4JQWA

Crystal structure of a complex of nod1 card and ubiquitin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
91
Chain Sequence
HPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complex of NOD1 CARD and ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signalling protein
molecule keywords Nucleotide-binding oligomerization domain-containing protein
total genus 29
structure length 91
sequence length 92
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4jqwA00
3T6PA 1E3YA 4M9XA 4N1KA 4JUPA 1WMGA 4N1JA 3CRDA 3YGSP 2G7RA 4P4HA 2DBHA 2KM6A 1DDFA 3EZQA 4A2WA 2MB9A 4O9FA 2IB1A 2MPCA 4M9ZA 2NAQA 2YU0A 1FADA 1D2ZB 4DWNA 2N97A 1D2ZA 2GF5A 2LWEA 3LQQA 4E9MA 4O9LA 1ICHA 2DO9A 1WH4A 3QF2A 2YQFA 2LS7A 2N83A 2LWDA 4LWDA 3YGSC 1DGNA 2BBZA 4EWIA 2DBGA 2A9IA 1E41A 2HM2Q 3KATA 2P1HA 2B1WA 2YVIA 2D96A 2O71A 1Z6TA 4I16A 3J63A 2MS7A 4D8OA 2F1SA 2VGQA 2OF5A 4O7QA 4P4HI 3LQRA 1N3KA 1CWWA 2NZ7A 3EZQB 1NGRA 3CL3A 4FH0A 1WXPA 4IZ5E 2A5YB 2N00A 3MOPK 4QOBA 4F44A 2N1FA 2N80A 4IZ7B 2DBFA 2YGSA 2MS8A 2M5VA 1A1WA 4JQWA 1CY5A 3MOPA 4RHWE 4ZBWA 4A2QA 4F42A 2L6AA 2OF5H 3MOPG 4RHWA 2MN4A 2N7ZA 4IZAB 4UZ0A 1A1ZA 1UCPA 2BBRA 1PN5A 4M9SA 2KN6A 2NSNA 4N1LA 3J6JA 4NQKA 2L9MA 1YGOA 4O6XA 1C15A 2DBDA
chains in the Genus database with same CATH superfamily
3T6PA 1E3YA 4M9XA 4N1KA 4JUPA 1WMGA 4N1JA 3CRDA 3YGSP 2G7RA 4P4HA 2DBHA 2KM6A 1DDFA 3EZQA 4A2WA 2MB9A 4O9FA 2IB1A 2MPCA 4M9ZA 2NAQA 2YU0A 1FADA 1D2ZB 4DWNA 2N97A 1D2ZA 2GF5A 2LWEA 3LQQA 4E9MA 4O9LA 1ICHA 2DO9A 1WH4A 3QF2A 2YQFA 2LS7A 2N83A 2LWDA 4LWDA 3YGSC 1DGNA 2BBZA 4EWIA 2DBGA 2A9IA 1E41A 2HM2Q 3KATA 2P1HA 2B1WA 2YVIA 2D96A 2O71A 1Z6TA 4I16A 3J63A 2MS7A 4D8OA 2F1SA 2VGQA 2OF5A 4O7QA 4P4HI 3LQRA 1N3KA 1CWWA 2NZ7A 3EZQB 1NGRA 3CL3A 4FH0A 1WXPA 4IZ5E 2A5YB 2N00A 3MOPK 4QOBA 4F44A 2MJMA 2N1FA 2N80A 4IZ7B 2DBFA 2YGSA 2MS8A 2M5VA 1A1WA 4JQWA 1CY5A 3MOPA 4RHWE 4ZBWA 4A2QA 4F42A 2L6AA 2OF5H 3MOPG 2XV9A 4RHWA 2MN4A 2N7ZA 4IZAB 4UZ0A 1A1ZA 1UCPA 2BBRA 1PN5A 4M9SA 2KN6A 2NSNA 4N1LA 3J6JA 4NQKA 2L9MA 1YGOA 4O6XA 1C15A 2DBDA
chains in the Genus database with same CATH topology
