3EZQA

Crystal structure of the fas/fadd death domain complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
NLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Fas-FADD death domain complex structure unravels signalling by receptor clustering
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 6
total genus 43
structure length 115
sequence length 115
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3ezqA00
2IB1A 2MS8A 2BBZA 2OF5A 2DO9A 1WH4A 4M9ZA 3YGSP 2OF5H 2A9IA 4NQKA 1CWWA 1D2ZA 2YVIA 1DGNA 4UZ0A 1D2ZB 2DBHA 2MB9A 4ZBWA 1E41A 2NAQA 4IZ7B 4DWNA 2N97A 2G7RA 4LWDA 2O71A 3CL3A 2N80A 3YGSC 2DBDA 4O9FA 3J63A 4JQWA 4IZAB 2MPCA 1C15A 2VGQA 4I16A 2LWDA 4QOBA 1DDFA 4JUPA 2KM6A 1UCPA 2LS7A 2BBRA 3KATA 2M5VA 4N1KA 1WXPA 4M9XA 2N7ZA 4O7QA 2LWEA 3J6JA 2DBFA 4A2QA 4P4HA 4EWIA 2DBGA 1FADA 2N83A 3LQQA 2MN4A 1WMGA 1CY5A 1E3YA 3QF2A 2A5YB 2D96A 2N1FA 4F42A 4N1LA 4N1JA 3CRDA 2MS7A 3MOPA 3EZQA 1YGOA 1A1ZA 2NSNA 3LQRA 3EZQB 4M9SA 2YQFA 1N3KA 3MOPG 1A1WA 3MOPK 2HM2Q 4P4HI 4O9LA 1PN5A 2GF5A 2YGSA 4FH0A 2KN6A 1Z6TA 4A2WA 4IZ5E 4O6XA 2L9MA 2YU0A 4D8OA 4E9MA 2N00A 2P1HA 2L6AA 3T6PA 4F44A 2NZ7A 4RHWA 1NGRA 4RHWE 2F1SA 2B1WA 1ICHA
chains in the Genus database with same CATH superfamily
2IB1A 2MS8A 2BBZA 2OF5A 2DO9A 1WH4A 4M9ZA 3YGSP 2OF5H 2A9IA 4NQKA 1CWWA 1D2ZA 2YVIA 1DGNA 4UZ0A 1D2ZB 2DBHA 2MB9A 4ZBWA 1E41A 2NAQA 4IZ7B 4DWNA 2MJMA 2N97A 2G7RA 4LWDA 2O71A 3CL3A 2N80A 3YGSC 2DBDA 4O9FA 3J63A 4JQWA 4IZAB 2MPCA 1C15A 2VGQA 4I16A 2LWDA 4QOBA 1DDFA 4JUPA 2KM6A 1UCPA 2LS7A 2BBRA 3KATA 2M5VA 4N1KA 1WXPA 4M9XA 2N7ZA 4O7QA 2LWEA 3J6JA 2DBFA 4A2QA 4P4HA 4EWIA 2DBGA 1FADA 2N83A 3LQQA 2MN4A 1WMGA 1CY5A 2XV9A 1E3YA 3QF2A 2A5YB 2D96A 2N1FA 4F42A 4N1LA 4N1JA 3CRDA 2MS7A 3MOPA 3EZQA 1YGOA 1A1ZA 2NSNA 3LQRA 3EZQB 4M9SA 2YQFA 1N3KA 3MOPG 1A1WA 3MOPK 2HM2Q 4P4HI 4O9LA 1PN5A 2GF5A 2YGSA 4FH0A 2KN6A 1Z6TA 4A2WA 4IZ5E 4O6XA 2L9MA 2YU0A 4D8OA 4E9MA 2N00A 2P1HA 2L6AA 3T6PA 4F44A 2NZ7A 4RHWA 1NGRA 4RHWE 2F1SA 2B1WA 1ICHA
chains in the Genus database with same CATH topology
