPA 4NQKA 2VGQA 3KATA 2GF5A 4F44A 3J6JA 2YU0A 1DGNA 1YGOA 3YGSC 3MOPK 2LWDA 2F1SA 2N1FA 4RHWE 2NAQA 1E41A 2XV9A 4IZ5E 4FH0A 1WXPA 1D2ZB 2N00A 4DWNA 2BBZA 3YGSP 1C15A 2M5VA 2LWEA 2NSNA 4LWDA 3MOPA 4P4HA 2DBDA 4ZBWA 1PN5A 4O9FA 1N3KA 4E9MA 4N1JA 3EZQB 4M9ZA 3MOPG 2HM2Q 2MB9A 2MS7A 1NGRA 3LQQA 4M9XA 4A2QA 4F42A 1E3YA 2D96A 2DBGA 2B1WA 3CL3A 4O7QA 2L9MA 1WH4A 2P1HA 4N1LA 1CWWA 2YGSA 1Z6TA 4D8OA 2O71A 2DBFA 1FADA 3LQRA 4IZ7B 4P4HI 2DBHA 3J63A 2KN6A 2YQFA 1ICHA 2MS8A 4RHWA 2YVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6P A;  4EWI A;  2G7R A;  4O9L A;  2OF5 A;  2N83 A;  2MN4 A;  4IZA B;  4UZ0 A;  1DDF A;  3QF2 A;  4I16 A;  1CY5 A;  3EZQ A;  4M9S A;  1WMG A;  2A5Y B;  2DO9 A;  2L6A A;  1D2Z A;  1A1Z A;  3CRD A;  2LS7 A;  1A1W A;  2N7Z A;  4N1K A;  4A2W A;  2IB1 A;  2BBR A;  4O6X A;  2NZ7 A;  4JQW A;  2OF5 H;  2MPC A;  4QOB A;  2N80 A;  1UCP A;  2A9I A;  2KM6 A;  2N97 A;  4JUP A;  4NQK A;  2VGQ A;  3KAT A;  2GF5 A;  4F44 A;  3J6J A;  2YU0 A;  1DGN A;  1YGO A;  3YGS C;  3MOP K;  2LWD A;  2F1S A;  2N1F A;  4RHW E;  2NAQ A;  1E41 A;  4IZ5 E;  4FH0 A;  1WXP A;  1D2Z B;  2N00 A;  4DWN A;  2BBZ A;  3YGS P;  1C15 A;  2M5V A;  2LWE A;  2NSN A;  4LWD A;  3MOP A;  4P4H A;  2DBD A;  4ZBW A;  1PN5 A;  4O9F A;  1N3K A;  4E9M A;  4N1J A;  3EZQ B;  4M9Z A;  3MOP G;  2HM2 Q;  2MB9 A;  2MS7 A;  1NGR A;  3LQQ A;  4M9X A;  4A2Q A;  4F42 A;  1E3Y A;  2D96 A;  2DBG A;  2B1W A;  3CL3 A;  4O7Q A;  2L9M A;  1WH4 A;  2P1H A;  4N1L A;  1CWW A;  2YGS A;  1Z6T A;  4D8O A;  2O71 A;  2DBF A;  1FAD A;  3LQR A;  4IZ7 B;  4P4H I;  2DBH A;  3J63 A;  2KN6 A;  2YQF A;  1ICH A;  2MS8 A;  4RHW A;  2YVI A; 
#chains in the Genus database with same CATH topology
 3T6P A;  4EWI A;  2G7R A;  4O9L A;  2OF5 A;  2N83 A;  2MN4 A;  4IZA B;  4UZ0 A;  1DDF A;  3QF2 A;  4I16 A;  1CY5 A;  3EZQ A;  4M9S A;  1WMG A;  2A5Y B;  2DO9 A;  2L6A A;  1D2Z A;  1A1Z A;  3CRD A;  2LS7 A;  1A1W A;  2N7Z A;  4N1K A;  4A2W A;  2IB1 A;  2BBR A;  2MJM A;  4O6X A;  2NZ7 A;  4JQW A;  2OF5 H;  2MPC A;  