3T6PA 1E3YA 4M9XA 4N1KA 4JUPA 1WMGA 4N1JA 3CRDA 3YGSP 2G7RA 4P4HA 2DBHA 2KM6A 1DDFA 3EZQA 4A2WA 2MB9A 4O9FA 2IB1A 2MPCA 4M9ZA 2NAQA 2YU0A 1FADA 1D2ZB 4DWNA 2N97A 1D2ZA 2GF5A 2LWEA 3LQQA 4E9MA 4O9LA 1ICHA 2DO9A 1WH4A 3QF2A 2YQFA 2LS7A 2N83A 2LWDA 4LWDA 3YGSC 1DGNA 2BBZA 4EWIA 2DBGA 2A9IA 1E41A 2HM2Q 3KATA 2P1HA 2B1WA 2YVIA 2D96A 2O71A 1Z6TA 4I16A 3J63A 2MS7A 4D8OA 2F1SA 2VGQA 2OF5A 4O7QA 4P4HI 3LQRA 1N3KA 1CWWA 2NZ7A 3EZQB 1NGRA 3CL3A 4FH0A 1WXPA 4IZ5E 2A5YB 2N00A 3MOPK 4QOBA 4F44A 2MJMA 2N1FA 2N80A 4IZ7B 2DBFA 2YGSA 2MS8A 2M5VA 1A1WA 4JQWA 1CY5A 3MOPA 4RHWE 4ZBWA 4A2QA 4F42A 2L6AA 2OF5H 3MOPG 2XV9A 4RHWA 2MN4A 2N7ZA 4IZAB 4UZ0A 1A1ZA 1UCPA 2BBRA 1PN5A 4M9SA 2KN6A 2NSNA 4N1LA 3J6JA 4NQKA 2L9MA 1YGOA 4O6XA 1C15A 2DBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6P A;  1E3Y A;  4M9X A;  4N1K A;  4JUP A;  1WMG A;  4N1J A;  3CRD A;  3YGS P;  2G7R A;  4P4H A;  2DBH A;  2KM6 A;  1DDF A;  3EZQ A;  4A2W A;  2MB9 A;  4O9F A;  2IB1 A;  2MPC A;  4M9Z A;  2NAQ A;  2YU0 A;  1FAD A;  1D2Z B;  4DWN A;  2N97 A;  1D2Z A;  2GF5 A;  2LWE A;  3LQQ A;  4E9M A;  4O9L A;  1ICH A;  2DO9 A;  1WH4 A;  3QF2 A;  2YQF A;  2LS7 A;  2N83 A;  2LWD A;  4LWD A;  3YGS C;  1DGN A;  2BBZ A;  4EWI A;  2DBG A;  2A9I A;  1E41 A;  2HM2 Q;  3KAT A;  2P1H A;  2B1W A;  2YVI A;  2D96 A;  2O71 A;  1Z6T A;  4I16 A;  3J63 A;  2MS7 A;  4D8O A;  2F1S A;  2VGQ A;  2OF5 A;  4O7Q A;  4P4H I;  3LQR A;  1N3K A;  1CWW A;  2NZ7 A;  3EZQ B;  1NGR A;  3CL3 A;  4FH0 A;  1WXP A;  4IZ5 E;  2A5Y B;  2N00 A;  3MOP K;  4QOB A;  4F44 A;  2N1F A;  2N80 A;  4IZ7 B;  2DBF A;  2YGS A;  2MS8 A;  2M5V A;  1A1W A;  4JQW A;  1CY5 A;  3MOP A;  4RHW E;  4ZBW A;  4A2Q A;  4F42 A;  2L6A A;  2OF5 H;  3MOP G;  4RHW A;  2MN4 A;  2N7Z A;  4IZA B;  4UZ0 A;  1A1Z A;  1UCP A;  2BBR A;  1PN5 A;  4M9S A;  2KN6 A;  2NSN A;  4N1L A;  3J6J A;  4NQK A;  2L9M A;  1YGO A;  4O6X A;  1C15 A;  2DBD A; 
#chains in the Genus database with same CATH topology
