4IZAB

Structure of dually phosphorylated erk2 bound to the pea-15 death effector domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
GMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 40
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4izaB00
1D2ZB 3LQRA 2YVIA 2OF5A 2MB9A 3T6PA 4I16A 4N1LA 1NGRA 2BBRA 4IZ5E 2YGSA 1UCPA 3EZQA 2DBGA 1ICHA 4UZ0A 3YGSP 1A1WA 4RHWA 4N1JA 2N97A 2YU0A 4M9SA 2HM2Q 4E9MA 2N83A 3LQQA 4O6XA 2BBZA 2NSNA 4O7QA 4DWNA 1FADA 2KM6A 2NZ7A 3EZQB 1DDFA 2MS7A 2L6AA 4IZAB 3J6JA 4ZBWA 2G7RA 4A2QA 2YQFA 4O9LA 4EWIA 2NAQA 1Z6TA 4D8OA 2OF5H 1D2ZA 4P4HA 2N7ZA 4P4HI 2DBDA 3J63A 1A1ZA 3MOPG 2F1SA 1E41A 2VGQA 2P1HA 1N3KA 3KATA 3QF2A 2D96A 1YGOA 4N1KA 4A2WA 2A5YB 2O71A 1E3YA 2LWEA 2GF5A 3MOPA 4IZ7B 3CL3A 4M9XA 4QOBA 4FH0A 1CWWA 4LWDA 2DO9A 2KN6A 1WH4A 4NQKA 1DGNA 4O9FA 4JUPA 2MPCA 1CY5A 3CRDA 4M9ZA 4JQWA 1C15A 3YGSC 2N1FA 2LWDA 2N80A 2MS8A 2N00A 2LS7A 2MN4A 2DBHA 2M5VA 3MOPK 2L9MA 1WXPA 1WMGA 2DBFA 2IB1A 2A9IA 4F44A 4F42A 1PN5A 4RHWE 2B1WA
chains in the Genus database with same CATH superfamily
1D2ZB 3LQRA 2YVIA 2OF5A 2MB9A 3T6PA 4I16A 4N1LA 1NGRA 2BBRA 4IZ5E 2YGSA 1UCPA 2MJMA 3EZQA 2DBGA 1ICHA 4UZ0A 3YGSP 1A1WA 4RHWA 4N1JA 2N97A 2YU0A 4M9SA 2HM2Q 4E9MA 2N83A 3LQQA 4O6XA 2BBZA 2NSNA 4O7QA 4DWNA 1FADA 2KM6A 2NZ7A 2XV9A 3EZQB 1DDFA 2MS7A 2L6AA 4IZAB 3J6JA 4ZBWA 2G7RA 4A2QA 2YQFA 4O9LA 4EWIA 2NAQA 1Z6TA 4D8OA 2OF5H 1D2ZA 4P4HA 2N7ZA 4P4HI 2DBDA 3J63A 1A1ZA 3MOPG 2F1SA 1E41A 2VGQA 2P1HA 1N3KA 3KATA 3QF2A 2D96A 1YGOA 4N1KA 4A2WA 2A5YB 2O71A 1E3YA 2LWEA 2GF5A 3MOPA 4IZ7B 3CL3A 4M9XA 4QOBA 4FH0A 1CWWA 4LWDA 2DO9A 2KN6A 1WH4A 4NQKA 1DGNA 4O9FA 4JUPA 2MPCA 1CY5A 3CRDA 4M9ZA 4JQWA 1C15A 3YGSC 2N1FA 2LWDA 2N80A 2MS8A 2N00A 2LS7A 2MN4A 2DBHA 2M5VA 3MOPK 2L9MA 1WXPA 1WMGA 2DBFA 2IB1A 2A9IA 4F44A 4F42A 1PN5A 4RHWE 2B1WA
chains in the Genus database with same CATH topology
