2NAQA

3d nmr solution structure of nlrp3 pyd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
MASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ASC Pyrin Domain Self-associates and Binds NLRP3 Protein Using Equivalent Binding Interfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords NACHT, LRR and PYD domains-containing protein 3
total genus 22
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2naqA00
4A2QA 4N1JA 1WH4A 1FADA 2L9MA 2YVIA 1Z6TA 2MS7A 2OF5A 4LWDA 2DO9A 1ICHA 4JUPA 2BBZA 1E41A 1UCPA 2D96A 2HM2Q 2DBGA 2KN6A 3EZQA 4F42A 3YGSC 3YGSP 1NGRA 2BBRA 2DBFA 3EZQB 2MB9A 2LS7A 1PN5A 2N7ZA 2M5VA 4M9XA 1E3YA 2F1SA 2MS8A 4RHWE 4O9LA 2LWEA 3J6JA 3MOPG 3QF2A 3LQQA 1A1WA 4QOBA 2A9IA 1WXPA 2MN4A 2NZ7A 4M9ZA 2B1WA 4F44A 4IZ7B 2N1FA 1DGNA 4RHWA 4EWIA 2VGQA 2YGSA 4O9FA 3LQRA 2YQFA 2N83A 2YU0A 3MOPA 1D2ZA 3MOPK 4O6XA 3T6PA 2N80A 4M9SA 1CY5A 2DBHA 4ZBWA 4FH0A 1DDFA 2NAQA 2DBDA 4N1KA 2A5YB 2KM6A 2G7RA 2N00A 4N1LA 3J63A 4UZ0A 2O71A 1C15A 4D8OA 1CWWA 4I16A 2GF5A 4A2WA 2MPCA 1WMGA 3CRDA 3CL3A 1D2ZB 4JQWA 4IZAB 2IB1A 3KATA 1A1ZA 4P4HA 2LWDA 4IZ5E 4NQKA 2L6AA 2NSNA 2OF5H 2P1HA 1YGOA 1N3KA 4P4HI 2N97A 4E9MA 4DWNA 4O7QA
chains in the Genus database with same CATH superfamily
4A2QA 4N1JA 1WH4A 1FADA 2L9MA 2YVIA 1Z6TA 2MS7A 2OF5A 4LWDA 2DO9A 1ICHA 4JUPA 2BBZA 1E41A 2MJMA 1UCPA 2D96A 2HM2Q 2DBGA 2KN6A 3EZQA 4F42A 3YGSC 3YGSP 1NGRA 2BBRA 2DBFA 3EZQB 2MB9A 2LS7A 1PN5A 2N7ZA 2M5VA 4M9XA 1E3YA 2F1SA 2MS8A 4RHWE 4O9LA 2LWEA 3J6JA 3MOPG 3QF2A 3LQQA 1A1WA 4QOBA 2A9IA 1WXPA 2MN4A 2NZ7A 4M9ZA 2B1WA 4F44A 4IZ7B 2N1FA 1DGNA 4RHWA 4EWIA 2VGQA 2YGSA 4O9FA 3LQRA 2YQFA 2N83A 2YU0A 3MOPA 1D2ZA 3MOPK 4O6XA 3T6PA 2N80A 4M9SA 1CY5A 2DBHA 4ZBWA 4FH0A 1DDFA 2NAQA 2DBDA 2XV9A 4N1KA 2A5YB 2KM6A 2G7RA 2N00A 4N1LA 3J63A 4UZ0A 2O71A 1C15A 4D8OA 1CWWA 4I16A 2GF5A 4A2WA 2MPCA 1WMGA 3CRDA 3CL3A 1D2ZB 4JQWA 4IZAB 2IB1A 3KATA 1A1ZA 4P4HA 2LWDA 4IZ5E 4NQKA 2L6AA 2NSNA 2OF5H 2P1HA 1YGOA 1N3KA 4P4HI 2N97A 4E9MA 4DWNA 4O7QA
chains in the Genus database with same CATH topology
