3YGSP

Apaf-1 card in complex with prodomain of procaspase-9
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
SMDEADRRLLRRCRLRLVEELQVDQLWDVLLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of procaspase-9 recruitment by the apoptotic protease-activating factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords APOPTOTIC PROTEASE ACTIVATING FACTOR 1
total genus 38
structure length 97
sequence length 97
ec nomenclature ec 3.4.22.62: Caspase-9.
pdb deposition date 1999-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3ygsP00
2MS8A 4M9XA 2L6AA 2N1FA 1ICHA 2G7RA 2O71A 2L9MA 3MOPA 3EZQA 2DBGA 1Z6TA 2LWEA 2BBZA 4M9SA 1FADA 4O9LA 1D2ZA 1E3YA 4E9MA 2GF5A 4RHWE 2NAQA 2OF5A 2NZ7A 4JUPA 1PN5A 1WH4A 2DBHA 2F1SA 2DBDA 4ZBWA 4QOBA 2P1HA 2NSNA 2KN6A 4IZAB 4O7QA 4N1LA 3QF2A 4P4HI 1D2ZB 1CWWA 2DBFA 1YGOA 3MOPG 1A1ZA 1CY5A 3MOPK 3J6JA 3KATA 4O9FA 2N00A 4M9ZA 4JQWA 4O6XA 4IZ7B 2MB9A 4D8OA 2D96A 2A5YB 4IZ5E 2N83A 3CL3A 2LS7A 4FH0A 4F44A 4RHWA 1WXPA 2OF5H 2MS7A 4I16A 1E41A 4LWDA 3T6PA 2YVIA 4NQKA 3LQRA 1DDFA 1NGRA 2LWDA 3YGSP 4EWIA 2MN4A 2A9IA 4N1JA 1WMGA 4N1KA 2VGQA 3CRDA 1C15A 2HM2Q 2N80A 4A2WA 2BBRA 2YGSA 4UZ0A 1DGNA 3EZQB 2YQFA 2B1WA 2KM6A 3YGSC 2DO9A 4F42A 2IB1A 2YU0A 4A2QA 1N3KA 3J63A 1A1WA 2M5VA 3LQQA 4P4HA 2MPCA 4DWNA 2N7ZA 1UCPA 2N97A
chains in the Genus database with same CATH superfamily
2MS8A 4M9XA 2L6AA 2N1FA 1ICHA 2G7RA 2O71A 2L9MA 3MOPA 3EZQA 2DBGA 1Z6TA 2LWEA 2BBZA 4M9SA 1FADA 4O9LA 1D2ZA 1E3YA 4E9MA 2GF5A 4RHWE 2NAQA 2OF5A 2NZ7A 4JUPA 1PN5A 1WH4A 2DBHA 2F1SA 2DBDA 4ZBWA 4QOBA 2P1HA 2NSNA 2KN6A 4IZAB 4O7QA 4N1LA 3QF2A 4P4HI 1D2ZB 1CWWA 2DBFA 2MJMA 1YGOA 3MOPG 1A1ZA 1CY5A 3MOPK 3J6JA 3KATA 4O9FA 2N00A 4M9ZA 4JQWA 4O6XA 4IZ7B 2MB9A 4D8OA 2D96A 2A5YB 4IZ5E 2N83A 3CL3A 2LS7A 4FH0A 4F44A 4RHWA 1WXPA 2OF5H 2MS7A 4I16A 1E41A 4LWDA 3T6PA 2YVIA 4NQKA 3LQRA 1DDFA 1NGRA 2LWDA 3YGSP 4EWIA 2MN4A 2A9IA 4N1JA 1WMGA 4N1KA 2VGQA 3CRDA 1C15A 2HM2Q 2N80A 4A2WA 2BBRA 2YGSA 4UZ0A 1DGNA 3EZQB 2YQFA 2B1WA 2KM6A 3YGSC 2DO9A 4F42A 2IB1A 2XV9A 2YU0A 4A2QA 1N3KA 3J63A 1A1WA 2M5VA 3LQQA 4P4HA 2MPCA 4DWNA 2N7ZA 1UCPA 2N97A
chains in the Genus database with same CATH topology