 3T6P A;  1E3Y A;  4M9X A;  4N1K A;  4JUP A;  1WMG A;  4N1J A;  3CRD A;  3YGS P;  2G7R A;  4P4H A;  2DBH A;  2KM6 A;  1DDF A;  3EZQ A;  4A2W A;  2MB9 A;  4O9F A;  2IB1 A;  2MPC A;  4M9Z A;  2NAQ A;  2YU0 A;  1FAD A;  1D2Z B;  4DWN A;  2N97 A;  1D2Z A;  2GF5 A;  2LWE A;  3LQQ A;  4E9M A;  4O9L A;  1ICH A;  2DO9 A;  1WH4 A;  3QF2 A;  2YQF A;  2LS7 A;  2N83 A;  2LWD A;  4LWD A;  3YGS C;  1DGN A;  2BBZ A;  4EWI A;  2DBG A;  2A9I A;  1E41 A;  2HM2 Q;  3KAT A;  2P1H A;  2B1W A;  2YVI A;  2D96 A;  2O71 A;  1Z6T A;  4I16 A;  3J63 A;  2MS7 A;  4D8O A;  2F1S A;  2VGQ A;  2OF5 A;  4O7Q A;  4P4H I;  3LQR A;  1N3K A;  1CWW A;  2NZ7 A;  3EZQ B;  1NGR A;  3CL3 A;  4FH0 A;  1WXP A;  4IZ5 E;  2A5Y B;  2N00 A;  3MOP K;  4QOB A;  4F44 A;  2MJM A;  2N1F A;  2N80 A;  4IZ7 B;  2DBF A;  2YGS A;  2MS8 A;  2M5V A;  1A1W A;  4JQW A;  1CY5 A;  3MOP A;  4RHW E;  4ZBW A;  4A2Q A;  4F42 A;  2L6A A;  2OF5 H;  3MOP G;  2XV9 A;  4RHW A;  2MN4 A;  2N7Z A;  4IZA B;  4UZ0 A;  1A1Z A;  1UCP A;  2BBR A;  1PN5 A;  4M9S A;  2KN6 A;  2NSN A;  4N1L A;  3J6J A;  4NQK A;  2L9M A;  1YGO A;  4O6X A;  1C15 A;  2DBD A; 
#chains in the Genus database with same CATH homology
 3T6P A;  1E3Y A;  4M9X A;  4N1K A;  4JUP A;  1WMG A;  4N1J A;  3CRD A;  3YGS P;  2G7R A;  4P4H A;  2DBH A;  2KM6 A;  1DDF A;  3EZQ A;  4A2W A;  2MB9 A;  4O9F A;  2IB1 A;  2MPC A;  4M9Z A;  2NAQ A;  2YU0 A;  1FAD A;  1D2Z B;  4DWN A;  2N97 A;  1D2Z A;  2GF5 A;  2LWE A;  3LQQ A;  4E9M A;  4O9L A;  1ICH A;  2DO9 A;  1WH4 A;  3QF2 A;  2YQF A;  2LS7 A;  2N83 A;  2LWD A;  4LWD A;  3YGS C;  1DGN A;  2BBZ A;  4EWI A;  2DBG A;  2A9I A;  1E41 A;  2HM2 Q;  3KAT A;  2P1H A;  2B1W A;  2YVI A;  2D96 A;  2O71 A;  1Z6T A;  4I16 A;  3J63 A;  2MS7 A;  4D8O A;  2F1S A;  2VGQ A;  2OF5 A;  4O7Q A;  4P4H I;  3LQR A;  1N3K A;  1CWW A;  2NZ7 A;  3EZQ B;  1NGR A;  3CL3 A;  4FH0 A;  1WXP A;  4IZ5 E;  2A5Y B;  2N00 A;  3MOP K;  4QOB A;  4F44 A;  2MJM A;  2N1F A;  2N80 A;  4IZ7 B;  2DBF A;  2YGS A;  2MS8 A;  2M5V A;  1A1W A;  4JQW A;  1CY5 A;  3MOP A;  4RHW E;  4ZBW A;  4A2Q A;  4F42 A;  2L6A A;  2OF5 H;  3MOP G;  2XV9 A;  4RHW A;  2MN4 A;  2N7Z A;  4IZA B;  4UZ0 A;  1A1Z A;  1UCP A;  2BBR A;  1PN5 A;  4M9S A;  2KN6 A;  2NSN A;  4N1L A;  3J6J A;  4NQK A;  2L9M A;  1YGO A;  4O6X A;  1C15 A;  2DBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...