4A2QA 4N1JA 1WH4A 1FADA 2L9MA 2YVIA 1Z6TA 2MS7A 2OF5A 4LWDA 2DO9A 1ICHA 4JUPA 2BBZA 1E41A 2MJMA 1UCPA 2D96A 2HM2Q 2DBGA 2KN6A 3EZQA 4F42A 3YGSC 3YGSP 1NGRA 2BBRA 2DBFA 3EZQB 2MB9A 2LS7A 1PN5A 2N7ZA 2M5VA 4M9XA 1E3YA 2F1SA 2MS8A 4RHWE 4O9LA 2LWEA 3J6JA 3MOPG 3QF2A 3LQQA 1A1WA 4QOBA 2A9IA 1WXPA 2MN4A 2NZ7A 4M9ZA 2B1WA 4F44A 4IZ7B 2N1FA 1DGNA 4RHWA 4EWIA 2VGQA 2YGSA 4O9FA 3LQRA 2YQFA 2N83A 2YU0A 3MOPA 1D2ZA 3MOPK 4O6XA 3T6PA 2N80A 4M9SA 1CY5A 2DBHA 4ZBWA 4FH0A 1DDFA 2NAQA 2DBDA 2XV9A 4N1KA 2A5YB 2KM6A 2G7RA 2N00A 4N1LA 3J63A 4UZ0A 2O71A 1C15A 4D8OA 1CWWA 4I16A 2GF5A 4A2WA 2MPCA 1WMGA 3CRDA 3CL3A 1D2ZB 4JQWA 4IZAB 2IB1A 3KATA 1A1ZA 4P4HA 2LWDA 4IZ5E 4NQKA 2L6AA 2NSNA 2OF5H 2P1HA 1YGOA 1N3KA 4P4HI 2N97A 4E9MA 4DWNA 4O7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Q A;  4N1J A;  1WH4 A;  1FAD A;  2L9M A;  2YVI A;  1Z6T A;  2MS7 A;  2OF5 A;  4LWD A;  2DO9 A;  1ICH A;  4JUP A;  2BBZ A;  1E41 A;  1UCP A;  2D96 A;  2HM2 Q;  2DBG A;  2KN6 A;  3EZQ A;  4F42 A;  3YGS C;  3YGS P;  1NGR A;  2BBR A;  2DBF A;  3EZQ B;  2MB9 A;  2LS7 A;  1PN5 A;  2N7Z A;  2M5V A;  4M9X A;  1E3Y A;  2F1S A;  2MS8 A;  4RHW E;  4O9L A;  2LWE A;  3J6J A;  3MOP G;  3QF2 A;  3LQQ A;  1A1W A;  4QOB A;  2A9I A;  1WXP A;  2MN4 A;  2NZ7 A;  4M9Z A;  2B1W A;  4F44 A;  4IZ7 B;  2N1F A;  1DGN A;  4RHW A;  4EWI A;  2VGQ A;  2YGS A;  4O9F A;  3LQR A;  2YQF A;  2N83 A;  2YU0 A;  3MOP A;  1D2Z A;  3MOP K;  4O6X A;  3T6P A;  2N80 A;  4M9S A;  1CY5 A;  2DBH A;  4ZBW A;  4FH0 A;  1DDF A;  2NAQ A;  2DBD A;  4N1K A;  2A5Y B;  2KM6 A;  2G7R A;  2N00 A;  4N1L A;  3J63 A;  4UZ0 A;  2O71 A;  1C15 A;  4D8O A;  1CWW A;  4I16 A;  2GF5 A;  4A2W A;  2MPC A;  1WMG A;  3CRD A;  3CL3 A;  1D2Z B;  4JQW A;  4IZA B;  2IB1 A;  3KAT A;  1A1Z A;  4P4H A;  2LWD A;  4IZ5 E;  4NQK A;  2L6A A;  2NSN A;  2OF5 H;  2P1H A;  1YGO A;  1N3K A;  4P4H I;  2N97 A;  4E9M A;  4DWN A;  4O7Q A; 
#chains in the Genus database with same CATH topology
