2MPCA

Solution structure of the pyrin domain of human pyrin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
90
structure length
90
Chain Sequence
TPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Multifaceted Binding Modes for Pyrin and ASC Pyrin Domains gives Insights into Pyrin Inflammasome Assembly
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pyrin
total genus 27
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mpcA00
1YGOA 2P1HA 2F1SA 4N1JA 4O7QA 4IZ5E 1WH4A 2BBZA 2YVIA 2NAQA 3KATA 4DWNA 2DBFA 4O9FA 1E41A 2VGQA 2MPCA 1WMGA 4I16A 1CY5A 3EZQA 2DBDA 2HM2Q 3QF2A 2A5YB 2MB9A 4RHWE 3YGSP 4JQWA 4FH0A 2DBHA 4M9XA 2B1WA 2L6AA 4A2WA 4M9SA 1WXPA 4M9ZA 4E9MA 4NQKA 2N00A 2YQFA 2LWDA 2MS7A 1DGNA 3MOPG 2L9MA 1C15A 1DDFA 1A1WA 2O71A 2A9IA 2NSNA 2GF5A 4O6XA 3YGSC 4JUPA 2NZ7A 4IZAB 2LWEA 4A2QA 4ZBWA 4QOBA 1UCPA 3CRDA 1D2ZA 3MOPA 2KN6A 2OF5H 4EWIA 1ICHA 2YU0A 1CWWA 2MS8A 4RHWA 3LQQA 1A1ZA 2N97A 4IZ7B 4P4HI 2DBGA 2N7ZA 3CL3A 2DO9A 1E3YA 2IB1A 1NGRA 4P4HA 4UZ0A 4D8OA 4F44A 2OF5A 4LWDA 2MN4A 2M5VA 4O9LA 4F42A 3T6PA 4N1KA 1N3KA 2D96A 2N1FA 3LQRA 1D2ZB 2LS7A 1FADA 2KM6A 2G7RA 2YGSA 2N83A 2BBRA 1PN5A 3EZQB 3MOPK 4N1LA 3J6JA 1Z6TA 3J63A 2N80A
chains in the Genus database with same CATH superfamily
1YGOA 2P1HA 2F1SA 4N1JA 4O7QA 4IZ5E 1WH4A 2BBZA 2YVIA 2NAQA 3KATA 4DWNA 2DBFA 4O9FA 1E41A 2VGQA 2MPCA 1WMGA 4I16A 1CY5A 3EZQA 2DBDA 2HM2Q 3QF2A 2A5YB 2MB9A 4RHWE 3YGSP 4JQWA 4FH0A 2DBHA 2XV9A 4M9XA 2B1WA 2L6AA 4A2WA 4M9SA 1WXPA 4M9ZA 4E9MA 4NQKA 2N00A 2YQFA 2LWDA 2MS7A 1DGNA 3MOPG 2L9MA 1C15A 1DDFA 1A1WA 2O71A 2A9IA 2NSNA 2GF5A 4O6XA 3YGSC 4JUPA 2NZ7A 4IZAB 2LWEA 4A2QA 4ZBWA 4QOBA 1UCPA 3CRDA 1D2ZA 3MOPA 2KN6A 2OF5H 4EWIA 1ICHA 2YU0A 1CWWA 2MS8A 4RHWA 3LQQA 1A1ZA 2N97A 4IZ7B 4P4HI 2DBGA 2N7ZA 3CL3A 2DO9A 2MJMA 1E3YA 2IB1A 1NGRA 4P4HA 4UZ0A 4D8OA 4F44A 2OF5A 4LWDA 2MN4A 2M5VA 4O9LA 4F42A 3T6PA 4N1KA 1N3KA 2D96A 2N1FA 3LQRA 1D2ZB 2LS7A 1FADA 2KM6A 2G7RA 2YGSA 2N83A 2BBRA 1PN5A 3EZQB 3MOPK 4N1LA 3J6JA 1Z6TA 3J63A 2N80A
chains in the Genus database with same CATH topology
