3CL3A

Crystal structure of a vflip-ikkgamma complex: insights into viral activation of the ikk signalosome
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
172
structure length
172
Chain Sequence
ATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRALKEEGRLTFPLLAECLFRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVLHVDGELCARDIRSLIFLSKDTIGSRSTPQTFLHWVYCMENLDLLGPTDVDALMSMLRSLSRVDLQRQVQTLMGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a vFlip-IKKgamma complex: insights into viral activation of the IKK signalosome.
pubmed doi rcsb
source organism Human gammaherpesvirus 8
molecule tags Viral protein/signaling protein
molecule keywords ORF K13
total genus 57
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3cl3A02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3cl3A01
3J63A 3CL3A 4N1JA 1A1WA 2MB9A 3LQRA 2P1HA 4F42A 2B1WA 3J6JA 1NGRA 2N97A 1FADA 3EZQA 1N3KA 4I16A 2OF5H 2GF5A 3YGSP 1WXPA 2DO9A 2G7RA 3MOPG 2YU0A 2N7ZA 2DBHA 3YGSC 2OF5A 4IZAB 4DWNA 2DBDA 2D96A 3EZQB 1ICHA 2MPCA 4A2QA 2MN4A 1DDFA 2DBGA 4JQWA 4EWIA 2YGSA 2N00A 4E9MA 2LWDA 2NZ7A 4N1KA 3MOPK 2YVIA 2BBZA 2HM2Q 1YGOA 4NQKA 3T6PA 4RHWE 4JUPA 1C15A 1CY5A 2KN6A 4UZ0A 1WH4A 2M5VA 2MS7A 2YQFA 2DBFA 2A9IA 4D8OA 4M9XA 2N1FA 2A5YB 4RHWA 2O71A 2BBRA 4O9LA 2L9MA 4IZ5E 4A2WA 3MOPA 2IB1A 1PN5A 1E3YA 4LWDA 4ZBWA 1D2ZA 3QF2A 1A1ZA 2KM6A 4O9FA 2NSNA 4QOBA 4IZ7B 2MS8A 3CRDA 1Z6TA 2VGQA 4FH0A 2LWEA 2F1SA 1D2ZB 1UCPA 3LQQA 4O7QA 1WMGA 4F44A 4N1LA 4P4HA 3KATA 4P4HI 1E41A 2L6AA 2NAQA 4O6XA 1CWWA 4M9ZA 2LS7A 4M9SA 1DGNA 2N80A 2N83A
chains in the Genus database with same CATH superfamily
3J63A 3CL3A 4N1JA 1A1WA 2MB9A 3LQRA 2P1HA 4F42A 2B1WA 3J6JA 1NGRA 2N97A 1FADA 3EZQA 1N3KA 4I16A 2OF5H 2GF5A 3YGSP 1WXPA 2DO9A 2G7RA 3MOPG 2YU0A 2N7ZA 2DBHA 3YGSC 2OF5A 4IZAB 4DWNA 2DBDA 2D96A 3EZQB 1ICHA 2MPCA 4A2QA 2MN4A 1DDFA 2DBGA 4JQWA 4EWIA 2YGSA 2N00A 4E9MA 2LWDA 2NZ7A 4N1KA 3MOPK 2YVIA 2BBZA 2HM2Q 1YGOA 4NQKA 3T6PA 4RHWE 4JUPA 1C15A 1CY5A 2KN6A 4UZ0A 1WH4A 2M5VA 2MJMA 2MS7A 2YQFA 2DBFA 2A9IA 4D8OA 4M9XA 2N1FA 2A5YB 4RHWA 2O71A 2BBRA 4O9LA 2L9MA 4IZ5E 4A2WA 3MOPA 2IB1A 1PN5A 1E3YA 4LWDA 4ZBWA 1D2ZA 3QF2A 1A1ZA 2KM6A 4O9FA 2NSNA 4QOBA 4IZ7B 2MS8A 3CRDA 1Z6TA 2VGQA 4FH0A 2XV9A 2LWEA 2F1SA 1D2ZB 1UCPA 3LQQA 4O7QA 1WMGA 4F44A 4N1LA 4P4HA 3KATA 4P4HI 1E41A 2L6AA 2NAQA 4O6XA 1CWWA 4M9ZA 2LS7A 4M9SA 1DGNA 2N80A 2N83A