 4A2Q A;  4N1J A;  1WH4 A;  1FAD A;  2L9M A;  2YVI A;  1Z6T A;  2MS7 A;  2OF5 A;  4LWD A;  2DO9 A;  1ICH A;  4JUP A;  2BBZ A;  1E41 A;  2MJM A;  1UCP A;  2D96 A;  2HM2 Q;  2DBG A;  2KN6 A;  3EZQ A;  4F42 A;  3YGS C;  3YGS P;  1NGR A;  2BBR A;  2DBF A;  3EZQ B;  2MB9 A;  2LS7 A;  1PN5 A;  2N7Z A;  2M5V A;  4M9X A;  1E3Y A;  2F1S A;  2MS8 A;  4RHW E;  4O9L A;  2LWE A;  3J6J A;  3MOP G;  3QF2 A;  3LQQ A;  1A1W A;  4QOB A;  2A9I A;  1WXP A;  2MN4 A;  2NZ7 A;  4M9Z A;  2B1W A;  4F44 A;  4IZ7 B;  2N1F A;  1DGN A;  4RHW A;  4EWI A;  2VGQ A;  2YGS A;  4O9F A;  3LQR A;  2YQF A;  2N83 A;  2YU0 A;  3MOP A;  1D2Z A;  3MOP K;  4O6X A;  3T6P A;  2N80 A;  4M9S A;  1CY5 A;  2DBH A;  4ZBW A;  4FH0 A;  1DDF A;  2NAQ A;  2DBD A;  2XV9 A;  4N1K A;  2A5Y B;  2KM6 A;  2G7R A;  2N00 A;  4N1L A;  3J63 A;  4UZ0 A;  2O71 A;  1C15 A;  4D8O A;  1CWW A;  4I16 A;  2GF5 A;  4A2W A;  2MPC A;  1WMG A;  3CRD A;  3CL3 A;  1D2Z B;  4JQW A;  4IZA B;  2IB1 A;  3KAT A;  1A1Z A;  4P4H A;  2LWD A;  4IZ5 E;  4NQK A;  2L6A A;  2NSN A;  2OF5 H;  2P1H A;  1YGO A;  1N3K A;  4P4H I;  2N97 A;  4E9M A;  4DWN A;  4O7Q A; 
#chains in the Genus database with same CATH homology
 4A2Q A;  4N1J A;  1WH4 A;  1FAD A;  2L9M A;  2YVI A;  1Z6T A;  2MS7 A;  2OF5 A;  4LWD A;  2DO9 A;  1ICH A;  4JUP A;  2BBZ A;  1E41 A;  2MJM A;  1UCP A;  2D96 A;  2HM2 Q;  2DBG A;  2KN6 A;  3EZQ A;  4F42 A;  3YGS C;  3YGS P;  1NGR A;  2BBR A;  2DBF A;  3EZQ B;  2MB9 A;  2LS7 A;  1PN5 A;  2N7Z A;  2M5V A;  4M9X A;  1E3Y A;  2F1S A;  2MS8 A;  4RHW E;  4O9L A;  2LWE A;  3J6J A;  3MOP G;  3QF2 A;  3LQQ A;  1A1W A;  4QOB A;  2A9I A;  1WXP A;  2MN4 A;  2NZ7 A;  4M9Z A;  2B1W A;  4F44 A;  4IZ7 B;  2N1F A;  1DGN A;  4RHW A;  4EWI A;  2VGQ A;  2YGS A;  4O9F A;  3LQR A;  2YQF A;  2N83 A;  2YU0 A;  3MOP A;  1D2Z A;  3MOP K;  4O6X A;  3T6P A;  2N80 A;  4M9S A;  1CY5 A;  2DBH A;  4ZBW A;  4FH0 A;  1DDF A;  2NAQ A;  2DBD A;  2XV9 A;  4N1K A;  2A5Y B;  2KM6 A;  2G7R A;  2N00 A;  4N1L A;  3J63 A;  4UZ0 A;  2O71 A;  1C15 A;  4D8O A;  1CWW A;  4I16 A;  2GF5 A;  4A2W A;  2MPC A;  1WMG A;  3CRD A;  3CL3 A;  1D2Z B;  4JQW A;  4IZA B;  2IB1 A;  3KAT A;  1A1Z A;  4P4H A;  2LWD A;  4IZ5 E;  4NQK A;  2L6A A;  2NSN A;  2OF5 H;  2P1H A;  1YGO A;  1N3K A;  4P4H I;  2N97 A;  4E9M A;  4DWN A;  4O7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...