4QOB A;  2N80 A;  1UCP A;  2A9I A;  2KM6 A;  2N97 A;  4JUP A;  4NQK A;  2VGQ A;  3KAT A;  2GF5 A;  4F44 A;  3J6J A;  2YU0 A;  1DGN A;  1YGO A;  3YGS C;  3MOP K;  2LWD A;  2F1S A;  2N1F A;  4RHW E;  2NAQ A;  1E41 A;  2XV9 A;  4IZ5 E;  4FH0 A;  1WXP A;  1D2Z B;  2N00 A;  4DWN A;  2BBZ A;  3YGS P;  1C15 A;  2M5V A;  2LWE A;  2NSN A;  4LWD A;  3MOP A;  4P4H A;  2DBD A;  4ZBW A;  1PN5 A;  4O9F A;  1N3K A;  4E9M A;  4N1J A;  3EZQ B;  4M9Z A;  3MOP G;  2HM2 Q;  2MB9 A;  2MS7 A;  1NGR A;  3LQQ A;  4M9X A;  4A2Q A;  4F42 A;  1E3Y A;  2D96 A;  2DBG A;  2B1W A;  3CL3 A;  4O7Q A;  2L9M A;  1WH4 A;  2P1H A;  4N1L A;  1CWW A;  2YGS A;  1Z6T A;  4D8O A;  2O71 A;  2DBF A;  1FAD A;  3LQR A;  4IZ7 B;  4P4H I;  2DBH A;  3J63 A;  2KN6 A;  2YQF A;  1ICH A;  2MS8 A;  4RHW A;  2YVI A; 
#chains in the Genus database with same CATH homology
 3T6P A;  4EWI A;  2G7R A;  4O9L A;  2OF5 A;  2N83 A;  2MN4 A;  4IZA B;  4UZ0 A;  1DDF A;  3QF2 A;  4I16 A;  1CY5 A;  3EZQ A;  4M9S A;  1WMG A;  2A5Y B;  2DO9 A;  2L6A A;  1D2Z A;  1A1Z A;  3CRD A;  2LS7 A;  1A1W A;  2N7Z A;  4N1K A;  4A2W A;  2IB1 A;  2BBR A;  2MJM A;  4O6X A;  2NZ7 A;  4JQW A;  2OF5 H;  2MPC A;  4QOB A;  2N80 A;  1UCP A;  2A9I A;  2KM6 A;  2N97 A;  4JUP A;  4NQK A;  2VGQ A;  3KAT A;  2GF5 A;  4F44 A;  3J6J A;  2YU0 A;  1DGN A;  1YGO A;  3YGS C;  3MOP K;  2LWD A;  2F1S A;  2N1F A;  4RHW E;  2NAQ A;  1E41 A;  2XV9 A;  4IZ5 E;  4FH0 A;  1WXP A;  1D2Z B;  2N00 A;  4DWN A;  2BBZ A;  3YGS P;  1C15 A;  2M5V A;  2LWE A;  2NSN A;  4LWD A;  3MOP A;  4P4H A;  2DBD A;  4ZBW A;  1PN5 A;  4O9F A;  1N3K A;  4E9M A;  4N1J A;  3EZQ B;  4M9Z A;  3MOP G;  2HM2 Q;  2MB9 A;  2MS7 A;  1NGR A;  3LQQ A;  4M9X A;  4A2Q A;  4F42 A;  1E3Y A;  2D96 A;  2DBG A;  2B1W A;  3CL3 A;  4O7Q A;  2L9M A;  1WH4 A;  2P1H A;  4N1L A;  1CWW A;  2YGS A;  1Z6T A;  4D8O A;  2O71 A;  2DBF A;  1FAD A;  3LQR A;  4IZ7 B;  4P4H I;  2DBH A;  3J63 A;  2KN6 A;  2YQF A;  1ICH A;  2MS8 A;  4RHW A;  2YVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...