4I16A

Crystal structure of carma1 card
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
AALWDNVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the assembly of CARMA1 and BCL10
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Caspase recruitment domain-containing protein 11
total genus 31
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4i16A00
2MS7A 2YQFA 4DWNA 3MOPK 4N1JA 2MB9A 3LQRA 3MOPA 1D2ZB 2N80A 2BBZA 2A5YB 2GF5A 4O9LA 3YGSC 4D8OA 3YGSP 2KN6A 4F44A 3CRDA 2NZ7A 1PN5A 2B1WA 1A1WA 2P1HA 2LWDA 2L9MA 4E9MA 4O7QA 1DGNA 3EZQB 2DBDA 4M9SA 1N3KA 1E41A 4F42A 2YGSA 2N83A 2KM6A 2N97A 3J63A 4M9ZA 2IB1A 1Z6TA 4EWIA 4N1KA 4FH0A 1FADA 1DDFA 2D96A 1NGRA 4N1LA 4IZAB 1WH4A 4NQKA 2LWEA 1C15A 4ZBWA 4IZ5E 4JQWA 3T6PA 4IZ7B 2MPCA 4P4HI 3KATA 3EZQA 1YGOA 2LS7A 3MOPG 2DO9A 2DBGA 2O71A 4RHWA 2OF5A 2G7RA 4QOBA 2F1SA 2NAQA 4JUPA 4O9FA 4UZ0A 2HM2Q 4A2QA 1ICHA 2N1FA 1A1ZA 4LWDA 2YVIA 3QF2A 4P4HA 2DBFA 1WXPA 2DBHA 2M5VA 4M9XA 2BBRA 4RHWE 1UCPA 1CWWA 4I16A 2N00A 1D2ZA 1WMGA 2MS8A 4A2WA 2A9IA 2N7ZA 2L6AA 4O6XA 2VGQA 3LQQA 1CY5A 2MN4A 2YU0A 2NSNA 3J6JA 1E3YA 2OF5H 3CL3A
chains in the Genus database with same CATH superfamily
2MS7A 2YQFA 4DWNA 3MOPK 4N1JA 2MB9A 3LQRA 3MOPA 1D2ZB 2N80A 2BBZA 2A5YB 2GF5A 4O9LA 3YGSC 4D8OA 3YGSP 2KN6A 4F44A 3CRDA 2NZ7A 1PN5A 2B1WA 1A1WA 2P1HA 2LWDA 2L9MA 4E9MA 4O7QA 1DGNA 3EZQB 2DBDA 4M9SA 1N3KA 1E41A 4F42A 2YGSA 2N83A 2KM6A 2N97A 3J63A 4M9ZA 2IB1A 1Z6TA 4EWIA 4N1KA 4FH0A 1FADA 1DDFA 2D96A 1NGRA 4N1LA 4IZAB 1WH4A 4NQKA 2LWEA 1C15A 4ZBWA 4IZ5E 4JQWA 3T6PA 4IZ7B 2MPCA 4P4HI 3KATA 3EZQA 1YGOA 2LS7A 3MOPG 2DO9A 2DBGA 2O71A 4RHWA 2OF5A 2G7RA 2MJMA 4QOBA 2F1SA 2NAQA 4JUPA 4O9FA 4UZ0A 2HM2Q 4A2QA 1ICHA 2N1FA 1A1ZA 4LWDA 2YVIA 3QF2A 4P4HA 2DBFA 1WXPA 2DBHA 2M5VA 4M9XA 2BBRA 4RHWE 1UCPA 1CWWA 4I16A 2N00A 1D2ZA 1WMGA 2MS8A 4A2WA 2A9IA 2N7ZA 2L6AA 4O6XA 2VGQA 3LQQA 1CY5A 2MN4A 2YU0A 2NSNA 3J6JA 1E3YA 2XV9A 2OF5H 3CL3A
chains in the Genus database with same CATH topology
