3YGSP

Apaf-1 card in complex with prodomain of procaspase-9
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
SMDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of procaspase-9 recruitment by the apoptotic protease-activating factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords APOPTOTIC PROTEASE ACTIVATING FACTOR 1
total genus 38
structure length 97
sequence length 97
ec nomenclature ec 3.4.22.62: Caspase-9.
pdb deposition date 1999-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3ygsP00
3EZQA 4FH0A 2MB9A 1A1WA 2DBHA 4M9XA 2LWDA 4D8OA 2KN6A 2L6AA 4N1LA 3YGSP 2F1SA 2DBGA 2BBRA 4UZ0A 1Z6TA 4O9FA 2LS7A 2LWEA 2MPCA 3J63A 4O9LA 3MOPA 2OF5A 4QOBA 3YGSC 4F44A 2KM6A 4IZ5E 4N1JA 1C15A 1NGRA 2N80A 1N3KA 2MN4A 1CY5A 1FADA 3J6JA 2GF5A 4RHWE 1DGNA 1ICHA 4M9SA 1A1ZA 2YVIA 3CL3A 4EWIA 2O71A 4IZAB 1E41A 2YGSA 3QF2A 1WMGA 2DO9A 2YU0A 1CWWA 1WXPA 2HM2Q 1D2ZA 4DWNA 2D96A 3KATA 2MS7A 2N00A 2A5YB 1D2ZB 4O6XA 2M5VA 1UCPA 2NSNA 2IB1A 4P4HI 1E3YA 3EZQB 2N1FA 2OF5H 4F42A 2BBZA 2VGQA 2N83A 3LQQA 4I16A 3LQRA 3MOPG 4M9ZA 2B1WA 4O7QA 2MS8A 2L9MA 2YQFA 4JUPA 1DDFA 2A9IA 2N97A 4N1KA 2G7RA 2DBFA 4E9MA 1PN5A 4A2WA 1YGOA 2NZ7A 3MOPK 3T6PA 4A2QA 4RHWA 4NQKA 2NAQA 2DBDA 2N7ZA 2P1HA 1WH4A 3CRDA 4LWDA 4IZ7B 4JQWA 4P4HA 4ZBWA
chains in the Genus database with same CATH superfamily
3EZQA 4FH0A 2MB9A 1A1WA 2MJMA 2DBHA 4M9XA 2LWDA 4D8OA 2KN6A 2L6AA 4N1LA 3YGSP 2F1SA 2DBGA 2BBRA 4UZ0A 1Z6TA 4O9FA 2LS7A 2LWEA 2MPCA 3J63A 4O9LA 3MOPA 2OF5A 4QOBA 3YGSC 4F44A 2XV9A 2KM6A 4IZ5E 4N1JA 1C15A 1NGRA 2N80A 1N3KA 2MN4A 1CY5A 1FADA 3J6JA 2GF5A 4RHWE 1DGNA 1ICHA 4M9SA 1A1ZA 2YVIA 3CL3A 4EWIA 2O71A 4IZAB 1E41A 2YGSA 3QF2A 1WMGA 2DO9A 2YU0A 1CWWA 1WXPA 2HM2Q 1D2ZA 4DWNA 2D96A 3KATA 2MS7A 2N00A 2A5YB 1D2ZB 4O6XA 2M5VA 1UCPA 2NSNA 2IB1A 4P4HI 1E3YA 3EZQB 2N1FA 2OF5H 4F42A 2BBZA 2VGQA 2N83A 3LQQA 4I16A 3LQRA 3MOPG 4M9ZA 2B1WA 4O7QA 2MS8A 2L9MA 2YQFA 4JUPA 1DDFA 2A9IA 2N97A 4N1KA 2G7RA 2DBFA 4E9MA 1PN5A 4A2WA 1YGOA 2NZ7A 3MOPK 3T6PA 4A2QA 4RHWA 4NQKA 2NAQA 2DBDA 2N7ZA 2P1HA 1WH4A 3CRDA 4LWDA 4IZ7B 4JQWA 4P4HA 4ZBWA
chains in the Genus database with same CATH topology
