4N1LA

Crystal structures of nlrp14 pyrin domain reveal a conformational switch mechanism, regulating its molecular interactions
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
SSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWNEVKKARREDLANLMKKYYPGEKAWSVSLKIFGKMNRKDLCERAKEEINWSAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the NLRP14 pyrin domain reveal a conformational switch mechanism regulating its molecular interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords NACHT, LRR and PYD domains-containing protein 14
total genus 37
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4n1lA00
2LWDA 1CWWA 4A2WA 3LQQA 2VGQA 2GF5A 4IZ5E 3CL3A 1A1ZA 2N00A 4ZBWA 2MS7A 1D2ZB 3EZQA 4M9SA 2BBRA 2DO9A 1N3KA 4LWDA 4O6XA 1CY5A 2KN6A 2M5VA 2N1FA 3KATA 2NZ7A 2P1HA 4DWNA 2YQFA 4F44A 2NSNA 2OF5A 3MOPA 2LWEA 1ICHA 2NAQA 3LQRA 4EWIA 4FH0A 2DBGA 2D96A 1Z6TA 1D2ZA 1A1WA 2A9IA 2DBFA 3MOPK 3J63A 2N97A 3YGSC 4E9MA 4UZ0A 2YU0A 4JUPA 2MB9A 2MPCA 1NGRA 4O9LA 4O9FA 4IZ7B 4N1LA 1UCPA 2HM2Q 3QF2A 4QOBA 4N1JA 2O71A 1FADA 2N80A 3J6JA 4JQWA 4M9XA 4F42A 4I16A 3CRDA 4O7QA 2L9MA 2MS8A 2F1SA 3YGSP 1E41A 1C15A 1DGNA 1DDFA 2G7RA 1WH4A 1WXPA 4P4HI 2L6AA 2YGSA 2MN4A 2YVIA 2N7ZA 2DBHA 2A5YB 3T6PA 1YGOA 2B1WA 2DBDA 3EZQB 4IZAB 4N1KA 4A2QA 2KM6A 3MOPG 2N83A 4P4HA 2LS7A 4NQKA 1PN5A 1WMGA 2BBZA 2OF5H 4M9ZA 1E3YA 4RHWA 4RHWE 2IB1A 4D8OA
chains in the Genus database with same CATH superfamily
2LWDA 1CWWA 4A2WA 3LQQA 2VGQA 2GF5A 4IZ5E 3CL3A 1A1ZA 2N00A 4ZBWA 2MS7A 1D2ZB 3EZQA 4M9SA 2BBRA 2DO9A 1N3KA 4LWDA 4O6XA 1CY5A 2KN6A 2M5VA 2N1FA 3KATA 2NZ7A 2P1HA 4DWNA 2YQFA 4F44A 2NSNA 2OF5A 3MOPA 2LWEA 1ICHA 2NAQA 3LQRA 4EWIA 4FH0A 2DBGA 2D96A 1Z6TA 1D2ZA 1A1WA 2A9IA 2DBFA 3MOPK 3J63A 2N97A 3YGSC 4E9MA 4UZ0A 2YU0A 4JUPA 2MB9A 2MPCA 1NGRA 4O9LA 4O9FA 4IZ7B 4N1LA 1UCPA 2XV9A 2HM2Q 3QF2A 4QOBA 4N1JA 2O71A 1FADA 2N80A 3J6JA 4JQWA 4M9XA 4F42A 4I16A 3CRDA 4O7QA 2L9MA 2MS8A 2MJMA 2F1SA 3YGSP 1E41A 1C15A 1DGNA 1DDFA 2G7RA 1WH4A 1WXPA 4P4HI 2L6AA 2YGSA 2MN4A 2YVIA 2N7ZA 2DBHA 2A5YB 3T6PA 1YGOA 2B1WA 2DBDA 3EZQB 4IZAB 4N1KA 4A2QA 2KM6A 3MOPG 2N83A 4P4HA 2LS7A 4NQKA 1PN5A 1WMGA 2BBZA 2OF5H 4M9ZA 1E3YA 4RHWA 4RHWE 2IB1A 4D8OA