chains in the Genus database with same CATH topology
3J63A 3CL3A 4N1JA 1A1WA 2MB9A 3LQRA 2P1HA 4F42A 2B1WA 3J6JA 1NGRA 2N97A 1FADA 3EZQA 1N3KA 4I16A 2OF5H 2GF5A 3YGSP 1WXPA 2DO9A 2G7RA 3MOPG 2YU0A 2N7ZA 2DBHA 3YGSC 2OF5A 4IZAB 4DWNA 2DBDA 2D96A 3EZQB 1ICHA 2MPCA 4A2QA 2MN4A 1DDFA 2DBGA 4JQWA 4EWIA 2YGSA 2N00A 4E9MA 2LWDA 2NZ7A 4N1KA 3MOPK 2YVIA 2BBZA 2HM2Q 1YGOA 4NQKA 3T6PA 4RHWE 4JUPA 1C15A 1CY5A 2KN6A 4UZ0A 1WH4A 2M5VA 2MJMA 2MS7A 2YQFA 2DBFA 2A9IA 4D8OA 4M9XA 2N1FA 2A5YB 4RHWA 2O71A 2BBRA 4O9LA 2L9MA 4IZ5E 4A2WA 3MOPA 2IB1A 1PN5A 1E3YA 4LWDA 4ZBWA 1D2ZA 3QF2A 1A1ZA 2KM6A 4O9FA 2NSNA 4QOBA 4IZ7B 2MS8A 3CRDA 1Z6TA 2VGQA 4FH0A 2XV9A 2LWEA 2F1SA 1D2ZB 1UCPA 3LQQA 4O7QA 1WMGA 4F44A 4N1LA 4P4HA 3KATA 4P4HI 1E41A 2L6AA 2NAQA 4O6XA 1CWWA 4M9ZA 2LS7A 4M9SA 1DGNA 2N80A 2N83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J63 A;  3CL3 A;  4N1J A;  1A1W A;  2MB9 A;  3LQR A;  2P1H A;  4F42 A;  2B1W A;  3J6J A;  1NGR A;  2N97 A;  1FAD A;  3EZQ A;  1N3K A;  4I16 A;  2OF5 H;  2GF5 A;  3YGS P;  1WXP A;  2DO9 A;  2G7R A;  3MOP G;  2YU0 A;  2N7Z A;  2DBH A;  3YGS C;  2OF5 A;  4IZA B;  4DWN A;  2DBD A;  2D96 A;  3EZQ B;  1ICH A;  2MPC A;  4A2Q A;  2MN4 A;  1DDF A;  2DBG A;  4JQW A;  4EWI A;  2YGS A;  2N00 A;  4E9M A;  2LWD A;  2NZ7 A;  4N1K A;  3MOP K;  2YVI A;  2BBZ A;  2HM2 Q;  1YGO A;  4NQK A;  3T6P A;  4RHW E;  4JUP A;  1C15 A;  1CY5 A;  2KN6 A;  4UZ0 A;  1WH4 A;  2M5V A;  2MS7 A;  2YQF A;  2DBF A;  2A9I A;  4D8O A;  4M9X A;  2N1F A;  2A5Y B;  4RHW A;  2O71 A;  2BBR A;  4O9L A;  2L9M A;  4IZ5 E;  4A2W A;  3MOP A;  2IB1 A;  1PN5 A;  1E3Y A;  4LWD A;  4ZBW A;  1D2Z A;  3QF2 A;  1A1Z A;  2KM6 A;  4O9F A;  2NSN A;  4QOB A;  4IZ7 B;  2MS8 A;  3CRD A;  1Z6T A;  2VGQ A;  4FH0 A;  2LWE A;  2F1S A;  1D2Z B;  1UCP A;  3LQQ A;  4O7Q A;  1WMG A;  4F44 A;  4N1L A;  4P4H A;  3KAT A;  4P4H I;  1E41 A;  2L6A A;  2NAQ A;  4O6X A;  1CWW A;  4M9Z A;  2LS7 A;  4M9S A;  1DGN A;  2N80 A;  2N83 A; 
#chains in the Genus database with same CATH topology
