4JQWA

Crystal structure of a complex of nod1 card and ubiquitin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
92
structure length
91
Chain Sequence
HPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complex of NOD1 CARD and ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signalling protein
molecule keywords Nucleotide-binding oligomerization domain-containing protein
total genus 29
structure length 91
sequence length 92
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4jqwA00
4IZ7B 1A1WA 4N1LA 4LWDA 4ZBWA 2N97A 2BBZA 2L6AA 2BBRA 3MOPA 4RHWA 2LS7A 1A1ZA 3LQQA 2L9MA 2O71A 1DGNA 4A2QA 2A9IA 3LQRA 4FH0A 4P4HA 2MS8A 1CWWA 4D8OA 2VGQA 4F44A 2P1HA 1CY5A 4EWIA 1DDFA 3YGSC 2MB9A 3MOPK 2OF5A 4IZ5E 4E9MA 1E3YA 2KN6A 2MPCA 2IB1A 4DWNA 4A2WA 2DBFA 3EZQA 2MS7A 2G7RA 2DBHA 4JQWA 4P4HI 2DBGA 4JUPA 1C15A 3J6JA 3CL3A 2LWDA 1ICHA 3MOPG 2F1SA 1NGRA 2D96A 4QOBA 2HM2Q 1D2ZA 2NAQA 2DBDA 2OF5H 2MN4A 2N1FA 1Z6TA 3CRDA 4NQKA 4O9LA 1N3KA 3KATA 1FADA 2YVIA 1PN5A 4M9XA 2N83A 4RHWE 3J63A 2KM6A 1D2ZB 2YGSA 2M5VA 3EZQB 2LWEA 4UZ0A 2GF5A 3YGSP 4N1JA 2A5YB 1WH4A 4I16A 4IZAB 4O7QA 2N80A 2B1WA 2N00A 3T6PA 2DO9A 2YU0A 1UCPA 1WMGA 2NSNA 4O6XA 4O9FA 2YQFA 4M9SA 2N7ZA 3QF2A 4M9ZA 1WXPA 1E41A 1YGOA 4N1KA 4F42A 2NZ7A
chains in the Genus database with same CATH superfamily
4IZ7B 1A1WA 4N1LA 4LWDA 4ZBWA 2N97A 2BBZA 2L6AA 2BBRA 3MOPA 4RHWA 2LS7A 1A1ZA 3LQQA 2L9MA 2O71A 1DGNA 4A2QA 2A9IA 3LQRA 4FH0A 4P4HA 2MS8A 1CWWA 4D8OA 2VGQA 2MJMA 4F44A 2P1HA 1CY5A 4EWIA 1DDFA 3YGSC 2MB9A 3MOPK 2OF5A 4IZ5E 4E9MA 1E3YA 2KN6A 2MPCA 2IB1A 4DWNA 4A2WA 2DBFA 3EZQA 2MS7A 2G7RA 2DBHA 4JQWA 4P4HI 2XV9A 2DBGA 4JUPA 1C15A 3J6JA 3CL3A 2LWDA 1ICHA 3MOPG 2F1SA 1NGRA 2D96A 4QOBA 2HM2Q 1D2ZA 2NAQA 2DBDA 2OF5H 2MN4A 2N1FA 1Z6TA 3CRDA 4NQKA 4O9LA 1N3KA 3KATA 1FADA 2YVIA 1PN5A 4M9XA 2N83A 4RHWE 3J63A 2KM6A 1D2ZB 2YGSA 2M5VA 3EZQB 2LWEA 4UZ0A 2GF5A 3YGSP 4N1JA 2A5YB 1WH4A 4I16A 4IZAB 4O7QA 2N80A 2B1WA 2N00A 3T6PA 2DO9A 2YU0A 1UCPA 1WMGA 2NSNA 4O6XA 4O9FA 2YQFA 4M9SA 2N7ZA 3QF2A 4M9ZA 1WXPA 1E41A 1YGOA 4N1KA 4F42A 2NZ7A
chains in the Genus database with same CATH topology