chains in the Genus database with same CATH topology
2LWDA 1CWWA 4A2WA 3LQQA 2VGQA 2GF5A 4IZ5E 3CL3A 1A1ZA 2N00A 4ZBWA 2MS7A 1D2ZB 3EZQA 4M9SA 2BBRA 2DO9A 1N3KA 4LWDA 4O6XA 1CY5A 2KN6A 2M5VA 2N1FA 3KATA 2NZ7A 2P1HA 4DWNA 2YQFA 4F44A 2NSNA 2OF5A 3MOPA 2LWEA 1ICHA 2NAQA 3LQRA 4EWIA 4FH0A 2DBGA 2D96A 1Z6TA 1D2ZA 1A1WA 2A9IA 2DBFA 3MOPK 3J63A 2N97A 3YGSC 4E9MA 4UZ0A 2YU0A 4JUPA 2MB9A 2MPCA 1NGRA 4O9LA 4O9FA 4IZ7B 4N1LA 1UCPA 2XV9A 2HM2Q 3QF2A 4QOBA 4N1JA 2O71A 1FADA 2N80A 3J6JA 4JQWA 4M9XA 4F42A 4I16A 3CRDA 4O7QA 2L9MA 2MS8A 2MJMA 2F1SA 3YGSP 1E41A 1C15A 1DGNA 1DDFA 2G7RA 1WH4A 1WXPA 4P4HI 2L6AA 2YGSA 2MN4A 2YVIA 2N7ZA 2DBHA 2A5YB 3T6PA 1YGOA 2B1WA 2DBDA 3EZQB 4IZAB 4N1KA 4A2QA 2KM6A 3MOPG 2N83A 4P4HA 2LS7A 4NQKA 1PN5A 1WMGA 2BBZA 2OF5H 4M9ZA 1E3YA 4RHWA 4RHWE 2IB1A 4D8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWD A;  1CWW A;  4A2W A;  3LQQ A;  2VGQ A;  2GF5 A;  4IZ5 E;  3CL3 A;  1A1Z A;  2N00 A;  4ZBW A;  2MS7 A;  1D2Z B;  3EZQ A;  4M9S A;  2BBR A;  2DO9 A;  1N3K A;  4LWD A;  4O6X A;  1CY5 A;  2KN6 A;  2M5V A;  2N1F A;  3KAT A;  2NZ7 A;  2P1H A;  4DWN A;  2YQF A;  4F44 A;  2NSN A;  2OF5 A;  3MOP A;  2LWE A;  1ICH A;  2NAQ A;  3LQR A;  4EWI A;  4FH0 A;  2DBG A;  2D96 A;  1Z6T A;  1D2Z A;  1A1W A;  2A9I A;  2DBF A;  3MOP K;  3J63 A;  2N97 A;  3YGS C;  4E9M A;  4UZ0 A;  2YU0 A;  4JUP A;  2MB9 A;  2MPC A;  1NGR A;  4O9L A;  4O9F A;  4IZ7 B;  4N1L A;  1UCP A;  2HM2 Q;  3QF2 A;  4QOB A;  4N1J A;  2O71 A;  1FAD A;  2N80 A;  3J6J A;  4JQW A;  4M9X A;  4F42 A;  4I16 A;  3CRD A;  4O7Q A;  2L9M A;  2MS8 A;  2F1S A;  3YGS P;  1E41 A;  1C15 A;  1DGN A;  1DDF A;  2G7R A;  1WH4 A;  1WXP A;  4P4H I;  2L6A A;  2YGS A;  2MN4 A;  2YVI A;  2N7Z A;  2DBH A;  2A5Y B;  3T6P A;  1YGO A;  2B1W A;  2DBD A;  3EZQ B;  4IZA B;  4N1K A;  4A2Q A;  2KM6 A;  3MOP G;  2N83 A;  4P4H A;  2LS7 A;  4NQK A;  1PN5 A;  1WMG A;  2BBZ A;  2OF5 H;  4M9Z A;  1E3Y A;  4RHW A;  4RHW E;  2IB1 A;  4D8O A; 
#chains in the Genus database with same CATH topology