 3J63 A;  3CL3 A;  4N1J A;  1A1W A;  2MB9 A;  3LQR A;  2P1H A;  4F42 A;  2B1W A;  3J6J A;  1NGR A;  2N97 A;  1FAD A;  3EZQ A;  1N3K A;  4I16 A;  2OF5 H;  2GF5 A;  3YGS P;  1WXP A;  2DO9 A;  2G7R A;  3MOP G;  2YU0 A;  2N7Z A;  2DBH A;  3YGS C;  2OF5 A;  4IZA B;  4DWN A;  2DBD A;  2D96 A;  3EZQ B;  1ICH A;  2MPC A;  4A2Q A;  2MN4 A;  1DDF A;  2DBG A;  4JQW A;  4EWI A;  2YGS A;  2N00 A;  4E9M A;  2LWD A;  2NZ7 A;  4N1K A;  3MOP K;  2YVI A;  2BBZ A;  2HM2 Q;  1YGO A;  4NQK A;  3T6P A;  4RHW E;  4JUP A;  1C15 A;  1CY5 A;  2KN6 A;  4UZ0 A;  1WH4 A;  2M5V A;  2MJM A;  2MS7 A;  2YQF A;  2DBF A;  2A9I A;  4D8O A;  4M9X A;  2N1F A;  2A5Y B;  4RHW A;  2O71 A;  2BBR A;  4O9L A;  2L9M A;  4IZ5 E;  4A2W A;  3MOP A;  2IB1 A;  1PN5 A;  1E3Y A;  4LWD A;  4ZBW A;  1D2Z A;  3QF2 A;  1A1Z A;  2KM6 A;  4O9F A;  2NSN A;  4QOB A;  4IZ7 B;  2MS8 A;  3CRD A;  1Z6T A;  2VGQ A;  4FH0 A;  2XV9 A;  2LWE A;  2F1S A;  1D2Z B;  1UCP A;  3LQQ A;  4O7Q A;  1WMG A;  4F44 A;  4N1L A;  4P4H A;  3KAT A;  4P4H I;  1E41 A;  2L6A A;  2NAQ A;  4O6X A;  1CWW A;  4M9Z A;  2LS7 A;  4M9S A;  1DGN A;  2N80 A;  2N83 A; 
#chains in the Genus database with same CATH homology
 3J63 A;  3CL3 A;  4N1J A;  1A1W A;  2MB9 A;  3LQR A;  2P1H A;  4F42 A;  2B1W A;  3J6J A;  1NGR A;  2N97 A;  1FAD A;  3EZQ A;  1N3K A;  4I16 A;  2OF5 H;  2GF5 A;  3YGS P;  1WXP A;  2DO9 A;  2G7R A;  3MOP G;  2YU0 A;  2N7Z A;  2DBH A;  3YGS C;  2OF5 A;  4IZA B;  4DWN A;  2DBD A;  2D96 A;  3EZQ B;  1ICH A;  2MPC A;  4A2Q A;  2MN4 A;  1DDF A;  2DBG A;  4JQW A;  4EWI A;  2YGS A;  2N00 A;  4E9M A;  2LWD A;  2NZ7 A;  4N1K A;  3MOP K;  2YVI A;  2BBZ A;  2HM2 Q;  1YGO A;  4NQK A;  3T6P A;  4RHW E;  4JUP A;  1C15 A;  1CY5 A;  2KN6 A;  4UZ0 A;  1WH4 A;  2M5V A;  2MJM A;  2MS7 A;  2YQF A;  2DBF A;  2A9I A;  4D8O A;  4M9X A;  2N1F A;  2A5Y B;  4RHW A;  2O71 A;  2BBR A;  4O9L A;  2L9M A;  4IZ5 E;  4A2W A;  3MOP A;  2IB1 A;  1PN5 A;  1E3Y A;  4LWD A;  4ZBW A;  1D2Z A;  3QF2 A;  1A1Z A;  2KM6 A;  4O9F A;  2NSN A;  4QOB A;  4IZ7 B;  2MS8 A;  3CRD A;  1Z6T A;  2VGQ A;  4FH0 A;  2XV9 A;  2LWE A;  2F1S A;  1D2Z B;  1UCP A;  3LQQ A;  4O7Q A;  1WMG A;  4F44 A;  4N1L A;  4P4H A;  3KAT A;  4P4H I;  1E41 A;  2L6A A;  2NAQ A;  4O6X A;  1CWW A;  4M9Z A;  2LS7 A;  4M9S A;  1DGN A;  2N80 A;  2N83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...