2MPCA

Solution structure of the pyrin domain of human pyrin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
90
structure length
90
Chain Sequence
TPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Multifaceted Binding Modes for Pyrin and ASC Pyrin Domains gives Insights into Pyrin Inflammasome Assembly
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pyrin
total genus 27
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mpcA00
2N83A 1FADA 4M9XA 2HM2Q 2N1FA 2D96A 2MS7A 3T6PA 2N00A 1NGRA 4DWNA 1A1WA 2OF5A 4IZAB 2YGSA 3EZQA 2OF5H 1YGOA 4N1KA 4P4HA 2MPCA 2MN4A 2IB1A 2DBDA 2MB9A 4P4HI 3LQQA 2A9IA 1WH4A 4D8OA 2KN6A 3CRDA 3YGSP 4JUPA 2N80A 1A1ZA 2GF5A 4LWDA 1DDFA 1D2ZA 1N3KA 4RHWE 1D2ZB 3J63A 1CWWA 2N97A 4O7QA 1E41A 3J6JA 2KM6A 1CY5A 4IZ5E 4I16A 3MOPA 2NAQA 4QOBA 2LS7A 1E3YA 4UZ0A 4IZ7B 1PN5A 2A5YB 4E9MA 2DBGA 3MOPG 2DBHA 4NQKA 2BBRA 2LWDA 1ICHA 2P1HA 4RHWA 3LQRA 4F42A 4F44A 4FH0A 4M9ZA 4O9FA 2YU0A 4A2QA 3KATA 3EZQB 1Z6TA 2M5VA 4EWIA 4ZBWA 3CL3A 2F1SA 2NSNA 2L9MA 4O6XA 4M9SA 4N1LA 1UCPA 3MOPK 2G7RA 2DBFA 2N7ZA 2YQFA 2YVIA 1C15A 2MS8A 4JQWA 2LWEA 2O71A 2DO9A 2VGQA 2BBZA 2B1WA 4O9LA 4A2WA 2L6AA 3YGSC 4N1JA 3QF2A 1WMGA 1DGNA 1WXPA 2NZ7A
chains in the Genus database with same CATH superfamily
2N83A 1FADA 4M9XA 2HM2Q 2N1FA 2D96A 2MS7A 3T6PA 2N00A 1NGRA 4DWNA 1A1WA 2OF5A 4IZAB 2YGSA 3EZQA 2OF5H 1YGOA 4N1KA 4P4HA 2MPCA 2MN4A 2IB1A 2DBDA 2MB9A 4P4HI 3LQQA 2A9IA 1WH4A 4D8OA 2KN6A 3CRDA 3YGSP 4JUPA 2N80A 1A1ZA 2GF5A 4LWDA 1DDFA 1D2ZA 1N3KA 4RHWE 1D2ZB 3J63A 1CWWA 2N97A 4O7QA 1E41A 3J6JA 2KM6A 2XV9A 1CY5A 4IZ5E 4I16A 3MOPA 2NAQA 4QOBA 2LS7A 1E3YA 4UZ0A 4IZ7B 1PN5A 2A5YB 4E9MA 2DBGA 3MOPG 2DBHA 4NQKA 2BBRA 2LWDA 1ICHA 2P1HA 4RHWA 3LQRA 4F42A 4F44A 4FH0A 4M9ZA 4O9FA 2YU0A 4A2QA 3KATA 3EZQB 1Z6TA 2M5VA 4EWIA 4ZBWA 3CL3A 2F1SA 2NSNA 2L9MA 4O6XA 4M9SA 4N1LA 1UCPA 3MOPK 2G7RA 2DBFA 2N7ZA 2YQFA 2YVIA 1C15A 2MS8A 4JQWA 2LWEA 2O71A 2DO9A 2VGQA 2BBZA 2B1WA 4O9LA 4A2WA 2L6AA 3YGSC 4N1JA 3QF2A 1WMGA 1DGNA 1WXPA 2NZ7A 2MJMA
chains in the Genus database with same CATH topology
