1DGNA

Solution structure of iceberg, an inhibitor of interleukin-1beta generation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
ADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ICEBERG: a novel inhibitor of interleukin-1beta generation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords ICEBERG (PROTEASE INHIBITOR)
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1999-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1dgnA00
4UZ0A 4A2WA 3KATA 2DBHA 2DBDA 2O71A 4P4HI 1WXPA 2MS8A 4P4HA 1FADA 4N1LA 2YQFA 1E41A 2A9IA 4IZAB 1CWWA 2N7ZA 4JQWA 2BBRA 2KN6A 2N1FA 2N97A 2NAQA 4ZBWA 2F1SA 2VGQA 2YU0A 2HM2Q 2B1WA 4IZ5E 3MOPG 4LWDA 2MS7A 3YGSP 1A1WA 2KM6A 2YVIA 2LS7A 4F42A 1C15A 1WH4A 3CL3A 2IB1A 4O7QA 2G7RA 4M9SA 2N83A 4RHWE 3MOPA 4N1JA 2MB9A 4JUPA 3CRDA 1DGNA 2D96A 2P1HA 2OF5A 4F44A 3LQQA 1PN5A 3QF2A 2M5VA 4RHWA 2NSNA 4O9LA 3T6PA 2LWEA 4DWNA 1DDFA 3EZQB 4QOBA 2DBFA 1E3YA 4E9MA 2A5YB 2MN4A 4EWIA 2DO9A 2GF5A 3LQRA 2MPCA 4IZ7B 1NGRA 2N00A 2DBGA 4A2QA 3MOPK 2BBZA 2N80A 3YGSC 1Z6TA 1D2ZB 1UCPA 4I16A 1YGOA 2L6AA 1D2ZA 3J63A 2OF5H 4O9FA 4N1KA 2YGSA 4NQKA 4M9ZA 1ICHA 4M9XA 4O6XA 1A1ZA 2L9MA 3J6JA 2LWDA 1N3KA 1WMGA 4FH0A 2NZ7A 1CY5A 3EZQA 4D8OA
chains in the Genus database with same CATH superfamily
4UZ0A 2MJMA 4A2WA 3KATA 2DBHA 2DBDA 2O71A 4P4HI 1WXPA 2MS8A 4P4HA 1FADA 4N1LA 2YQFA 1E41A 2A9IA 4IZAB 1CWWA 2N7ZA 4JQWA 2BBRA 2KN6A 2N1FA 2N97A 2NAQA 4ZBWA 2F1SA 2VGQA 2YU0A 2HM2Q 2B1WA 4IZ5E 3MOPG 4LWDA 2MS7A 3YGSP 1A1WA 2KM6A 2YVIA 2LS7A 4F42A 1C15A 1WH4A 3CL3A 2IB1A 4O7QA 2G7RA 2XV9A 4M9SA 2N83A 4RHWE 3MOPA 4N1JA 2MB9A 3CRDA 4JUPA 1DGNA 2D96A 2P1HA 2OF5A 4F44A 3LQQA 1PN5A 3QF2A 2M5VA 4RHWA 2NSNA 4O9LA 3T6PA 2LWEA 4DWNA 1DDFA 3EZQB 4QOBA 2DBFA 1E3YA 4E9MA 2A5YB 2MN4A 4EWIA 2DO9A 2GF5A 3LQRA 2MPCA 4IZ7B 1NGRA 2N00A 2DBGA 4A2QA 3MOPK 2BBZA 2N80A 3YGSC 1Z6TA 1D2ZB 1UCPA 4I16A 1YGOA 2L6AA 1D2ZA 3J63A 2OF5H 4O9FA 4N1KA 2YGSA 4NQKA 4M9ZA 1ICHA 4M9XA 4O6XA 1A1ZA 2L9MA 3J6JA 2LWDA 1N3KA 1WMGA 4FH0A 2NZ7A 1CY5A 3EZQA 4D8OA
chains in the Genus database with same CATH topology
