2MB9A

Human bcl10 card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
EEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTREISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Architecture of the CARMA1/Bcl10/MALT1 Signalosome: Nucleation-Induced Filamentous Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords B-cell lymphoma/leukemia 10
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mb9A00
2N80A 2N1FA 2N97A 4IZAB 2DBGA 4F44A 4RHWA 3T6PA 2DBFA 3EZQA 4RHWE 4P4HI 2MB9A 4M9ZA 3QF2A 2NSNA 2O71A 1DDFA 2YU0A 2BBZA 2IB1A 2OF5A 4D8OA 1Z6TA 4N1LA 2L9MA 4IZ5E 1FADA 4IZ7B 3LQRA 2A5YB 3MOPG 2DBHA 1YGOA 1A1ZA 4EWIA 2B1WA 3EZQB 2MS7A 4F42A 2KM6A 4JQWA 3LQQA 2YVIA 4I16A 4A2QA 4A2WA 2NZ7A 2L6AA 1E41A 1WMGA 1WH4A 1ICHA 2N00A 4NQKA 4O6XA 2G7RA 1E3YA 4O9LA 2LS7A 2LWEA 2N83A 4M9XA 4QOBA 2MN4A 2DBDA 4O7QA 2OF5H 2VGQA 1D2ZA 1N3KA 2NAQA 3CL3A 1UCPA 3MOPK 3KATA 1DGNA 4UZ0A 4N1KA 1WXPA 4JUPA 1C15A 2GF5A 2F1SA 2N7ZA 2BBRA 1NGRA 1PN5A 1D2ZB 4M9SA 2DO9A 4FH0A 3YGSP 4DWNA 1CY5A 2KN6A 4O9FA 2A9IA 4N1JA 2MS8A 2D96A 2YGSA 2YQFA 2HM2Q 4ZBWA 4E9MA 1A1WA 2M5VA 4P4HA 1CWWA 4LWDA 2LWDA 3YGSC 3MOPA 3J6JA 2MPCA 3CRDA 2P1HA 3J63A
chains in the Genus database with same CATH superfamily
2N80A 2N1FA 2N97A 4IZAB 2DBGA 4F44A 4RHWA 3T6PA 2DBFA 3EZQA 4RHWE 4P4HI 2MB9A 4M9ZA 3QF2A 2NSNA 2O71A 1DDFA 2YU0A 2BBZA 2IB1A 2OF5A 2MJMA 4D8OA 1Z6TA 4N1LA 2L9MA 4IZ5E 1FADA 4IZ7B 3LQRA 2A5YB 3MOPG 2DBHA 1YGOA 1A1ZA 4EWIA 2B1WA 3EZQB 2MS7A 4F42A 2KM6A 4JQWA 3LQQA 2YVIA 4I16A 4A2QA 4A2WA 2NZ7A 2L6AA 1E41A 1WMGA 1WH4A 1ICHA 2XV9A 2N00A 4NQKA 4O6XA 2G7RA 1E3YA 4O9LA 2LS7A 2LWEA 2N83A 4M9XA 4QOBA 2MN4A 2DBDA 4O7QA 2OF5H 2VGQA 1D2ZA 1N3KA 2NAQA 3CL3A 1UCPA 3MOPK 3KATA 1DGNA 4UZ0A 4N1KA 1WXPA 4JUPA 1C15A 2GF5A 2F1SA 2N7ZA 2BBRA 1NGRA 1PN5A 1D2ZB 4M9SA 2DO9A 4FH0A 3YGSP 4DWNA 1CY5A 2KN6A 4O9FA 2A9IA 4N1JA 2MS8A 2D96A 2YGSA 2YQFA 2HM2Q 4ZBWA 4E9MA 1A1WA 2M5VA 4P4HA 1CWWA 4LWDA 2LWDA 3YGSC 3MOPA 3J6JA 2MPCA 3CRDA 2P1HA 3J63A
chains in the Genus database with same CATH topology