2IB1A 2MS8A 2BBZA 2OF5A 2DO9A 1WH4A 4M9ZA 3YGSP 2OF5H 2A9IA 4NQKA 1CWWA 1D2ZA 2YVIA 1DGNA 4UZ0A 1D2ZB 2DBHA 2MB9A 4ZBWA 1E41A 2NAQA 4IZ7B 4DWNA 2MJMA 2N97A 2G7RA 4LWDA 2O71A 3CL3A 2N80A 3YGSC 2DBDA 4O9FA 3J63A 4JQWA 4IZAB 2MPCA 1C15A 2VGQA 4I16A 2LWDA 4QOBA 1DDFA 4JUPA 2KM6A 1UCPA 2LS7A 2BBRA 3KATA 2M5VA 4N1KA 1WXPA 4M9XA 2N7ZA 4O7QA 2LWEA 3J6JA 2DBFA 4A2QA 4P4HA 4EWIA 2DBGA 1FADA 2N83A 3LQQA 2MN4A 1WMGA 1CY5A 2XV9A 1E3YA 3QF2A 2A5YB 2D96A 2N1FA 4F42A 4N1LA 4N1JA 3CRDA 2MS7A 3MOPA 3EZQA 1YGOA 1A1ZA 2NSNA 3LQRA 3EZQB 4M9SA 2YQFA 1N3KA 3MOPG 1A1WA 3MOPK 2HM2Q 4P4HI 4O9LA 1PN5A 2GF5A 2YGSA 4FH0A 2KN6A 1Z6TA 4A2WA 4IZ5E 4O6XA 2L9MA 2YU0A 4D8OA 4E9MA 2N00A 2P1HA 2L6AA 3T6PA 4F44A 2NZ7A 4RHWA 1NGRA 4RHWE 2F1SA 2B1WA 1ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IB1 A;  2MS8 A;  2BBZ A;  2OF5 A;  2DO9 A;  1WH4 A;  4M9Z A;  3YGS P;  2OF5 H;  2A9I A;  4NQK A;  1CWW A;  1D2Z A;  2YVI A;  1DGN A;  4UZ0 A;  1D2Z B;  2DBH A;  2MB9 A;  4ZBW A;  1E41 A;  2NAQ A;  4IZ7 B;  4DWN A;  2N97 A;  2G7R A;  4LWD A;  2O71 A;  3CL3 A;  2N80 A;  3YGS C;  2DBD A;  4O9F A;  3J63 A;  4JQW A;  4IZA B;  2MPC A;  1C15 A;  2VGQ A;  4I16 A;  2LWD A;  4QOB A;  1DDF A;  4JUP A;  2KM6 A;  1UCP A;  2LS7 A;  2BBR A;  3KAT A;  2M5V A;  4N1K A;  1WXP A;  4M9X A;  2N7Z A;  4O7Q A;  2LWE A;  3J6J A;  2DBF A;  4A2Q A;  4P4H A;  4EWI A;  2DBG A;  1FAD A;  2N83 A;  3LQQ A;  2MN4 A;  1WMG A;  1CY5 A;  1E3Y A;  3QF2 A;  2A5Y B;  2D96 A;  2N1F A;  4F42 A;  4N1L A;  4N1J A;  3CRD A;  2MS7 A;  3MOP A;  3EZQ A;  1YGO A;  1A1Z A;  2NSN A;  3LQR A;  3EZQ B;  4M9S A;  2YQF A;  1N3K A;  3MOP G;  1A1W A;  3MOP K;  2HM2 Q;  4P4H I;  4O9L A;  1PN5 A;  2GF5 A;  2YGS A;  4FH0 A;  2KN6 A;  1Z6T A;  4A2W A;  4IZ5 E;  4O6X A;  2L9M A;  2YU0 A;  4D8O A;  4E9M A;  2N00 A;  2P1H A;  2L6A A;  3T6P A;  4F44 A;  2NZ7 A;  4RHW A;  1NGR A;  4RHW E;  2F1S A;  2B1W A;  1ICH A; 
#chains in the Genus database with same CATH topology