2MS7A 2YQFA 4DWNA 3MOPK 4N1JA 2MB9A 3LQRA 3MOPA 1D2ZB 2N80A 2BBZA 2A5YB 2GF5A 4O9LA 3YGSC 4D8OA 3YGSP 2KN6A 4F44A 3CRDA 2NZ7A 1PN5A 2B1WA 1A1WA 2P1HA 2LWDA 2L9MA 4E9MA 4O7QA 1DGNA 3EZQB 2DBDA 4M9SA 1N3KA 1E41A 4F42A 2YGSA 2N83A 2KM6A 2N97A 3J63A 4M9ZA 2IB1A 1Z6TA 4EWIA 4N1KA 4FH0A 1FADA 1DDFA 2D96A 1NGRA 4N1LA 4IZAB 1WH4A 4NQKA 2LWEA 1C15A 4ZBWA 4IZ5E 4JQWA 3T6PA 4IZ7B 2MPCA 4P4HI 3KATA 3EZQA 1YGOA 2LS7A 3MOPG 2DO9A 2DBGA 2O71A 4RHWA 2OF5A 2G7RA 2MJMA 4QOBA 2F1SA 2NAQA 4JUPA 4O9FA 4UZ0A 2HM2Q 4A2QA 1ICHA 2N1FA 1A1ZA 4LWDA 2YVIA 3QF2A 4P4HA 2DBFA 1WXPA 2DBHA 2M5VA 4M9XA 2BBRA 4RHWE 1UCPA 1CWWA 4I16A 2N00A 1D2ZA 1WMGA 2MS8A 4A2WA 2A9IA 2N7ZA 2L6AA 4O6XA 2VGQA 3LQQA 1CY5A 2MN4A 2YU0A 2NSNA 3J6JA 1E3YA 2XV9A 2OF5H 3CL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MS7 A;  2YQF A;  4DWN A;  3MOP K;  4N1J A;  2MB9 A;  3LQR A;  3MOP A;  1D2Z B;  2N80 A;  2BBZ A;  2A5Y B;  2GF5 A;  4O9L A;  3YGS C;  4D8O A;  3YGS P;  2KN6 A;  4F44 A;  3CRD A;  2NZ7 A;  1PN5 A;  2B1W A;  1A1W A;  2P1H A;  2LWD A;  2L9M A;  4E9M A;  4O7Q A;  1DGN A;  3EZQ B;  2DBD A;  4M9S A;  1N3K A;  1E41 A;  4F42 A;  2YGS A;  2N83 A;  2KM6 A;  2N97 A;  3J63 A;  4M9Z A;  2IB1 A;  1Z6T A;  4EWI A;  4N1K A;  4FH0 A;  1FAD A;  1DDF A;  2D96 A;  1NGR A;  4N1L A;  4IZA B;  1WH4 A;  4NQK A;  2LWE A;  1C15 A;  4ZBW A;  4IZ5 E;  4JQW A;  3T6P A;  4IZ7 B;  2MPC A;  4P4H I;  3KAT A;  3EZQ A;  1YGO A;  2LS7 A;  3MOP G;  2DO9 A;  2DBG A;  2O71 A;  4RHW A;  2OF5 A;  2G7R A;  4QOB A;  2F1S A;  2NAQ A;  4JUP A;  4O9F A;  4UZ0 A;  2HM2 Q;  4A2Q A;  1ICH A;  2N1F A;  1A1Z A;  4LWD A;  2YVI A;  3QF2 A;  4P4H A;  2DBF A;  1WXP A;  2DBH A;  2M5V A;  4M9X A;  2BBR A;  4RHW E;  1UCP A;  1CWW A;  4I16 A;  2N00 A;  1D2Z A;  1WMG A;  2MS8 A;  4A2W A;  2A9I A;  2N7Z A;  2L6A A;  4O6X A;  2VGQ A;  3LQQ A;  1CY5 A;  2MN4 A;  2YU0 A;  2NSN A;  3J6J A;  1E3Y A;  2OF5 H;  3CL3 A; 
#chains in the Genus database with same CATH topology