1D2ZB 3LQRA 2YVIA 2OF5A 2MB9A 3T6PA 4I16A 4N1LA 1NGRA 2BBRA 4IZ5E 2YGSA 1UCPA 2MJMA 3EZQA 2DBGA 1ICHA 4UZ0A 3YGSP 1A1WA 4RHWA 4N1JA 2N97A 2YU0A 4M9SA 2HM2Q 4E9MA 2N83A 3LQQA 4O6XA 2BBZA 2NSNA 4O7QA 4DWNA 1FADA 2KM6A 2NZ7A 2XV9A 3EZQB 1DDFA 2MS7A 2L6AA 4IZAB 3J6JA 4ZBWA 2G7RA 4A2QA 2YQFA 4O9LA 4EWIA 2NAQA 1Z6TA 4D8OA 2OF5H 1D2ZA 4P4HA 2N7ZA 4P4HI 2DBDA 3J63A 1A1ZA 3MOPG 2F1SA 1E41A 2VGQA 2P1HA 1N3KA 3KATA 3QF2A 2D96A 1YGOA 4N1KA 4A2WA 2A5YB 2O71A 1E3YA 2LWEA 2GF5A 3MOPA 4IZ7B 3CL3A 4M9XA 4QOBA 4FH0A 1CWWA 4LWDA 2DO9A 2KN6A 1WH4A 4NQKA 1DGNA 4O9FA 4JUPA 2MPCA 1CY5A 3CRDA 4M9ZA 4JQWA 1C15A 3YGSC 2N1FA 2LWDA 2N80A 2MS8A 2N00A 2LS7A 2MN4A 2DBHA 2M5VA 3MOPK 2L9MA 1WXPA 1WMGA 2DBFA 2IB1A 2A9IA 4F44A 4F42A 1PN5A 4RHWE 2B1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2Z B;  3LQR A;  2YVI A;  2OF5 A;  2MB9 A;  3T6P A;  4I16 A;  4N1L A;  1NGR A;  2BBR A;  4IZ5 E;  2YGS A;  1UCP A;  3EZQ A;  2DBG A;  1ICH A;  4UZ0 A;  3YGS P;  1A1W A;  4RHW A;  4N1J A;  2N97 A;  2YU0 A;  4M9S A;  2HM2 Q;  4E9M A;  2N83 A;  3LQQ A;  4O6X A;  2BBZ A;  2NSN A;  4O7Q A;  4DWN A;  1FAD A;  2KM6 A;  2NZ7 A;  3EZQ B;  1DDF A;  2MS7 A;  2L6A A;  4IZA B;  3J6J A;  4ZBW A;  2G7R A;  4A2Q A;  2YQF A;  4O9L A;  4EWI A;  2NAQ A;  1Z6T A;  4D8O A;  2OF5 H;  1D2Z A;  4P4H A;  2N7Z A;  4P4H I;  2DBD A;  3J63 A;  1A1Z A;  3MOP G;  2F1S A;  1E41 A;  2VGQ A;  2P1H A;  1N3K A;  3KAT A;  3QF2 A;  2D96 A;  1YGO A;  4N1K A;  4A2W A;  2A5Y B;  2O71 A;  1E3Y A;  2LWE A;  2GF5 A;  3MOP A;  4IZ7 B;  3CL3 A;  4M9X A;  4QOB A;  4FH0 A;  1CWW A;  4LWD A;  2DO9 A;  2KN6 A;  1WH4 A;  4NQK A;  1DGN A;  4O9F A;  4JUP A;  2MPC A;  1CY5 A;  3CRD A;  4M9Z A;  4JQW A;  1C15 A;  3YGS C;  2N1F A;  2LWD A;  2N80 A;  2MS8 A;  2N00 A;  2LS7 A;  2MN4 A;  2DBH A;  2M5V A;  3MOP K;  2L9M A;  1WXP A;  1WMG A;  2DBF A;  2IB1 A;  2A9I A;  4F44 A;  4F42 A;  1PN5 A;  4RHW E;  2B1W A; 
#chains in the Genus database with same CATH topology
