4O6XA

Crystal structure of human ankyrin g death domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
100
structure length
98
Chain Sequence
ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISRSFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Ankyrin G death domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin-3
total genus 40
structure length 98
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4o6xA00
4N1LA 4RHWE 3CL3A 2L6AA 4F44A 1ICHA 1DDFA 1PN5A 1Z6TA 2F1SA 1FADA 2MS7A 3MOPA 4F42A 3YGSP 2BBRA 4IZAB 2YVIA 4O9LA 1WH4A 2LS7A 2D96A 1NGRA 2DO9A 2IB1A 2MS8A 2HM2Q 2MPCA 2OF5A 4D8OA 2YGSA 4M9XA 1A1ZA 2NZ7A 2M5VA 2DBGA 4JUPA 4LWDA 4RHWA 2NSNA 2P1HA 2LWEA 1DGNA 1A1WA 4N1KA 3T6PA 2NAQA 4ZBWA 2DBFA 2A5YB 2KM6A 4A2WA 4P4HI 3EZQB 4IZ5E 1E41A 2N83A 3KATA 3CRDA 2DBDA 2YQFA 1YGOA 3QF2A 3MOPG 1UCPA 4DWNA 2MN4A 4IZ7B 2N7ZA 2N00A 1WMGA 3LQQA 2GF5A 2A9IA 2G7RA 4P4HA 2DBHA 3YGSC 1CY5A 2O71A 4E9MA 3LQRA 2LWDA 1WXPA 2N1FA 3MOPK 1E3YA 4UZ0A 1C15A 2L9MA 1N3KA 2OF5H 4A2QA 4JQWA 4O7QA 2KN6A 4EWIA 1CWWA 2B1WA 2YU0A 3EZQA 4QOBA 4N1JA 4M9SA 4O6XA 2MB9A 2N97A 4NQKA 4O9FA 4I16A 1D2ZA 3J6JA 2BBZA 4FH0A 3J63A 1D2ZB 2N80A 2VGQA 4M9ZA
chains in the Genus database with same CATH superfamily
4N1LA 4RHWE 3CL3A 2L6AA 4F44A 1ICHA 1DDFA 1PN5A 1Z6TA 2F1SA 1FADA 2MS7A 3MOPA 4F42A 3YGSP 2BBRA 4IZAB 2YVIA 4O9LA 1WH4A 2LS7A 2D96A 1NGRA 2DO9A 2IB1A 2MS8A 2HM2Q 2MPCA 2OF5A 4D8OA 2YGSA 4M9XA 1A1ZA 2NZ7A 2M5VA 2DBGA 4JUPA 4LWDA 4RHWA 2NSNA 2P1HA 2LWEA 1DGNA 1A1WA 4N1KA 3T6PA 2NAQA 2MJMA 4ZBWA 2DBFA 2A5YB 2KM6A 4A2WA 4P4HI 3EZQB 4IZ5E 1E41A 2N83A 3KATA 3CRDA 2DBDA 2YQFA 1YGOA 3QF2A 3MOPG 1UCPA 4DWNA 2MN4A 4IZ7B 2N7ZA 2N00A 1WMGA 3LQQA 2GF5A 2A9IA 2G7RA 4P4HA 2DBHA 3YGSC 1CY5A 2O71A 4E9MA 3LQRA 2LWDA 1WXPA 2N1FA 3MOPK 1E3YA 4UZ0A 1C15A 2L9MA 1N3KA 2OF5H 4A2QA 4JQWA 4O7QA 2KN6A 4EWIA 1CWWA 2B1WA 2YU0A 3EZQA 4QOBA 4N1JA 4M9SA 4O6XA 2MB9A 2N97A 4NQKA 4O9FA 4I16A 2XV9A 1D2ZA 3J6JA 2BBZA 4FH0A 3J63A 1D2ZB 2N80A 2VGQA 4M9ZA
chains in the Genus database with same CATH topology