 2MS7 A;  2YQF A;  4DWN A;  3MOP K;  4N1J A;  2MB9 A;  3LQR A;  3MOP A;  1D2Z B;  2N80 A;  2BBZ A;  2A5Y B;  2GF5 A;  4O9L A;  3YGS C;  4D8O A;  3YGS P;  2KN6 A;  4F44 A;  3CRD A;  2NZ7 A;  1PN5 A;  2B1W A;  1A1W A;  2P1H A;  2LWD A;  2L9M A;  4E9M A;  4O7Q A;  1DGN A;  3EZQ B;  2DBD A;  4M9S A;  1N3K A;  1E41 A;  4F42 A;  2YGS A;  2N83 A;  2KM6 A;  2N97 A;  3J63 A;  4M9Z A;  2IB1 A;  1Z6T A;  4EWI A;  4N1K A;  4FH0 A;  1FAD A;  1DDF A;  2D96 A;  1NGR A;  4N1L A;  4IZA B;  1WH4 A;  4NQK A;  2LWE A;  1C15 A;  4ZBW A;  4IZ5 E;  4JQW A;  3T6P A;  4IZ7 B;  2MPC A;  4P4H I;  3KAT A;  3EZQ A;  1YGO A;  2LS7 A;  3MOP G;  2DO9 A;  2DBG A;  2O71 A;  4RHW A;  2OF5 A;  2G7R A;  2MJM A;  4QOB A;  2F1S A;  2NAQ A;  4JUP A;  4O9F A;  4UZ0 A;  2HM2 Q;  4A2Q A;  1ICH A;  2N1F A;  1A1Z A;  4LWD A;  2YVI A;  3QF2 A;  4P4H A;  2DBF A;  1WXP A;  2DBH A;  2M5V A;  4M9X A;  2BBR A;  4RHW E;  1UCP A;  1CWW A;  4I16 A;  2N00 A;  1D2Z A;  1WMG A;  2MS8 A;  4A2W A;  2A9I A;  2N7Z A;  2L6A A;  4O6X A;  2VGQ A;  3LQQ A;  1CY5 A;  2MN4 A;  2YU0 A;  2NSN A;  3J6J A;  1E3Y A;  2XV9 A;  2OF5 H;  3CL3 A; 
#chains in the Genus database with same CATH homology
 2MS7 A;  2YQF A;  4DWN A;  3MOP K;  4N1J A;  2MB9 A;  3LQR A;  3MOP A;  1D2Z B;  2N80 A;  2BBZ A;  2A5Y B;  2GF5 A;  4O9L A;  3YGS C;  4D8O A;  3YGS P;  2KN6 A;  4F44 A;  3CRD A;  2NZ7 A;  1PN5 A;  2B1W A;  1A1W A;  2P1H A;  2LWD A;  2L9M A;  4E9M A;  4O7Q A;  1DGN A;  3EZQ B;  2DBD A;  4M9S A;  1N3K A;  1E41 A;  4F42 A;  2YGS A;  2N83 A;  2KM6 A;  2N97 A;  3J63 A;  4M9Z A;  2IB1 A;  1Z6T A;  4EWI A;  4N1K A;  4FH0 A;  1FAD A;  1DDF A;  2D96 A;  1NGR A;  4N1L A;  4IZA B;  1WH4 A;  4NQK A;  2LWE A;  1C15 A;  4ZBW A;  4IZ5 E;  4JQW A;  3T6P A;  4IZ7 B;  2MPC A;  4P4H I;  3KAT A;  3EZQ A;  1YGO A;  2LS7 A;  3MOP G;  2DO9 A;  2DBG A;  2O71 A;  4RHW A;  2OF5 A;  2G7R A;  2MJM A;  4QOB A;  2F1S A;  2NAQ A;  4JUP A;  4O9F A;  4UZ0 A;  2HM2 Q;  4A2Q A;  1ICH A;  2N1F A;  1A1Z A;  4LWD A;  2YVI A;  3QF2 A;  4P4H A;  2DBF A;  1WXP A;  2DBH A;  2M5V A;  4M9X A;  2BBR A;  4RHW E;  1UCP A;  1CWW A;  4I16 A;  2N00 A;  1D2Z A;  1WMG A;  2MS8 A;  4A2W A;  2A9I A;  2N7Z A;  2L6A A;  4O6X A;  2VGQ A;  3LQQ A;  1CY5 A;  2MN4 A;  2YU0 A;  2NSN A;  3J6J A;  1E3Y A;  2XV9 A;  2OF5 H;  3CL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...