1YGOA 2P1HA 2F1SA 4N1JA 4O7QA 4IZ5E 1WH4A 2BBZA 2YVIA 2NAQA 3KATA 4DWNA 2DBFA 4O9FA 1E41A 2VGQA 2MPCA 1WMGA 4I16A 1CY5A 3EZQA 2DBDA 2HM2Q 3QF2A 2A5YB 2MB9A 4RHWE 3YGSP 4JQWA 4FH0A 2DBHA 2XV9A 4M9XA 2B1WA 2L6AA 4A2WA 4M9SA 1WXPA 4M9ZA 4E9MA 4NQKA 2N00A 2YQFA 2LWDA 2MS7A 1DGNA 3MOPG 2L9MA 1C15A 1DDFA 1A1WA 2O71A 2A9IA 2NSNA 2GF5A 4O6XA 3YGSC 4JUPA 2NZ7A 4IZAB 2LWEA 4A2QA 4ZBWA 4QOBA 1UCPA 3CRDA 1D2ZA 3MOPA 2KN6A 2OF5H 4EWIA 1ICHA 2YU0A 1CWWA 2MS8A 4RHWA 3LQQA 1A1ZA 2N97A 4IZ7B 4P4HI 2DBGA 2N7ZA 3CL3A 2DO9A 2MJMA 1E3YA 2IB1A 1NGRA 4P4HA 4UZ0A 4D8OA 4F44A 2OF5A 4LWDA 2MN4A 2M5VA 4O9LA 4F42A 3T6PA 4N1KA 1N3KA 2D96A 2N1FA 3LQRA 1D2ZB 2LS7A 1FADA 2KM6A 2G7RA 2YGSA 2N83A 2BBRA 1PN5A 3EZQB 3MOPK 4N1LA 3J6JA 1Z6TA 3J63A 2N80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGO A;  2P1H A;  2F1S A;  4N1J A;  4O7Q A;  4IZ5 E;  1WH4 A;  2BBZ A;  2YVI A;  2NAQ A;  3KAT A;  4DWN A;  2DBF A;  4O9F A;  1E41 A;  2VGQ A;  2MPC A;  1WMG A;  4I16 A;  1CY5 A;  3EZQ A;  2DBD A;  2HM2 Q;  3QF2 A;  2A5Y B;  2MB9 A;  4RHW E;  3YGS P;  4JQW A;  4FH0 A;  2DBH A;  4M9X A;  2B1W A;  2L6A A;  4A2W A;  4M9S A;  1WXP A;  4M9Z A;  4E9M A;  4NQK A;  2N00 A;  2YQF A;  2LWD A;  2MS7 A;  1DGN A;  3MOP G;  2L9M A;  1C15 A;  1DDF A;  1A1W A;  2O71 A;  2A9I A;  2NSN A;  2GF5 A;  4O6X A;  3YGS C;  4JUP A;  2NZ7 A;  4IZA B;  2LWE A;  4A2Q A;  4ZBW A;  4QOB A;  1UCP A;  3CRD A;  1D2Z A;  3MOP A;  2KN6 A;  2OF5 H;  4EWI A;  1ICH A;  2YU0 A;  1CWW A;  2MS8 A;  4RHW A;  3LQQ A;  1A1Z A;  2N97 A;  4IZ7 B;  4P4H I;  2DBG A;  2N7Z A;  3CL3 A;  2DO9 A;  1E3Y A;  2IB1 A;  1NGR A;  4P4H A;  4UZ0 A;  4D8O A;  4F44 A;  2OF5 A;  4LWD A;  2MN4 A;  2M5V A;  4O9L A;  4F42 A;  3T6P A;  4N1K A;  1N3K A;  2D96 A;  2N1F A;  3LQR A;  1D2Z B;  2LS7 A;  1FAD A;  2KM6 A;  2G7R A;  2YGS A;  2N83 A;  2BBR A;  1PN5 A;  3EZQ B;  3MOP K;  4N1L A;  3J6J A;  1Z6T A;  3J63 A;  2N80 A; 
#chains in the Genus database with same CATH topology