 2LWD A;  1CWW A;  4A2W A;  3LQQ A;  2VGQ A;  2GF5 A;  4IZ5 E;  3CL3 A;  1A1Z A;  2N00 A;  4ZBW A;  2MS7 A;  1D2Z B;  3EZQ A;  4M9S A;  2BBR A;  2DO9 A;  1N3K A;  4LWD A;  4O6X A;  1CY5 A;  2KN6 A;  2M5V A;  2N1F A;  3KAT A;  2NZ7 A;  2P1H A;  4DWN A;  2YQF A;  4F44 A;  2NSN A;  2OF5 A;  3MOP A;  2LWE A;  1ICH A;  2NAQ A;  3LQR A;  4EWI A;  4FH0 A;  2DBG A;  2D96 A;  1Z6T A;  1D2Z A;  1A1W A;  2A9I A;  2DBF A;  3MOP K;  3J63 A;  2N97 A;  3YGS C;  4E9M A;  4UZ0 A;  2YU0 A;  4JUP A;  2MB9 A;  2MPC A;  1NGR A;  4O9L A;  4O9F A;  4IZ7 B;  4N1L A;  1UCP A;  2XV9 A;  2HM2 Q;  3QF2 A;  4QOB A;  4N1J A;  2O71 A;  1FAD A;  2N80 A;  3J6J A;  4JQW A;  4M9X A;  4F42 A;  4I16 A;  3CRD A;  4O7Q A;  2L9M A;  2MS8 A;  2MJM A;  2F1S A;  3YGS P;  1E41 A;  1C15 A;  1DGN A;  1DDF A;  2G7R A;  1WH4 A;  1WXP A;  4P4H I;  2L6A A;  2YGS A;  2MN4 A;  2YVI A;  2N7Z A;  2DBH A;  2A5Y B;  3T6P A;  1YGO A;  2B1W A;  2DBD A;  3EZQ B;  4IZA B;  4N1K A;  4A2Q A;  2KM6 A;  3MOP G;  2N83 A;  4P4H A;  2LS7 A;  4NQK A;  1PN5 A;  1WMG A;  2BBZ A;  2OF5 H;  4M9Z A;  1E3Y A;  4RHW A;  4RHW E;  2IB1 A;  4D8O A; 
#chains in the Genus database with same CATH homology
 2LWD A;  1CWW A;  4A2W A;  3LQQ A;  2VGQ A;  2GF5 A;  4IZ5 E;  3CL3 A;  1A1Z A;  2N00 A;  4ZBW A;  2MS7 A;  1D2Z B;  3EZQ A;  4M9S A;  2BBR A;  2DO9 A;  1N3K A;  4LWD A;  4O6X A;  1CY5 A;  2KN6 A;  2M5V A;  2N1F A;  3KAT A;  2NZ7 A;  2P1H A;  4DWN A;  2YQF A;  4F44 A;  2NSN A;  2OF5 A;  3MOP A;  2LWE A;  1ICH A;  2NAQ A;  3LQR A;  4EWI A;  4FH0 A;  2DBG A;  2D96 A;  1Z6T A;  1D2Z A;  1A1W A;  2A9I A;  2DBF A;  3MOP K;  3J63 A;  2N97 A;  3YGS C;  4E9M A;  4UZ0 A;  2YU0 A;  4JUP A;  2MB9 A;  2MPC A;  1NGR A;  4O9L A;  4O9F A;  4IZ7 B;  4N1L A;  1UCP A;  2XV9 A;  2HM2 Q;  3QF2 A;  4QOB A;  4N1J A;  2O71 A;  1FAD A;  2N80 A;  3J6J A;  4JQW A;  4M9X A;  4F42 A;  4I16 A;  3CRD A;  4O7Q A;  2L9M A;  2MS8 A;  2MJM A;  2F1S A;  3YGS P;  1E41 A;  1C15 A;  1DGN A;  1DDF A;  2G7R A;  1WH4 A;  1WXP A;  4P4H I;  2L6A A;  2YGS A;  2MN4 A;  2YVI A;  2N7Z A;  2DBH A;  2A5Y B;  3T6P A;  1YGO A;  2B1W A;  2DBD A;  3EZQ B;  4IZA B;  4N1K A;  4A2Q A;  2KM6 A;  3MOP G;  2N83 A;  4P4H A;  2LS7 A;  4NQK A;  1PN5 A;  1WMG A;  2BBZ A;  2OF5 H;  4M9Z A;  1E3Y A;  4RHW A;  4RHW E;  2IB1 A;  4D8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...