 1D2Z B;  3LQR A;  2YVI A;  2OF5 A;  2MB9 A;  3T6P A;  4I16 A;  4N1L A;  1NGR A;  2BBR A;  4IZ5 E;  2YGS A;  1UCP A;  2MJM A;  3EZQ A;  2DBG A;  1ICH A;  4UZ0 A;  3YGS P;  1A1W A;  4RHW A;  4N1J A;  2N97 A;  2YU0 A;  4M9S A;  2HM2 Q;  4E9M A;  2N83 A;  3LQQ A;  4O6X A;  2BBZ A;  2NSN A;  4O7Q A;  4DWN A;  1FAD A;  2KM6 A;  2NZ7 A;  2XV9 A;  3EZQ B;  1DDF A;  2MS7 A;  2L6A A;  4IZA B;  3J6J A;  4ZBW A;  2G7R A;  4A2Q A;  2YQF A;  4O9L A;  4EWI A;  2NAQ A;  1Z6T A;  4D8O A;  2OF5 H;  1D2Z A;  4P4H A;  2N7Z A;  4P4H I;  2DBD A;  3J63 A;  1A1Z A;  3MOP G;  2F1S A;  1E41 A;  2VGQ A;  2P1H A;  1N3K A;  3KAT A;  3QF2 A;  2D96 A;  1YGO A;  4N1K A;  4A2W A;  2A5Y B;  2O71 A;  1E3Y A;  2LWE A;  2GF5 A;  3MOP A;  4IZ7 B;  3CL3 A;  4M9X A;  4QOB A;  4FH0 A;  1CWW A;  4LWD A;  2DO9 A;  2KN6 A;  1WH4 A;  4NQK A;  1DGN A;  4O9F A;  4JUP A;  2MPC A;  1CY5 A;  3CRD A;  4M9Z A;  4JQW A;  1C15 A;  3YGS C;  2N1F A;  2LWD A;  2N80 A;  2MS8 A;  2N00 A;  2LS7 A;  2MN4 A;  2DBH A;  2M5V A;  3MOP K;  2L9M A;  1WXP A;  1WMG A;  2DBF A;  2IB1 A;  2A9I A;  4F44 A;  4F42 A;  1PN5 A;  4RHW E;  2B1W A; 
#chains in the Genus database with same CATH homology
 1D2Z B;  3LQR A;  2YVI A;  2OF5 A;  2MB9 A;  3T6P A;  4I16 A;  4N1L A;  1NGR A;  2BBR A;  4IZ5 E;  2YGS A;  1UCP A;  2MJM A;  3EZQ A;  2DBG A;  1ICH A;  4UZ0 A;  3YGS P;  1A1W A;  4RHW A;  4N1J A;  2N97 A;  2YU0 A;  4M9S A;  2HM2 Q;  4E9M A;  2N83 A;  3LQQ A;  4O6X A;  2BBZ A;  2NSN A;  4O7Q A;  4DWN A;  1FAD A;  2KM6 A;  2NZ7 A;  2XV9 A;  3EZQ B;  1DDF A;  2MS7 A;  2L6A A;  4IZA B;  3J6J A;  4ZBW A;  2G7R A;  4A2Q A;  2YQF A;  4O9L A;  4EWI A;  2NAQ A;  1Z6T A;  4D8O A;  2OF5 H;  1D2Z A;  4P4H A;  2N7Z A;  4P4H I;  2DBD A;  3J63 A;  1A1Z A;  3MOP G;  2F1S A;  1E41 A;  2VGQ A;  2P1H A;  1N3K A;  3KAT A;  3QF2 A;  2D96 A;  1YGO A;  4N1K A;  4A2W A;  2A5Y B;  2O71 A;  1E3Y A;  2LWE A;  2GF5 A;  3MOP A;  4IZ7 B;  3CL3 A;  4M9X A;  4QOB A;  4FH0 A;  1CWW A;  4LWD A;  2DO9 A;  2KN6 A;  1WH4 A;  4NQK A;  1DGN A;  4O9F A;  4JUP A;  2MPC A;  1CY5 A;  3CRD A;  4M9Z A;  4JQW A;  1C15 A;  3YGS C;  2N1F A;  2LWD A;  2N80 A;  2MS8 A;  2N00 A;  2LS7 A;  2MN4 A;  2DBH A;  2M5V A;  3MOP K;  2L9M A;  1WXP A;  1WMG A;  2DBF A;  2IB1 A;  2A9I A;  4F44 A;  4F42 A;  1PN5 A;  4RHW E;  2B1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...