2N80A 2N1FA 2N97A 4IZAB 2DBGA 4F44A 4RHWA 3T6PA 2DBFA 3EZQA 4RHWE 4P4HI 2MB9A 4M9ZA 3QF2A 2NSNA 2O71A 1DDFA 2YU0A 2BBZA 2IB1A 2OF5A 2MJMA 4D8OA 1Z6TA 4N1LA 2L9MA 4IZ5E 1FADA 4IZ7B 3LQRA 2A5YB 3MOPG 2DBHA 1YGOA 1A1ZA 4EWIA 2B1WA 3EZQB 2MS7A 4F42A 2KM6A 4JQWA 3LQQA 2YVIA 4I16A 4A2QA 4A2WA 2NZ7A 2L6AA 1E41A 1WMGA 1WH4A 1ICHA 2XV9A 2N00A 4NQKA 4O6XA 2G7RA 1E3YA 4O9LA 2LS7A 2LWEA 2N83A 4M9XA 4QOBA 2MN4A 2DBDA 4O7QA 2OF5H 2VGQA 1D2ZA 1N3KA 2NAQA 3CL3A 1UCPA 3MOPK 3KATA 1DGNA 4UZ0A 4N1KA 1WXPA 4JUPA 1C15A 2GF5A 2F1SA 2N7ZA 2BBRA 1NGRA 1PN5A 1D2ZB 4M9SA 2DO9A 4FH0A 3YGSP 4DWNA 1CY5A 2KN6A 4O9FA 2A9IA 4N1JA 2MS8A 2D96A 2YGSA 2YQFA 2HM2Q 4ZBWA 4E9MA 1A1WA 2M5VA 4P4HA 1CWWA 4LWDA 2LWDA 3YGSC 3MOPA 3J6JA 2MPCA 3CRDA 2P1HA 3J63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N80 A;  2N1F A;  2N97 A;  4IZA B;  2DBG A;  4F44 A;  4RHW A;  3T6P A;  2DBF A;  3EZQ A;  4RHW E;  4P4H I;  2MB9 A;  4M9Z A;  3QF2 A;  2NSN A;  2O71 A;  1DDF A;  2YU0 A;  2BBZ A;  2IB1 A;  2OF5 A;  4D8O A;  1Z6T A;  4N1L A;  2L9M A;  4IZ5 E;  1FAD A;  4IZ7 B;  3LQR A;  2A5Y B;  3MOP G;  2DBH A;  1YGO A;  1A1Z A;  4EWI A;  2B1W A;  3EZQ B;  2MS7 A;  4F42 A;  2KM6 A;  4JQW A;  3LQQ A;  2YVI A;  4I16 A;  4A2Q A;  4A2W A;  2NZ7 A;  2L6A A;  1E41 A;  1WMG A;  1WH4 A;  1ICH A;  2N00 A;  4NQK A;  4O6X A;  2G7R A;  1E3Y A;  4O9L A;  2LS7 A;  2LWE A;  2N83 A;  4M9X A;  4QOB A;  2MN4 A;  2DBD A;  4O7Q A;  2OF5 H;  2VGQ A;  1D2Z A;  1N3K A;  2NAQ A;  3CL3 A;  1UCP A;  3MOP K;  3KAT A;  1DGN A;  4UZ0 A;  4N1K A;  1WXP A;  4JUP A;  1C15 A;  2GF5 A;  2F1S A;  2N7Z A;  2BBR A;  1NGR A;  1PN5 A;  1D2Z B;  4M9S A;  2DO9 A;  4FH0 A;  3YGS P;  4DWN A;  1CY5 A;  2KN6 A;  4O9F A;  2A9I A;  4N1J A;  2MS8 A;  2D96 A;  2YGS A;  2YQF A;  2HM2 Q;  4ZBW A;  4E9M A;  1A1W A;  2M5V A;  4P4H A;  1CWW A;  4LWD A;  2LWD A;  3YGS C;  3MOP A;  3J6J A;  2MPC A;  3CRD A;  2P1H A;  3J63 A; 
#chains in the Genus database with same CATH topology