4UZ0A 2MJMA 4A2WA 3KATA 2DBHA 2DBDA 2O71A 4P4HI 1WXPA 2MS8A 4P4HA 1FADA 4N1LA 2YQFA 1E41A 2A9IA 4IZAB 1CWWA 2N7ZA 4JQWA 2BBRA 2KN6A 2N1FA 2N97A 2NAQA 4ZBWA 2F1SA 2VGQA 2YU0A 2HM2Q 2B1WA 4IZ5E 3MOPG 4LWDA 2MS7A 3YGSP 1A1WA 2KM6A 2YVIA 2LS7A 4F42A 1C15A 1WH4A 3CL3A 2IB1A 4O7QA 2G7RA 2XV9A 4M9SA 2N83A 4RHWE 3MOPA 4N1JA 2MB9A 3CRDA 4JUPA 1DGNA 2D96A 2P1HA 2OF5A 4F44A 3LQQA 1PN5A 3QF2A 2M5VA 4RHWA 2NSNA 4O9LA 3T6PA 2LWEA 4DWNA 1DDFA 3EZQB 4QOBA 2DBFA 1E3YA 4E9MA 2A5YB 2MN4A 4EWIA 2DO9A 2GF5A 3LQRA 2MPCA 4IZ7B 1NGRA 2N00A 2DBGA 4A2QA 3MOPK 2BBZA 2N80A 3YGSC 1Z6TA 1D2ZB 1UCPA 4I16A 1YGOA 2L6AA 1D2ZA 3J63A 2OF5H 4O9FA 4N1KA 2YGSA 4NQKA 4M9ZA 1ICHA 4M9XA 4O6XA 1A1ZA 2L9MA 3J6JA 2LWDA 1N3KA 1WMGA 4FH0A 2NZ7A 1CY5A 3EZQA 4D8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZ0 A;  4A2W A;  3KAT A;  2DBH A;  2DBD A;  2O71 A;  4P4H I;  1WXP A;  2MS8 A;  4P4H A;  1FAD A;  4N1L A;  2YQF A;  1E41 A;  2A9I A;  4IZA B;  1CWW A;  2N7Z A;  4JQW A;  2BBR A;  2KN6 A;  2N1F A;  2N97 A;  2NAQ A;  4ZBW A;  2F1S A;  2VGQ A;  2YU0 A;  2HM2 Q;  2B1W A;  4IZ5 E;  3MOP G;  4LWD A;  2MS7 A;  3YGS P;  1A1W A;  2KM6 A;  2YVI A;  2LS7 A;  4F42 A;  1C15 A;  1WH4 A;  3CL3 A;  2IB1 A;  4O7Q A;  2G7R A;  4M9S A;  2N83 A;  4RHW E;  3MOP A;  4N1J A;  2MB9 A;  4JUP A;  3CRD A;  1DGN A;  2D96 A;  2P1H A;  2OF5 A;  4F44 A;  3LQQ A;  1PN5 A;  3QF2 A;  2M5V A;  4RHW A;  2NSN A;  4O9L A;  3T6P A;  2LWE A;  4DWN A;  1DDF A;  3EZQ B;  4QOB A;  2DBF A;  1E3Y A;  4E9M A;  2A5Y B;  2MN4 A;  4EWI A;  2DO9 A;  2GF5 A;  3LQR A;  2MPC A;  4IZ7 B;  1NGR A;  2N00 A;  2DBG A;  4A2Q A;  3MOP K;  2BBZ A;  2N80 A;  3YGS C;  1Z6T A;  1D2Z B;  1UCP A;  4I16 A;  1YGO A;  2L6A A;  1D2Z A;  3J63 A;  2OF5 H;  4O9F A;  4N1K A;  2YGS A;  4NQK A;  4M9Z A;  1ICH A;  4M9X A;  4O6X A;  1A1Z A;  2L9M A;  3J6J A;  2LWD A;  1N3K A;  1WMG A;  4FH0 A;  2NZ7 A;  1CY5 A;  3EZQ A;  4D8O A; 
#chains in the Genus database with same CATH topology