2MS8A 4M9XA 2L6AA 2N1FA 1ICHA 2G7RA 2O71A 2L9MA 3MOPA 3EZQA 2DBGA 1Z6TA 2LWEA 2BBZA 4M9SA 1FADA 4O9LA 1D2ZA 1E3YA 4E9MA 2GF5A 4RHWE 2NAQA 2OF5A 2NZ7A 4JUPA 1PN5A 1WH4A 2DBHA 2F1SA 2DBDA 4ZBWA 4QOBA 2P1HA 2NSNA 2KN6A 4IZAB 4O7QA 4N1LA 3QF2A 4P4HI 1D2ZB 1CWWA 2DBFA 2MJMA 1YGOA 3MOPG 1A1ZA 1CY5A 3MOPK 3J6JA 3KATA 4O9FA 2N00A 4M9ZA 4JQWA 4O6XA 4IZ7B 2MB9A 4D8OA 2D96A 2A5YB 4IZ5E 2N83A 3CL3A 2LS7A 4FH0A 4F44A 4RHWA 1WXPA 2OF5H 2MS7A 4I16A 1E41A 4LWDA 3T6PA 2YVIA 4NQKA 3LQRA 1DDFA 1NGRA 2LWDA 3YGSP 4EWIA 2MN4A 2A9IA 4N1JA 1WMGA 4N1KA 2VGQA 3CRDA 1C15A 2HM2Q 2N80A 4A2WA 2BBRA 2YGSA 4UZ0A 1DGNA 3EZQB 2YQFA 2B1WA 2KM6A 3YGSC 2DO9A 4F42A 2IB1A 2XV9A 2YU0A 4A2QA 1N3KA 3J63A 1A1WA 2M5VA 3LQQA 4P4HA 2MPCA 4DWNA 2N7ZA 1UCPA 2N97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MS8 A;  4M9X A;  2L6A A;  2N1F A;  1ICH A;  2G7R A;  2O71 A;  2L9M A;  3MOP A;  3EZQ A;  2DBG A;  1Z6T A;  2LWE A;  2BBZ A;  4M9S A;  1FAD A;  4O9L A;  1D2Z A;  1E3Y A;  4E9M A;  2GF5 A;  4RHW E;  2NAQ A;  2OF5 A;  2NZ7 A;  4JUP A;  1PN5 A;  1WH4 A;  2DBH A;  2F1S A;  2DBD A;  4ZBW A;  4QOB A;  2P1H A;  2NSN A;  2KN6 A;  4IZA B;  4O7Q A;  4N1L A;  3QF2 A;  4P4H I;  1D2Z B;  1CWW A;  2DBF A;  1YGO A;  3MOP G;  1A1Z A;  1CY5 A;  3MOP K;  3J6J A;  3KAT A;  4O9F A;  2N00 A;  4M9Z A;  4JQW A;  4O6X A;  4IZ7 B;  2MB9 A;  4D8O A;  2D96 A;  2A5Y B;  4IZ5 E;  2N83 A;  3CL3 A;  2LS7 A;  4FH0 A;  4F44 A;  4RHW A;  1WXP A;  2OF5 H;  2MS7 A;  4I16 A;  1E41 A;  4LWD A;  3T6P A;  2YVI A;  4NQK A;  3LQR A;  1DDF A;  1NGR A;  2LWD A;  3YGS P;  4EWI A;  2MN4 A;  2A9I A;  4N1J A;  1WMG A;  4N1K A;  2VGQ A;  3CRD A;  1C15 A;  2HM2 Q;  2N80 A;  4A2W A;  2BBR A;  2YGS A;  4UZ0 A;  1DGN A;  3EZQ B;  2YQF A;  2B1W A;  2KM6 A;  3YGS C;  2DO9 A;  4F42 A;  2IB1 A;  2YU0 A;  4A2Q A;  1N3K A;  3J63 A;  1A1W A;  2M5V A;  3LQQ A;  4P4H A;  2MPC A;  4DWN A;  2N7Z A;  1UCP A;  2N97 A; 
#chains in the Genus database with same CATH topology