4IZ7B 1A1WA 4N1LA 4LWDA 4ZBWA 2N97A 2BBZA 2L6AA 2BBRA 3MOPA 4RHWA 2LS7A 1A1ZA 3LQQA 2L9MA 2O71A 1DGNA 4A2QA 2A9IA 3LQRA 4FH0A 4P4HA 2MS8A 1CWWA 4D8OA 2VGQA 2MJMA 4F44A 2P1HA 1CY5A 4EWIA 1DDFA 3YGSC 2MB9A 3MOPK 2OF5A 4IZ5E 4E9MA 1E3YA 2KN6A 2MPCA 2IB1A 4DWNA 4A2WA 2DBFA 3EZQA 2MS7A 2G7RA 2DBHA 4JQWA 4P4HI 2XV9A 2DBGA 4JUPA 1C15A 3J6JA 3CL3A 2LWDA 1ICHA 3MOPG 2F1SA 1NGRA 2D96A 4QOBA 2HM2Q 1D2ZA 2NAQA 2DBDA 2OF5H 2MN4A 2N1FA 1Z6TA 3CRDA 4NQKA 4O9LA 1N3KA 3KATA 1FADA 2YVIA 1PN5A 4M9XA 2N83A 4RHWE 3J63A 2KM6A 1D2ZB 2YGSA 2M5VA 3EZQB 2LWEA 4UZ0A 2GF5A 3YGSP 4N1JA 2A5YB 1WH4A 4I16A 4IZAB 4O7QA 2N80A 2B1WA 2N00A 3T6PA 2DO9A 2YU0A 1UCPA 1WMGA 2NSNA 4O6XA 4O9FA 2YQFA 4M9SA 2N7ZA 3QF2A 4M9ZA 1WXPA 1E41A 1YGOA 4N1KA 4F42A 2NZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ7 B;  1A1W A;  4N1L A;  4LWD A;  4ZBW A;  2N97 A;  2BBZ A;  2L6A A;  2BBR A;  3MOP A;  4RHW A;  2LS7 A;  1A1Z A;  3LQQ A;  2L9M A;  2O71 A;  1DGN A;  4A2Q A;  2A9I A;  3LQR A;  4FH0 A;  4P4H A;  2MS8 A;  1CWW A;  4D8O A;  2VGQ A;  4F44 A;  2P1H A;  1CY5 A;  4EWI A;  1DDF A;  3YGS C;  2MB9 A;  3MOP K;  2OF5 A;  4IZ5 E;  4E9M A;  1E3Y A;  2KN6 A;  2MPC A;  2IB1 A;  4DWN A;  4A2W A;  2DBF A;  3EZQ A;  2MS7 A;  2G7R A;  2DBH A;  4JQW A;  4P4H I;  2DBG A;  4JUP A;  1C15 A;  3J6J A;  3CL3 A;  2LWD A;  1ICH A;  3MOP G;  2F1S A;  1NGR A;  2D96 A;  4QOB A;  2HM2 Q;  1D2Z A;  2NAQ A;  2DBD A;  2OF5 H;  2MN4 A;  2N1F A;  1Z6T A;  3CRD A;  4NQK A;  4O9L A;  1N3K A;  3KAT A;  1FAD A;  2YVI A;  1PN5 A;  4M9X A;  2N83 A;  4RHW E;  3J63 A;  2KM6 A;  1D2Z B;  2YGS A;  2M5V A;  3EZQ B;  2LWE A;  4UZ0 A;  2GF5 A;  3YGS P;  4N1J A;  2A5Y B;  1WH4 A;  4I16 A;  4IZA B;  4O7Q A;  2N80 A;  2B1W A;  2N00 A;  3T6P A;  2DO9 A;  2YU0 A;  1UCP A;  1WMG A;  2NSN A;  4O6X A;  4O9F A;  2YQF A;  4M9S A;  2N7Z A;  3QF2 A;  4M9Z A;  1WXP A;  1E41 A;  1YGO A;  4N1K A;  4F42 A;  2NZ7 A; 
#chains in the Genus database with same CATH topology
