4ZBWA

Crystal structure of death effector domain of caspase8 in homo sapiens
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
183
structure length
183
Chain Sequence
DFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKALLQEEDSKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the death effector domains of caspase-8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-8
total genus 66
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2015-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4zbwA01
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4zbwA02
4O9FA 4I16A 3CRDA 1UCPA 4A2WA 2DO9A 2NZ7A 2YGSA 4IZAB 3EZQA 4UZ0A 2OF5A 4P4HA 2A5YB 1Z6TA 2IB1A 2LS7A 1FADA 4N1KA 1C15A 4RHWA 1CWWA 1ICHA 1NGRA 4EWIA 2N80A 4F42A 2L6AA 4LWDA 2B1WA 2GF5A 2MB9A 4FH0A 3EZQB 3MOPG 3QF2A 1N3KA 4F44A 2N7ZA 4DWNA 3KATA 4A2QA 4JQWA 2D96A 1D2ZB 1D2ZA 4P4HI 2BBZA 2DBDA 1PN5A 2LWDA 3YGSC 3J63A 1E3YA 3T6PA 4N1LA 2DBHA 1WMGA 2L9MA 2O71A 2MS7A 3MOPK 1WH4A 2F1SA 2MN4A 4O6XA 4O9LA 4IZ5E 1YGOA 2N1FA 4NQKA 1DDFA 2YVIA 2N97A 1WXPA 2KM6A 1E41A 2A9IA 4O7QA 3YGSP 2M5VA 2YU0A 2HM2Q 2BBRA 2G7RA 2NAQA 4RHWE 2MPCA 2VGQA 3J6JA 4JUPA 4E9MA 2P1HA 2N00A 4QOBA 1DGNA 1A1WA 1A1ZA 4D8OA 2MS8A 2LWEA 2KN6A 4N1JA 4M9ZA 4ZBWA 3MOPA 4M9SA 2NSNA 2OF5H 2DBFA 2YQFA 2N83A 4IZ7B 2DBGA 3CL3A 3LQRA 1CY5A 3LQQA 4M9XA
chains in the Genus database with same CATH superfamily
4O9FA 4I16A 3CRDA 1UCPA 4A2WA 2DO9A 2NZ7A 2YGSA 4IZAB 3EZQA 4UZ0A 2OF5A 4P4HA 2A5YB 1Z6TA 2IB1A 2LS7A 1FADA 4N1KA 1C15A 4RHWA 1CWWA 1ICHA 1NGRA 4EWIA 2N80A 4F42A 2L6AA 4LWDA 2B1WA 2GF5A 2MB9A 2MJMA 4FH0A 3EZQB 3MOPG 3QF2A 1N3KA 4F44A 2N7ZA 4DWNA 3KATA 4A2QA 4JQWA 2D96A 1D2ZB 1D2ZA 4P4HI 2BBZA 2DBDA 1PN5A 2LWDA 3YGSC 3J63A 1E3YA 3T6PA 4N1LA 2DBHA 1WMGA 2L9MA 2O71A 2MS7A 3MOPK 1WH4A 2F1SA 2MN4A 4O6XA 4O9LA 4IZ5E 1YGOA 2N1FA 4NQKA 1DDFA 2YVIA 2N97A 1WXPA 2KM6A 1E41A 2A9IA 4O7QA 3YGSP 2M5VA 2YU0A 2HM2Q 2BBRA 2G7RA 2NAQA 4RHWE 2MPCA 2VGQA 3J6JA 4JUPA 4E9MA 2P1HA 2N00A 4QOBA 1DGNA 1A1WA 1A1ZA 4D8OA 2MS8A 2LWEA 2KN6A 4N1JA 4M9ZA 4ZBWA 3MOPA 4M9SA 2NSNA 2OF5H 2DBFA 2YQFA 2N83A 4IZ7B 2DBGA 2XV9A 3CL3A 3LQRA 1CY5A 3LQQA 4M9XA
chains in the Genus database with same CATH topology