3EZQA 4FH0A 2MB9A 1A1WA 2MJMA 2DBHA 4M9XA 2LWDA 4D8OA 2KN6A 2L6AA 4N1LA 3YGSP 2F1SA 2DBGA 2BBRA 4UZ0A 1Z6TA 4O9FA 2LS7A 2LWEA 2MPCA 3J63A 4O9LA 3MOPA 2OF5A 4QOBA 3YGSC 4F44A 2XV9A 2KM6A 4IZ5E 4N1JA 1C15A 1NGRA 2N80A 1N3KA 2MN4A 1CY5A 1FADA 3J6JA 2GF5A 4RHWE 1DGNA 1ICHA 4M9SA 1A1ZA 2YVIA 3CL3A 4EWIA 2O71A 4IZAB 1E41A 2YGSA 3QF2A 1WMGA 2DO9A 2YU0A 1CWWA 1WXPA 2HM2Q 1D2ZA 4DWNA 2D96A 3KATA 2MS7A 2N00A 2A5YB 1D2ZB 4O6XA 2M5VA 1UCPA 2NSNA 2IB1A 4P4HI 1E3YA 3EZQB 2N1FA 2OF5H 4F42A 2BBZA 2VGQA 2N83A 3LQQA 4I16A 3LQRA 3MOPG 4M9ZA 2B1WA 4O7QA 2MS8A 2L9MA 2YQFA 4JUPA 1DDFA 2A9IA 2N97A 4N1KA 2G7RA 2DBFA 4E9MA 1PN5A 4A2WA 1YGOA 2NZ7A 3MOPK 3T6PA 4A2QA 4RHWA 4NQKA 2NAQA 2DBDA 2N7ZA 2P1HA 1WH4A 3CRDA 4LWDA 4IZ7B 4JQWA 4P4HA 4ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZQ A;  4FH0 A;  2MB9 A;  1A1W A;  2DBH A;  4M9X A;  2LWD A;  4D8O A;  2KN6 A;  2L6A A;  4N1L A;  3YGS P;  2F1S A;  2DBG A;  2BBR A;  4UZ0 A;  1Z6T A;  4O9F A;  2LS7 A;  2LWE A;  2MPC A;  3J63 A;  4O9L A;  3MOP A;  2OF5 A;  4QOB A;  3YGS C;  4F44 A;  2KM6 A;  4IZ5 E;  4N1J A;  1C15 A;  1NGR A;  2N80 A;  1N3K A;  2MN4 A;  1CY5 A;  1FAD A;  3J6J A;  2GF5 A;  4RHW E;  1DGN A;  1ICH A;  4M9S A;  1A1Z A;  2YVI A;  3CL3 A;  4EWI A;  2O71 A;  4IZA B;  1E41 A;  2YGS A;  3QF2 A;  1WMG A;  2DO9 A;  2YU0 A;  1CWW A;  1WXP A;  2HM2 Q;  1D2Z A;  4DWN A;  2D96 A;  3KAT A;  2MS7 A;  2N00 A;  2A5Y B;  1D2Z B;  4O6X A;  2M5V A;  1UCP A;  2NSN A;  2IB1 A;  4P4H I;  1E3Y A;  3EZQ B;  2N1F A;  2OF5 H;  4F42 A;  2BBZ A;  2VGQ A;  2N83 A;  3LQQ A;  4I16 A;  3LQR A;  3MOP G;  4M9Z A;  2B1W A;  4O7Q A;  2MS8 A;  2L9M A;  2YQF A;  4JUP A;  1DDF A;  2A9I A;  2N97 A;  4N1K A;  2G7R A;  2DBF A;  4E9M A;  1PN5 A;  4A2W A;  1YGO A;  2NZ7 A;  3MOP K;  3T6P A;  4A2Q A;  4RHW A;  4NQK A;  2NAQ A;  2DBD A;  2N7Z A;  2P1H A;  1WH4 A;  3CRD A;  4LWD A;  4IZ7 B;  4JQW A;  4P4H A;  4ZBW A; 
#chains in the Genus database with same CATH topology