2N83A 1FADA 4M9XA 2HM2Q 2N1FA 2D96A 2MS7A 3T6PA 2N00A 1NGRA 4DWNA 1A1WA 2OF5A 4IZAB 2YGSA 3EZQA 2OF5H 1YGOA 4N1KA 4P4HA 2MPCA 2MN4A 2IB1A 2DBDA 2MB9A 4P4HI 3LQQA 2A9IA 1WH4A 4D8OA 2KN6A 3CRDA 3YGSP 4JUPA 2N80A 1A1ZA 2GF5A 4LWDA 1DDFA 1D2ZA 1N3KA 4RHWE 1D2ZB 3J63A 1CWWA 2N97A 4O7QA 1E41A 3J6JA 2KM6A 2XV9A 1CY5A 4IZ5E 4I16A 3MOPA 2NAQA 4QOBA 2LS7A 1E3YA 4UZ0A 4IZ7B 1PN5A 2A5YB 4E9MA 2DBGA 3MOPG 2DBHA 4NQKA 2BBRA 2LWDA 1ICHA 2P1HA 4RHWA 3LQRA 4F42A 4F44A 4FH0A 4M9ZA 4O9FA 2YU0A 4A2QA 3KATA 3EZQB 1Z6TA 2M5VA 4EWIA 4ZBWA 3CL3A 2F1SA 2NSNA 2L9MA 4O6XA 4M9SA 4N1LA 1UCPA 3MOPK 2G7RA 2DBFA 2N7ZA 2YQFA 2YVIA 1C15A 2MS8A 4JQWA 2LWEA 2O71A 2DO9A 2VGQA 2BBZA 2B1WA 4O9LA 4A2WA 2L6AA 3YGSC 4N1JA 3QF2A 1WMGA 1DGNA 1WXPA 2NZ7A 2MJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N83 A;  1FAD A;  4M9X A;  2HM2 Q;  2N1F A;  2D96 A;  2MS7 A;  3T6P A;  2N00 A;  1NGR A;  4DWN A;  1A1W A;  2OF5 A;  4IZA B;  2YGS A;  3EZQ A;  2OF5 H;  1YGO A;  4N1K A;  4P4H A;  2MPC A;  2MN4 A;  2IB1 A;  2DBD A;  2MB9 A;  4P4H I;  3LQQ A;  2A9I A;  1WH4 A;  4D8O A;  2KN6 A;  3CRD A;  3YGS P;  4JUP A;  2N80 A;  1A1Z A;  2GF5 A;  4LWD A;  1DDF A;  1D2Z A;  1N3K A;  4RHW E;  1D2Z B;  3J63 A;  1CWW A;  2N97 A;  4O7Q A;  1E41 A;  3J6J A;  2KM6 A;  1CY5 A;  4IZ5 E;  4I16 A;  3MOP A;  2NAQ A;  4QOB A;  2LS7 A;  1E3Y A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2A5Y B;  4E9M A;  2DBG A;  3MOP G;  2DBH A;  4NQK A;  2BBR A;  2LWD A;  1ICH A;  2P1H A;  4RHW A;  3LQR A;  4F42 A;  4F44 A;  4FH0 A;  4M9Z A;  4O9F A;  2YU0 A;  4A2Q A;  3KAT A;  3EZQ B;  1Z6T A;  2M5V A;  4EWI A;  4ZBW A;  3CL3 A;  2F1S A;  2NSN A;  2L9M A;  4O6X A;  4M9S A;  4N1L A;  1UCP A;  3MOP K;  2G7R A;  2DBF A;  2N7Z A;  2YQF A;  2YVI A;  1C15 A;  2MS8 A;  4JQW A;  2LWE A;  2O71 A;  2DO9 A;  2VGQ A;  2BBZ A;  2B1W A;  4O9L A;  4A2W A;  2L6A A;  3YGS C;  4N1J A;  3QF2 A;  1WMG A;  1DGN A;  1WXP A;  2NZ7 A; 
#chains in the Genus database with same CATH topology