4O9FA 4I16A 3CRDA 1UCPA 4A2WA 2DO9A 2NZ7A 2YGSA 4IZAB 3EZQA 4UZ0A 2OF5A 4P4HA 2A5YB 1Z6TA 2IB1A 2LS7A 1FADA 4N1KA 1C15A 4RHWA 1CWWA 1ICHA 1NGRA 4EWIA 2N80A 4F42A 2L6AA 4LWDA 2B1WA 2GF5A 2MB9A 2MJMA 4FH0A 3EZQB 3MOPG 3QF2A 1N3KA 4F44A 2N7ZA 4DWNA 3KATA 4A2QA 4JQWA 2D96A 1D2ZB 1D2ZA 4P4HI 2BBZA 2DBDA 1PN5A 2LWDA 3YGSC 3J63A 1E3YA 3T6PA 4N1LA 2DBHA 1WMGA 2L9MA 2O71A 2MS7A 3MOPK 1WH4A 2F1SA 2MN4A 4O6XA 4O9LA 4IZ5E 1YGOA 2N1FA 4NQKA 1DDFA 2YVIA 2N97A 1WXPA 2KM6A 1E41A 2A9IA 4O7QA 3YGSP 2M5VA 2YU0A 2HM2Q 2BBRA 2G7RA 2NAQA 4RHWE 2MPCA 2VGQA 3J6JA 4JUPA 4E9MA 2P1HA 2N00A 4QOBA 1DGNA 1A1WA 1A1ZA 4D8OA 2MS8A 2LWEA 2KN6A 4N1JA 4M9ZA 4ZBWA 3MOPA 4M9SA 2NSNA 2OF5H 2DBFA 2YQFA 2N83A 4IZ7B 2DBGA 2XV9A 3CL3A 3LQRA 1CY5A 3LQQA 4M9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O9F A;  4I16 A;  3CRD A;  1UCP A;  4A2W A;  2DO9 A;  2NZ7 A;  2YGS A;  4IZA B;  3EZQ A;  4UZ0 A;  2OF5 A;  4P4H A;  2A5Y B;  1Z6T A;  2IB1 A;  2LS7 A;  1FAD A;  4N1K A;  1C15 A;  4RHW A;  1CWW A;  1ICH A;  1NGR A;  4EWI A;  2N80 A;  4F42 A;  2L6A A;  4LWD A;  2B1W A;  2GF5 A;  2MB9 A;  4FH0 A;  3EZQ B;  3MOP G;  3QF2 A;  1N3K A;  4F44 A;  2N7Z A;  4DWN A;  3KAT A;  4A2Q A;  4JQW A;  2D96 A;  1D2Z B;  1D2Z A;  4P4H I;  2BBZ A;  2DBD A;  1PN5 A;  2LWD A;  3YGS C;  3J63 A;  1E3Y A;  3T6P A;  4N1L A;  2DBH A;  1WMG A;  2L9M A;  2O71 A;  2MS7 A;  3MOP K;  1WH4 A;  2F1S A;  2MN4 A;  4O6X A;  4O9L A;  4IZ5 E;  1YGO A;  2N1F A;  4NQK A;  1DDF A;  2YVI A;  2N97 A;  1WXP A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  3YGS P;  2M5V A;  2YU0 A;  2HM2 Q;  2BBR A;  2G7R A;  2NAQ A;  4RHW E;  2MPC A;  2VGQ A;  3J6J A;  4JUP A;  4E9M A;  2P1H A;  2N00 A;  4QOB A;  1DGN A;  1A1W A;  1A1Z A;  4D8O A;  2MS8 A;  2LWE A;  2KN6 A;  4N1J A;  4M9Z A;  4ZBW A;  3MOP A;  4M9S A;  2NSN A;  2OF5 H;  2DBF A;  2YQF A;  2N83 A;  4IZ7 B;  2DBG A;  3CL3 A;  3LQR A;  1CY5 A;  3LQQ A;  4M9X A; 
#chains in the Genus database with same CATH topology