 2MS8 A;  4M9X A;  2L6A A;  2N1F A;  1ICH A;  2G7R A;  2O71 A;  2L9M A;  3MOP A;  3EZQ A;  2DBG A;  1Z6T A;  2LWE A;  2BBZ A;  4M9S A;  1FAD A;  4O9L A;  1D2Z A;  1E3Y A;  4E9M A;  2GF5 A;  4RHW E;  2NAQ A;  2OF5 A;  2NZ7 A;  4JUP A;  1PN5 A;  1WH4 A;  2DBH A;  2F1S A;  2DBD A;  4ZBW A;  4QOB A;  2P1H A;  2NSN A;  2KN6 A;  4IZA B;  4O7Q A;  4N1L A;  3QF2 A;  4P4H I;  1D2Z B;  1CWW A;  2DBF A;  2MJM A;  1YGO A;  3MOP G;  1A1Z A;  1CY5 A;  3MOP K;  3J6J A;  3KAT A;  4O9F A;  2N00 A;  4M9Z A;  4JQW A;  4O6X A;  4IZ7 B;  2MB9 A;  4D8O A;  2D96 A;  2A5Y B;  4IZ5 E;  2N83 A;  3CL3 A;  2LS7 A;  4FH0 A;  4F44 A;  4RHW A;  1WXP A;  2OF5 H;  2MS7 A;  4I16 A;  1E41 A;  4LWD A;  3T6P A;  2YVI A;  4NQK A;  3LQR A;  1DDF A;  1NGR A;  2LWD A;  3YGS P;  4EWI A;  2MN4 A;  2A9I A;  4N1J A;  1WMG A;  4N1K A;  2VGQ A;  3CRD A;  1C15 A;  2HM2 Q;  2N80 A;  4A2W A;  2BBR A;  2YGS A;  4UZ0 A;  1DGN A;  3EZQ B;  2YQF A;  2B1W A;  2KM6 A;  3YGS C;  2DO9 A;  4F42 A;  2IB1 A;  2XV9 A;  2YU0 A;  4A2Q A;  1N3K A;  3J63 A;  1A1W A;  2M5V A;  3LQQ A;  4P4H A;  2MPC A;  4DWN A;  2N7Z A;  1UCP A;  2N97 A; 
#chains in the Genus database with same CATH homology
 2MS8 A;  4M9X A;  2L6A A;  2N1F A;  1ICH A;  2G7R A;  2O71 A;  2L9M A;  3MOP A;  3EZQ A;  2DBG A;  1Z6T A;  2LWE A;  2BBZ A;  4M9S A;  1FAD A;  4O9L A;  1D2Z A;  1E3Y A;  4E9M A;  2GF5 A;  4RHW E;  2NAQ A;  2OF5 A;  2NZ7 A;  4JUP A;  1PN5 A;  1WH4 A;  2DBH A;  2F1S A;  2DBD A;  4ZBW A;  4QOB A;  2P1H A;  2NSN A;  2KN6 A;  4IZA B;  4O7Q A;  4N1L A;  3QF2 A;  4P4H I;  1D2Z B;  1CWW A;  2DBF A;  2MJM A;  1YGO A;  3MOP G;  1A1Z A;  1CY5 A;  3MOP K;  3J6J A;  3KAT A;  4O9F A;  2N00 A;  4M9Z A;  4JQW A;  4O6X A;  4IZ7 B;  2MB9 A;  4D8O A;  2D96 A;  2A5Y B;  4IZ5 E;  2N83 A;  3CL3 A;  2LS7 A;  4FH0 A;  4F44 A;  4RHW A;  1WXP A;  2OF5 H;  2MS7 A;  4I16 A;  1E41 A;  4LWD A;  3T6P A;  2YVI A;  4NQK A;  3LQR A;  1DDF A;  1NGR A;  2LWD A;  3YGS P;  4EWI A;  2MN4 A;  2A9I A;  4N1J A;  1WMG A;  4N1K A;  2VGQ A;  3CRD A;  1C15 A;  2HM2 Q;  2N80 A;  4A2W A;  2BBR A;  2YGS A;  4UZ0 A;  1DGN A;  3EZQ B;  2YQF A;  2B1W A;  2KM6 A;  3YGS C;  2DO9 A;  4F42 A;  2IB1 A;  2XV9 A;  2YU0 A;  4A2Q A;  1N3K A;  3J63 A;  1A1W A;  2M5V A;  3LQQ A;  4P4H A;  2MPC A;  4DWN A;  2N7Z A;  1UCP A;  2N97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...