 1YGO A;  2P1H A;  2F1S A;  4N1J A;  4O7Q A;  4IZ5 E;  1WH4 A;  2BBZ A;  2YVI A;  2NAQ A;  3KAT A;  4DWN A;  2DBF A;  4O9F A;  1E41 A;  2VGQ A;  2MPC A;  1WMG A;  4I16 A;  1CY5 A;  3EZQ A;  2DBD A;  2HM2 Q;  3QF2 A;  2A5Y B;  2MB9 A;  4RHW E;  3YGS P;  4JQW A;  4FH0 A;  2DBH A;  2XV9 A;  4M9X A;  2B1W A;  2L6A A;  4A2W A;  4M9S A;  1WXP A;  4M9Z A;  4E9M A;  4NQK A;  2N00 A;  2YQF A;  2LWD A;  2MS7 A;  1DGN A;  3MOP G;  2L9M A;  1C15 A;  1DDF A;  1A1W A;  2O71 A;  2A9I A;  2NSN A;  2GF5 A;  4O6X A;  3YGS C;  4JUP A;  2NZ7 A;  4IZA B;  2LWE A;  4A2Q A;  4ZBW A;  4QOB A;  1UCP A;  3CRD A;  1D2Z A;  3MOP A;  2KN6 A;  2OF5 H;  4EWI A;  1ICH A;  2YU0 A;  1CWW A;  2MS8 A;  4RHW A;  3LQQ A;  1A1Z A;  2N97 A;  4IZ7 B;  4P4H I;  2DBG A;  2N7Z A;  3CL3 A;  2DO9 A;  2MJM A;  1E3Y A;  2IB1 A;  1NGR A;  4P4H A;  4UZ0 A;  4D8O A;  4F44 A;  2OF5 A;  4LWD A;  2MN4 A;  2M5V A;  4O9L A;  4F42 A;  3T6P A;  4N1K A;  1N3K A;  2D96 A;  2N1F A;  3LQR A;  1D2Z B;  2LS7 A;  1FAD A;  2KM6 A;  2G7R A;  2YGS A;  2N83 A;  2BBR A;  1PN5 A;  3EZQ B;  3MOP K;  4N1L A;  3J6J A;  1Z6T A;  3J63 A;  2N80 A; 
#chains in the Genus database with same CATH homology
 1YGO A;  2P1H A;  2F1S A;  4N1J A;  4O7Q A;  4IZ5 E;  1WH4 A;  2BBZ A;  2YVI A;  2NAQ A;  3KAT A;  4DWN A;  2DBF A;  4O9F A;  1E41 A;  2VGQ A;  2MPC A;  1WMG A;  4I16 A;  1CY5 A;  3EZQ A;  2DBD A;  2HM2 Q;  3QF2 A;  2A5Y B;  2MB9 A;  4RHW E;  3YGS P;  4JQW A;  4FH0 A;  2DBH A;  2XV9 A;  4M9X A;  2B1W A;  2L6A A;  4A2W A;  4M9S A;  1WXP A;  4M9Z A;  4E9M A;  4NQK A;  2N00 A;  2YQF A;  2LWD A;  2MS7 A;  1DGN A;  3MOP G;  2L9M A;  1C15 A;  1DDF A;  1A1W A;  2O71 A;  2A9I A;  2NSN A;  2GF5 A;  4O6X A;  3YGS C;  4JUP A;  2NZ7 A;  4IZA B;  2LWE A;  4A2Q A;  4ZBW A;  4QOB A;  1UCP A;  3CRD A;  1D2Z A;  3MOP A;  2KN6 A;  2OF5 H;  4EWI A;  1ICH A;  2YU0 A;  1CWW A;  2MS8 A;  4RHW A;  3LQQ A;  1A1Z A;  2N97 A;  4IZ7 B;  4P4H I;  2DBG A;  2N7Z A;  3CL3 A;  2DO9 A;  2MJM A;  1E3Y A;  2IB1 A;  1NGR A;  4P4H A;  4UZ0 A;  4D8O A;  4F44 A;  2OF5 A;  4LWD A;  2MN4 A;  2M5V A;  4O9L A;  4F42 A;  3T6P A;  4N1K A;  1N3K A;  2D96 A;  2N1F A;  3LQR A;  1D2Z B;  2LS7 A;  1FAD A;  2KM6 A;  2G7R A;  2YGS A;  2N83 A;  2BBR A;  1PN5 A;  3EZQ B;  3MOP K;  4N1L A;  3J6J A;  1Z6T A;  3J63 A;  2N80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...