 2IB1 A;  2MS8 A;  2BBZ A;  2OF5 A;  2DO9 A;  1WH4 A;  4M9Z A;  3YGS P;  2OF5 H;  2A9I A;  4NQK A;  1CWW A;  1D2Z A;  2YVI A;  1DGN A;  4UZ0 A;  1D2Z B;  2DBH A;  2MB9 A;  4ZBW A;  1E41 A;  2NAQ A;  4IZ7 B;  4DWN A;  2MJM A;  2N97 A;  2G7R A;  4LWD A;  2O71 A;  3CL3 A;  2N80 A;  3YGS C;  2DBD A;  4O9F A;  3J63 A;  4JQW A;  4IZA B;  2MPC A;  1C15 A;  2VGQ A;  4I16 A;  2LWD A;  4QOB A;  1DDF A;  4JUP A;  2KM6 A;  1UCP A;  2LS7 A;  2BBR A;  3KAT A;  2M5V A;  4N1K A;  1WXP A;  4M9X A;  2N7Z A;  4O7Q A;  2LWE A;  3J6J A;  2DBF A;  4A2Q A;  4P4H A;  4EWI A;  2DBG A;  1FAD A;  2N83 A;  3LQQ A;  2MN4 A;  1WMG A;  1CY5 A;  2XV9 A;  1E3Y A;  3QF2 A;  2A5Y B;  2D96 A;  2N1F A;  4F42 A;  4N1L A;  4N1J A;  3CRD A;  2MS7 A;  3MOP A;  3EZQ A;  1YGO A;  1A1Z A;  2NSN A;  3LQR A;  3EZQ B;  4M9S A;  2YQF A;  1N3K A;  3MOP G;  1A1W A;  3MOP K;  2HM2 Q;  4P4H I;  4O9L A;  1PN5 A;  2GF5 A;  2YGS A;  4FH0 A;  2KN6 A;  1Z6T A;  4A2W A;  4IZ5 E;  4O6X A;  2L9M A;  2YU0 A;  4D8O A;  4E9M A;  2N00 A;  2P1H A;  2L6A A;  3T6P A;  4F44 A;  2NZ7 A;  4RHW A;  1NGR A;  4RHW E;  2F1S A;  2B1W A;  1ICH A; 
#chains in the Genus database with same CATH homology
 2IB1 A;  2MS8 A;  2BBZ A;  2OF5 A;  2DO9 A;  1WH4 A;  4M9Z A;  3YGS P;  2OF5 H;  2A9I A;  4NQK A;  1CWW A;  1D2Z A;  2YVI A;  1DGN A;  4UZ0 A;  1D2Z B;  2DBH A;  2MB9 A;  4ZBW A;  1E41 A;  2NAQ A;  4IZ7 B;  4DWN A;  2MJM A;  2N97 A;  2G7R A;  4LWD A;  2O71 A;  3CL3 A;  2N80 A;  3YGS C;  2DBD A;  4O9F A;  3J63 A;  4JQW A;  4IZA B;  2MPC A;  1C15 A;  2VGQ A;  4I16 A;  2LWD A;  4QOB A;  1DDF A;  4JUP A;  2KM6 A;  1UCP A;  2LS7 A;  2BBR A;  3KAT A;  2M5V A;  4N1K A;  1WXP A;  4M9X A;  2N7Z A;  4O7Q A;  2LWE A;  3J6J A;  2DBF A;  4A2Q A;  4P4H A;  4EWI A;  2DBG A;  1FAD A;  2N83 A;  3LQQ A;  2MN4 A;  1WMG A;  1CY5 A;  2XV9 A;  1E3Y A;  3QF2 A;  2A5Y B;  2D96 A;  2N1F A;  4F42 A;  4N1L A;  4N1J A;  3CRD A;  2MS7 A;  3MOP A;  3EZQ A;  1YGO A;  1A1Z A;  2NSN A;  3LQR A;  3EZQ B;  4M9S A;  2YQF A;  1N3K A;  3MOP G;  1A1W A;  3MOP K;  2HM2 Q;  4P4H I;  4O9L A;  1PN5 A;  2GF5 A;  2YGS A;  4FH0 A;  2KN6 A;  1Z6T A;  4A2W A;  4IZ5 E;  4O6X A;  2L9M A;  2YU0 A;  4D8O A;  4E9M A;  2N00 A;  2P1H A;  2L6A A;  3T6P A;  4F44 A;  2NZ7 A;  4RHW A;  1NGR A;  4RHW E;  2F1S A;  2B1W A;  1ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...