 2N83 A;  1FAD A;  4M9X A;  2HM2 Q;  2N1F A;  2D96 A;  2MS7 A;  3T6P A;  2N00 A;  1NGR A;  4DWN A;  1A1W A;  2OF5 A;  4IZA B;  2YGS A;  3EZQ A;  2OF5 H;  1YGO A;  4N1K A;  4P4H A;  2MPC A;  2MN4 A;  2IB1 A;  2DBD A;  2MB9 A;  4P4H I;  3LQQ A;  2A9I A;  1WH4 A;  4D8O A;  2KN6 A;  3CRD A;  3YGS P;  4JUP A;  2N80 A;  1A1Z A;  2GF5 A;  4LWD A;  1DDF A;  1D2Z A;  1N3K A;  4RHW E;  1D2Z B;  3J63 A;  1CWW A;  2N97 A;  4O7Q A;  1E41 A;  3J6J A;  2KM6 A;  2XV9 A;  1CY5 A;  4IZ5 E;  4I16 A;  3MOP A;  2NAQ A;  4QOB A;  2LS7 A;  1E3Y A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2A5Y B;  4E9M A;  2DBG A;  3MOP G;  2DBH A;  4NQK A;  2BBR A;  2LWD A;  1ICH A;  2P1H A;  4RHW A;  3LQR A;  4F42 A;  4F44 A;  4FH0 A;  4M9Z A;  4O9F A;  2YU0 A;  4A2Q A;  3KAT A;  3EZQ B;  1Z6T A;  2M5V A;  4EWI A;  4ZBW A;  3CL3 A;  2F1S A;  2NSN A;  2L9M A;  4O6X A;  4M9S A;  4N1L A;  1UCP A;  3MOP K;  2G7R A;  2DBF A;  2N7Z A;  2YQF A;  2YVI A;  1C15 A;  2MS8 A;  4JQW A;  2LWE A;  2O71 A;  2DO9 A;  2VGQ A;  2BBZ A;  2B1W A;  4O9L A;  4A2W A;  2L6A A;  3YGS C;  4N1J A;  3QF2 A;  1WMG A;  1DGN A;  1WXP A;  2NZ7 A;  2MJM A; 
#chains in the Genus database with same CATH homology
 2N83 A;  1FAD A;  4M9X A;  2HM2 Q;  2N1F A;  2D96 A;  2MS7 A;  3T6P A;  2N00 A;  1NGR A;  4DWN A;  1A1W A;  2OF5 A;  4IZA B;  2YGS A;  3EZQ A;  2OF5 H;  1YGO A;  4N1K A;  4P4H A;  2MPC A;  2MN4 A;  2IB1 A;  2DBD A;  2MB9 A;  4P4H I;  3LQQ A;  2A9I A;  1WH4 A;  4D8O A;  2KN6 A;  3CRD A;  3YGS P;  4JUP A;  2N80 A;  1A1Z A;  2GF5 A;  4LWD A;  1DDF A;  1D2Z A;  1N3K A;  4RHW E;  1D2Z B;  3J63 A;  1CWW A;  2N97 A;  4O7Q A;  1E41 A;  3J6J A;  2KM6 A;  2XV9 A;  1CY5 A;  4IZ5 E;  4I16 A;  3MOP A;  2NAQ A;  4QOB A;  2LS7 A;  1E3Y A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2A5Y B;  4E9M A;  2DBG A;  3MOP G;  2DBH A;  4NQK A;  2BBR A;  2LWD A;  1ICH A;  2P1H A;  4RHW A;  3LQR A;  4F42 A;  4F44 A;  4FH0 A;  4M9Z A;  4O9F A;  2YU0 A;  4A2Q A;  3KAT A;  3EZQ B;  1Z6T A;  2M5V A;  4EWI A;  4ZBW A;  3CL3 A;  2F1S A;  2NSN A;  2L9M A;  4O6X A;  4M9S A;  4N1L A;  1UCP A;  3MOP K;  2G7R A;  2DBF A;  2N7Z A;  2YQF A;  2YVI A;  1C15 A;  2MS8 A;  4JQW A;  2LWE A;  2O71 A;  2DO9 A;  2VGQ A;  2BBZ A;  2B1W A;  4O9L A;  4A2W A;  2L6A A;  3YGS C;  4N1J A;  3QF2 A;  1WMG A;  1DGN A;  1WXP A;  2NZ7 A;  2MJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...