 4IZ7 B;  1A1W A;  4N1L A;  4LWD A;  4ZBW A;  2N97 A;  2BBZ A;  2L6A A;  2BBR A;  3MOP A;  4RHW A;  2LS7 A;  1A1Z A;  3LQQ A;  2L9M A;  2O71 A;  1DGN A;  4A2Q A;  2A9I A;  3LQR A;  4FH0 A;  4P4H A;  2MS8 A;  1CWW A;  4D8O A;  2VGQ A;  2MJM A;  4F44 A;  2P1H A;  1CY5 A;  4EWI A;  1DDF A;  3YGS C;  2MB9 A;  3MOP K;  2OF5 A;  4IZ5 E;  4E9M A;  1E3Y A;  2KN6 A;  2MPC A;  2IB1 A;  4DWN A;  4A2W A;  2DBF A;  3EZQ A;  2MS7 A;  2G7R A;  2DBH A;  4JQW A;  4P4H I;  2XV9 A;  2DBG A;  4JUP A;  1C15 A;  3J6J A;  3CL3 A;  2LWD A;  1ICH A;  3MOP G;  2F1S A;  1NGR A;  2D96 A;  4QOB A;  2HM2 Q;  1D2Z A;  2NAQ A;  2DBD A;  2OF5 H;  2MN4 A;  2N1F A;  1Z6T A;  3CRD A;  4NQK A;  4O9L A;  1N3K A;  3KAT A;  1FAD A;  2YVI A;  1PN5 A;  4M9X A;  2N83 A;  4RHW E;  3J63 A;  2KM6 A;  1D2Z B;  2YGS A;  2M5V A;  3EZQ B;  2LWE A;  4UZ0 A;  2GF5 A;  3YGS P;  4N1J A;  2A5Y B;  1WH4 A;  4I16 A;  4IZA B;  4O7Q A;  2N80 A;  2B1W A;  2N00 A;  3T6P A;  2DO9 A;  2YU0 A;  1UCP A;  1WMG A;  2NSN A;  4O6X A;  4O9F A;  2YQF A;  4M9S A;  2N7Z A;  3QF2 A;  4M9Z A;  1WXP A;  1E41 A;  1YGO A;  4N1K A;  4F42 A;  2NZ7 A; 
#chains in the Genus database with same CATH homology
 4IZ7 B;  1A1W A;  4N1L A;  4LWD A;  4ZBW A;  2N97 A;  2BBZ A;  2L6A A;  2BBR A;  3MOP A;  4RHW A;  2LS7 A;  1A1Z A;  3LQQ A;  2L9M A;  2O71 A;  1DGN A;  4A2Q A;  2A9I A;  3LQR A;  4FH0 A;  4P4H A;  2MS8 A;  1CWW A;  4D8O A;  2VGQ A;  2MJM A;  4F44 A;  2P1H A;  1CY5 A;  4EWI A;  1DDF A;  3YGS C;  2MB9 A;  3MOP K;  2OF5 A;  4IZ5 E;  4E9M A;  1E3Y A;  2KN6 A;  2MPC A;  2IB1 A;  4DWN A;  4A2W A;  2DBF A;  3EZQ A;  2MS7 A;  2G7R A;  2DBH A;  4JQW A;  4P4H I;  2XV9 A;  2DBG A;  4JUP A;  1C15 A;  3J6J A;  3CL3 A;  2LWD A;  1ICH A;  3MOP G;  2F1S A;  1NGR A;  2D96 A;  4QOB A;  2HM2 Q;  1D2Z A;  2NAQ A;  2DBD A;  2OF5 H;  2MN4 A;  2N1F A;  1Z6T A;  3CRD A;  4NQK A;  4O9L A;  1N3K A;  3KAT A;  1FAD A;  2YVI A;  1PN5 A;  4M9X A;  2N83 A;  4RHW E;  3J63 A;  2KM6 A;  1D2Z B;  2YGS A;  2M5V A;  3EZQ B;  2LWE A;  4UZ0 A;  2GF5 A;  3YGS P;  4N1J A;  2A5Y B;  1WH4 A;  4I16 A;  4IZA B;  4O7Q A;  2N80 A;  2B1W A;  2N00 A;  3T6P A;  2DO9 A;  2YU0 A;  1UCP A;  1WMG A;  2NSN A;  4O6X A;  4O9F A;  2YQF A;  4M9S A;  2N7Z A;  3QF2 A;  4M9Z A;  1WXP A;  1E41 A;  1YGO A;  4N1K A;  4F42 A;  2NZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...