 4UZ0 A;  2MJM A;  4A2W A;  3KAT A;  2DBH A;  2DBD A;  2O71 A;  4P4H I;  1WXP A;  2MS8 A;  4P4H A;  1FAD A;  4N1L A;  2YQF A;  1E41 A;  2A9I A;  4IZA B;  1CWW A;  2N7Z A;  4JQW A;  2BBR A;  2KN6 A;  2N1F A;  2N97 A;  2NAQ A;  4ZBW A;  2F1S A;  2VGQ A;  2YU0 A;  2HM2 Q;  2B1W A;  4IZ5 E;  3MOP G;  4LWD A;  2MS7 A;  3YGS P;  1A1W A;  2KM6 A;  2YVI A;  2LS7 A;  4F42 A;  1C15 A;  1WH4 A;  3CL3 A;  2IB1 A;  4O7Q A;  2G7R A;  2XV9 A;  4M9S A;  2N83 A;  4RHW E;  3MOP A;  4N1J A;  2MB9 A;  3CRD A;  4JUP A;  1DGN A;  2D96 A;  2P1H A;  2OF5 A;  4F44 A;  3LQQ A;  1PN5 A;  3QF2 A;  2M5V A;  4RHW A;  2NSN A;  4O9L A;  3T6P A;  2LWE A;  4DWN A;  1DDF A;  3EZQ B;  4QOB A;  2DBF A;  1E3Y A;  4E9M A;  2A5Y B;  2MN4 A;  4EWI A;  2DO9 A;  2GF5 A;  3LQR A;  2MPC A;  4IZ7 B;  1NGR A;  2N00 A;  2DBG A;  4A2Q A;  3MOP K;  2BBZ A;  2N80 A;  3YGS C;  1Z6T A;  1D2Z B;  1UCP A;  4I16 A;  1YGO A;  2L6A A;  1D2Z A;  3J63 A;  2OF5 H;  4O9F A;  4N1K A;  2YGS A;  4NQK A;  4M9Z A;  1ICH A;  4M9X A;  4O6X A;  1A1Z A;  2L9M A;  3J6J A;  2LWD A;  1N3K A;  1WMG A;  4FH0 A;  2NZ7 A;  1CY5 A;  3EZQ A;  4D8O A; 
#chains in the Genus database with same CATH homology
 4UZ0 A;  2MJM A;  4A2W A;  3KAT A;  2DBH A;  2DBD A;  2O71 A;  4P4H I;  1WXP A;  2MS8 A;  4P4H A;  1FAD A;  4N1L A;  2YQF A;  1E41 A;  2A9I A;  4IZA B;  1CWW A;  2N7Z A;  4JQW A;  2BBR A;  2KN6 A;  2N1F A;  2N97 A;  2NAQ A;  4ZBW A;  2F1S A;  2VGQ A;  2YU0 A;  2HM2 Q;  2B1W A;  4IZ5 E;  3MOP G;  4LWD A;  2MS7 A;  3YGS P;  1A1W A;  2KM6 A;  2YVI A;  2LS7 A;  4F42 A;  1C15 A;  1WH4 A;  3CL3 A;  2IB1 A;  4O7Q A;  2G7R A;  2XV9 A;  4M9S A;  2N83 A;  4RHW E;  3MOP A;  4N1J A;  2MB9 A;  3CRD A;  4JUP A;  1DGN A;  2D96 A;  2P1H A;  2OF5 A;  4F44 A;  3LQQ A;  1PN5 A;  3QF2 A;  2M5V A;  4RHW A;  2NSN A;  4O9L A;  3T6P A;  2LWE A;  4DWN A;  1DDF A;  3EZQ B;  4QOB A;  2DBF A;  1E3Y A;  4E9M A;  2A5Y B;  2MN4 A;  4EWI A;  2DO9 A;  2GF5 A;  3LQR A;  2MPC A;  4IZ7 B;  1NGR A;  2N00 A;  2DBG A;  4A2Q A;  3MOP K;  2BBZ A;  2N80 A;  3YGS C;  1Z6T A;  1D2Z B;  1UCP A;  4I16 A;  1YGO A;  2L6A A;  1D2Z A;  3J63 A;  2OF5 H;  4O9F A;  4N1K A;  2YGS A;  4NQK A;  4M9Z A;  1ICH A;  4M9X A;  4O6X A;  1A1Z A;  2L9M A;  3J6J A;  2LWD A;  1N3K A;  1WMG A;  4FH0 A;  2NZ7 A;  1CY5 A;  3EZQ A;  4D8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...