 3EZQ A;  4FH0 A;  2MB9 A;  1A1W A;  2MJM A;  2DBH A;  4M9X A;  2LWD A;  4D8O A;  2KN6 A;  2L6A A;  4N1L A;  3YGS P;  2F1S A;  2DBG A;  2BBR A;  4UZ0 A;  1Z6T A;  4O9F A;  2LS7 A;  2LWE A;  2MPC A;  3J63 A;  4O9L A;  3MOP A;  2OF5 A;  4QOB A;  3YGS C;  4F44 A;  2XV9 A;  2KM6 A;  4IZ5 E;  4N1J A;  1C15 A;  1NGR A;  2N80 A;  1N3K A;  2MN4 A;  1CY5 A;  1FAD A;  3J6J A;  2GF5 A;  4RHW E;  1DGN A;  1ICH A;  4M9S A;  1A1Z A;  2YVI A;  3CL3 A;  4EWI A;  2O71 A;  4IZA B;  1E41 A;  2YGS A;  3QF2 A;  1WMG A;  2DO9 A;  2YU0 A;  1CWW A;  1WXP A;  2HM2 Q;  1D2Z A;  4DWN A;  2D96 A;  3KAT A;  2MS7 A;  2N00 A;  2A5Y B;  1D2Z B;  4O6X A;  2M5V A;  1UCP A;  2NSN A;  2IB1 A;  4P4H I;  1E3Y A;  3EZQ B;  2N1F A;  2OF5 H;  4F42 A;  2BBZ A;  2VGQ A;  2N83 A;  3LQQ A;  4I16 A;  3LQR A;  3MOP G;  4M9Z A;  2B1W A;  4O7Q A;  2MS8 A;  2L9M A;  2YQF A;  4JUP A;  1DDF A;  2A9I A;  2N97 A;  4N1K A;  2G7R A;  2DBF A;  4E9M A;  1PN5 A;  4A2W A;  1YGO A;  2NZ7 A;  3MOP K;  3T6P A;  4A2Q A;  4RHW A;  4NQK A;  2NAQ A;  2DBD A;  2N7Z A;  2P1H A;  1WH4 A;  3CRD A;  4LWD A;  4IZ7 B;  4JQW A;  4P4H A;  4ZBW A; 
#chains in the Genus database with same CATH homology
 3EZQ A;  4FH0 A;  2MB9 A;  1A1W A;  2MJM A;  2DBH A;  4M9X A;  2LWD A;  4D8O A;  2KN6 A;  2L6A A;  4N1L A;  3YGS P;  2F1S A;  2DBG A;  2BBR A;  4UZ0 A;  1Z6T A;  4O9F A;  2LS7 A;  2LWE A;  2MPC A;  3J63 A;  4O9L A;  3MOP A;  2OF5 A;  4QOB A;  3YGS C;  4F44 A;  2XV9 A;  2KM6 A;  4IZ5 E;  4N1J A;  1C15 A;  1NGR A;  2N80 A;  1N3K A;  2MN4 A;  1CY5 A;  1FAD A;  3J6J A;  2GF5 A;  4RHW E;  1DGN A;  1ICH A;  4M9S A;  1A1Z A;  2YVI A;  3CL3 A;  4EWI A;  2O71 A;  4IZA B;  1E41 A;  2YGS A;  3QF2 A;  1WMG A;  2DO9 A;  2YU0 A;  1CWW A;  1WXP A;  2HM2 Q;  1D2Z A;  4DWN A;  2D96 A;  3KAT A;  2MS7 A;  2N00 A;  2A5Y B;  1D2Z B;  4O6X A;  2M5V A;  1UCP A;  2NSN A;  2IB1 A;  4P4H I;  1E3Y A;  3EZQ B;  2N1F A;  2OF5 H;  4F42 A;  2BBZ A;  2VGQ A;  2N83 A;  3LQQ A;  4I16 A;  3LQR A;  3MOP G;  4M9Z A;  2B1W A;  4O7Q A;  2MS8 A;  2L9M A;  2YQF A;  4JUP A;  1DDF A;  2A9I A;  2N97 A;  4N1K A;  2G7R A;  2DBF A;  4E9M A;  1PN5 A;  4A2W A;  1YGO A;  2NZ7 A;  3MOP K;  3T6P A;  4A2Q A;  4RHW A;  4NQK A;  2NAQ A;  2DBD A;  2N7Z A;  2P1H A;  1WH4 A;  3CRD A;  4LWD A;  4IZ7 B;  4JQW A;  4P4H A;  4ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...