4N1LA 4RHWE 3CL3A 2L6AA 4F44A 1ICHA 1DDFA 1PN5A 1Z6TA 2F1SA 1FADA 2MS7A 3MOPA 4F42A 3YGSP 2BBRA 4IZAB 2YVIA 4O9LA 1WH4A 2LS7A 2D96A 1NGRA 2DO9A 2IB1A 2MS8A 2HM2Q 2MPCA 2OF5A 4D8OA 2YGSA 4M9XA 1A1ZA 2NZ7A 2M5VA 2DBGA 4JUPA 4LWDA 4RHWA 2NSNA 2P1HA 2LWEA 1DGNA 1A1WA 4N1KA 3T6PA 2NAQA 2MJMA 4ZBWA 2DBFA 2A5YB 2KM6A 4A2WA 4P4HI 3EZQB 4IZ5E 1E41A 2N83A 3KATA 3CRDA 2DBDA 2YQFA 1YGOA 3QF2A 3MOPG 1UCPA 4DWNA 2MN4A 4IZ7B 2N7ZA 2N00A 1WMGA 3LQQA 2GF5A 2A9IA 2G7RA 4P4HA 2DBHA 3YGSC 1CY5A 2O71A 4E9MA 3LQRA 2LWDA 1WXPA 2N1FA 3MOPK 1E3YA 4UZ0A 1C15A 2L9MA 1N3KA 2OF5H 4A2QA 4JQWA 4O7QA 2KN6A 4EWIA 1CWWA 2B1WA 2YU0A 3EZQA 4QOBA 4N1JA 4M9SA 4O6XA 2MB9A 2N97A 4NQKA 4O9FA 4I16A 2XV9A 1D2ZA 3J6JA 2BBZA 4FH0A 3J63A 1D2ZB 2N80A 2VGQA 4M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1L A;  4RHW E;  3CL3 A;  2L6A A;  4F44 A;  1ICH A;  1DDF A;  1PN5 A;  1Z6T A;  2F1S A;  1FAD A;  2MS7 A;  3MOP A;  4F42 A;  3YGS P;  2BBR A;  4IZA B;  2YVI A;  4O9L A;  1WH4 A;  2LS7 A;  2D96 A;  1NGR A;  2DO9 A;  2IB1 A;  2MS8 A;  2HM2 Q;  2MPC A;  2OF5 A;  4D8O A;  2YGS A;  4M9X A;  1A1Z A;  2NZ7 A;  2M5V A;  2DBG A;  4JUP A;  4LWD A;  4RHW A;  2NSN A;  2P1H A;  2LWE A;  1DGN A;  1A1W A;  4N1K A;  3T6P A;  2NAQ A;  4ZBW A;  2DBF A;  2A5Y B;  2KM6 A;  4A2W A;  4P4H I;  3EZQ B;  4IZ5 E;  1E41 A;  2N83 A;  3KAT A;  3CRD A;  2DBD A;  2YQF A;  1YGO A;  3QF2 A;  3MOP G;  1UCP A;  4DWN A;  2MN4 A;  4IZ7 B;  2N7Z A;  2N00 A;  1WMG A;  3LQQ A;  2GF5 A;  2A9I A;  2G7R A;  4P4H A;  2DBH A;  3YGS C;  1CY5 A;  2O71 A;  4E9M A;  3LQR A;  2LWD A;  1WXP A;  2N1F A;  3MOP K;  1E3Y A;  4UZ0 A;  1C15 A;  2L9M A;  1N3K A;  2OF5 H;  4A2Q A;  4JQW A;  4O7Q A;  2KN6 A;  4EWI A;  1CWW A;  2B1W A;  2YU0 A;  3EZQ A;  4QOB A;  4N1J A;  4M9S A;  4O6X A;  2MB9 A;  2N97 A;  4NQK A;  4O9F A;  4I16 A;  1D2Z A;  3J6J A;  2BBZ A;  4FH0 A;  3J63 A;  1D2Z B;  2N80 A;  2VGQ A;  4M9Z A; 
#chains in the Genus database with same CATH topology