 4O9F A;  4I16 A;  3CRD A;  1UCP A;  4A2W A;  2DO9 A;  2NZ7 A;  2YGS A;  4IZA B;  3EZQ A;  4UZ0 A;  2OF5 A;  4P4H A;  2A5Y B;  1Z6T A;  2IB1 A;  2LS7 A;  1FAD A;  4N1K A;  1C15 A;  4RHW A;  1CWW A;  1ICH A;  1NGR A;  4EWI A;  2N80 A;  4F42 A;  2L6A A;  4LWD A;  2B1W A;  2GF5 A;  2MB9 A;  2MJM A;  4FH0 A;  3EZQ B;  3MOP G;  3QF2 A;  1N3K A;  4F44 A;  2N7Z A;  4DWN A;  3KAT A;  4A2Q A;  4JQW A;  2D96 A;  1D2Z B;  1D2Z A;  4P4H I;  2BBZ A;  2DBD A;  1PN5 A;  2LWD A;  3YGS C;  3J63 A;  1E3Y A;  3T6P A;  4N1L A;  2DBH A;  1WMG A;  2L9M A;  2O71 A;  2MS7 A;  3MOP K;  1WH4 A;  2F1S A;  2MN4 A;  4O6X A;  4O9L A;  4IZ5 E;  1YGO A;  2N1F A;  4NQK A;  1DDF A;  2YVI A;  2N97 A;  1WXP A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  3YGS P;  2M5V A;  2YU0 A;  2HM2 Q;  2BBR A;  2G7R A;  2NAQ A;  4RHW E;  2MPC A;  2VGQ A;  3J6J A;  4JUP A;  4E9M A;  2P1H A;  2N00 A;  4QOB A;  1DGN A;  1A1W A;  1A1Z A;  4D8O A;  2MS8 A;  2LWE A;  2KN6 A;  4N1J A;  4M9Z A;  4ZBW A;  3MOP A;  4M9S A;  2NSN A;  2OF5 H;  2DBF A;  2YQF A;  2N83 A;  4IZ7 B;  2DBG A;  2XV9 A;  3CL3 A;  3LQR A;  1CY5 A;  3LQQ A;  4M9X A; 
#chains in the Genus database with same CATH homology
 4O9F A;  4I16 A;  3CRD A;  1UCP A;  4A2W A;  2DO9 A;  2NZ7 A;  2YGS A;  4IZA B;  3EZQ A;  4UZ0 A;  2OF5 A;  4P4H A;  2A5Y B;  1Z6T A;  2IB1 A;  2LS7 A;  1FAD A;  4N1K A;  1C15 A;  4RHW A;  1CWW A;  1ICH A;  1NGR A;  4EWI A;  2N80 A;  4F42 A;  2L6A A;  4LWD A;  2B1W A;  2GF5 A;  2MB9 A;  2MJM A;  4FH0 A;  3EZQ B;  3MOP G;  3QF2 A;  1N3K A;  4F44 A;  2N7Z A;  4DWN A;  3KAT A;  4A2Q A;  4JQW A;  2D96 A;  1D2Z B;  1D2Z A;  4P4H I;  2BBZ A;  2DBD A;  1PN5 A;  2LWD A;  3YGS C;  3J63 A;  1E3Y A;  3T6P A;  4N1L A;  2DBH A;  1WMG A;  2L9M A;  2O71 A;  2MS7 A;  3MOP K;  1WH4 A;  2F1S A;  2MN4 A;  4O6X A;  4O9L A;  4IZ5 E;  1YGO A;  2N1F A;  4NQK A;  1DDF A;  2YVI A;  2N97 A;  1WXP A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  3YGS P;  2M5V A;  2YU0 A;  2HM2 Q;  2BBR A;  2G7R A;  2NAQ A;  4RHW E;  2MPC A;  2VGQ A;  3J6J A;  4JUP A;  4E9M A;  2P1H A;  2N00 A;  4QOB A;  1DGN A;  1A1W A;  1A1Z A;  4D8O A;  2MS8 A;  2LWE A;  2KN6 A;  4N1J A;  4M9Z A;  4ZBW A;  3MOP A;  4M9S A;  2NSN A;  2OF5 H;  2DBF A;  2YQF A;  2N83 A;  4IZ7 B;  2DBG A;  2XV9 A;  3CL3 A;  3LQR A;  1CY5 A;  3LQQ A;  4M9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...