 4N1L A;  4RHW E;  3CL3 A;  2L6A A;  4F44 A;  1ICH A;  1DDF A;  1PN5 A;  1Z6T A;  2F1S A;  1FAD A;  2MS7 A;  3MOP A;  4F42 A;  3YGS P;  2BBR A;  4IZA B;  2YVI A;  4O9L A;  1WH4 A;  2LS7 A;  2D96 A;  1NGR A;  2DO9 A;  2IB1 A;  2MS8 A;  2HM2 Q;  2MPC A;  2OF5 A;  4D8O A;  2YGS A;  4M9X A;  1A1Z A;  2NZ7 A;  2M5V A;  2DBG A;  4JUP A;  4LWD A;  4RHW A;  2NSN A;  2P1H A;  2LWE A;  1DGN A;  1A1W A;  4N1K A;  3T6P A;  2NAQ A;  2MJM A;  4ZBW A;  2DBF A;  2A5Y B;  2KM6 A;  4A2W A;  4P4H I;  3EZQ B;  4IZ5 E;  1E41 A;  2N83 A;  3KAT A;  3CRD A;  2DBD A;  2YQF A;  1YGO A;  3QF2 A;  3MOP G;  1UCP A;  4DWN A;  2MN4 A;  4IZ7 B;  2N7Z A;  2N00 A;  1WMG A;  3LQQ A;  2GF5 A;  2A9I A;  2G7R A;  4P4H A;  2DBH A;  3YGS C;  1CY5 A;  2O71 A;  4E9M A;  3LQR A;  2LWD A;  1WXP A;  2N1F A;  3MOP K;  1E3Y A;  4UZ0 A;  1C15 A;  2L9M A;  1N3K A;  2OF5 H;  4A2Q A;  4JQW A;  4O7Q A;  2KN6 A;  4EWI A;  1CWW A;  2B1W A;  2YU0 A;  3EZQ A;  4QOB A;  4N1J A;  4M9S A;  4O6X A;  2MB9 A;  2N97 A;  4NQK A;  4O9F A;  4I16 A;  2XV9 A;  1D2Z A;  3J6J A;  2BBZ A;  4FH0 A;  3J63 A;  1D2Z B;  2N80 A;  2VGQ A;  4M9Z A; 
#chains in the Genus database with same CATH homology
 4N1L A;  4RHW E;  3CL3 A;  2L6A A;  4F44 A;  1ICH A;  1DDF A;  1PN5 A;  1Z6T A;  2F1S A;  1FAD A;  2MS7 A;  3MOP A;  4F42 A;  3YGS P;  2BBR A;  4IZA B;  2YVI A;  4O9L A;  1WH4 A;  2LS7 A;  2D96 A;  1NGR A;  2DO9 A;  2IB1 A;  2MS8 A;  2HM2 Q;  2MPC A;  2OF5 A;  4D8O A;  2YGS A;  4M9X A;  1A1Z A;  2NZ7 A;  2M5V A;  2DBG A;  4JUP A;  4LWD A;  4RHW A;  2NSN A;  2P1H A;  2LWE A;  1DGN A;  1A1W A;  4N1K A;  3T6P A;  2NAQ A;  2MJM A;  4ZBW A;  2DBF A;  2A5Y B;  2KM6 A;  4A2W A;  4P4H I;  3EZQ B;  4IZ5 E;  1E41 A;  2N83 A;  3KAT A;  3CRD A;  2DBD A;  2YQF A;  1YGO A;  3QF2 A;  3MOP G;  1UCP A;  4DWN A;  2MN4 A;  4IZ7 B;  2N7Z A;  2N00 A;  1WMG A;  3LQQ A;  2GF5 A;  2A9I A;  2G7R A;  4P4H A;  2DBH A;  3YGS C;  1CY5 A;  2O71 A;  4E9M A;  3LQR A;  2LWD A;  1WXP A;  2N1F A;  3MOP K;  1E3Y A;  4UZ0 A;  1C15 A;  2L9M A;  1N3K A;  2OF5 H;  4A2Q A;  4JQW A;  4O7Q A;  2KN6 A;  4EWI A;  1CWW A;  2B1W A;  2YU0 A;  3EZQ A;  4QOB A;  4N1J A;  4M9S A;  4O6X A;  2MB9 A;  2N97 A;  4NQK A;  4O9F A;  4I16 A;  2XV9 A;  1D2Z A;  3J6J A;  2BBZ A;  4FH0 A;  3J63 A;  1D2Z B;  2N80 A;  2VGQ A;  4M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...