 2N80 A;  2N1F A;  2N97 A;  4IZA B;  2DBG A;  4F44 A;  4RHW A;  3T6P A;  2DBF A;  3EZQ A;  4RHW E;  4P4H I;  2MB9 A;  4M9Z A;  3QF2 A;  2NSN A;  2O71 A;  1DDF A;  2YU0 A;  2BBZ A;  2IB1 A;  2OF5 A;  2MJM A;  4D8O A;  1Z6T A;  4N1L A;  2L9M A;  4IZ5 E;  1FAD A;  4IZ7 B;  3LQR A;  2A5Y B;  3MOP G;  2DBH A;  1YGO A;  1A1Z A;  4EWI A;  2B1W A;  3EZQ B;  2MS7 A;  4F42 A;  2KM6 A;  4JQW A;  3LQQ A;  2YVI A;  4I16 A;  4A2Q A;  4A2W A;  2NZ7 A;  2L6A A;  1E41 A;  1WMG A;  1WH4 A;  1ICH A;  2XV9 A;  2N00 A;  4NQK A;  4O6X A;  2G7R A;  1E3Y A;  4O9L A;  2LS7 A;  2LWE A;  2N83 A;  4M9X A;  4QOB A;  2MN4 A;  2DBD A;  4O7Q A;  2OF5 H;  2VGQ A;  1D2Z A;  1N3K A;  2NAQ A;  3CL3 A;  1UCP A;  3MOP K;  3KAT A;  1DGN A;  4UZ0 A;  4N1K A;  1WXP A;  4JUP A;  1C15 A;  2GF5 A;  2F1S A;  2N7Z A;  2BBR A;  1NGR A;  1PN5 A;  1D2Z B;  4M9S A;  2DO9 A;  4FH0 A;  3YGS P;  4DWN A;  1CY5 A;  2KN6 A;  4O9F A;  2A9I A;  4N1J A;  2MS8 A;  2D96 A;  2YGS A;  2YQF A;  2HM2 Q;  4ZBW A;  4E9M A;  1A1W A;  2M5V A;  4P4H A;  1CWW A;  4LWD A;  2LWD A;  3YGS C;  3MOP A;  3J6J A;  2MPC A;  3CRD A;  2P1H A;  3J63 A; 
#chains in the Genus database with same CATH homology
 2N80 A;  2N1F A;  2N97 A;  4IZA B;  2DBG A;  4F44 A;  4RHW A;  3T6P A;  2DBF A;  3EZQ A;  4RHW E;  4P4H I;  2MB9 A;  4M9Z A;  3QF2 A;  2NSN A;  2O71 A;  1DDF A;  2YU0 A;  2BBZ A;  2IB1 A;  2OF5 A;  2MJM A;  4D8O A;  1Z6T A;  4N1L A;  2L9M A;  4IZ5 E;  1FAD A;  4IZ7 B;  3LQR A;  2A5Y B;  3MOP G;  2DBH A;  1YGO A;  1A1Z A;  4EWI A;  2B1W A;  3EZQ B;  2MS7 A;  4F42 A;  2KM6 A;  4JQW A;  3LQQ A;  2YVI A;  4I16 A;  4A2Q A;  4A2W A;  2NZ7 A;  2L6A A;  1E41 A;  1WMG A;  1WH4 A;  1ICH A;  2XV9 A;  2N00 A;  4NQK A;  4O6X A;  2G7R A;  1E3Y A;  4O9L A;  2LS7 A;  2LWE A;  2N83 A;  4M9X A;  4QOB A;  2MN4 A;  2DBD A;  4O7Q A;  2OF5 H;  2VGQ A;  1D2Z A;  1N3K A;  2NAQ A;  3CL3 A;  1UCP A;  3MOP K;  3KAT A;  1DGN A;  4UZ0 A;  4N1K A;  1WXP A;  4JUP A;  1C15 A;  2GF5 A;  2F1S A;  2N7Z A;  2BBR A;  1NGR A;  1PN5 A;  1D2Z B;  4M9S A;  2DO9 A;  4FH0 A;  3YGS P;  4DWN A;  1CY5 A;  2KN6 A;  4O9F A;  2A9I A;  4N1J A;  2MS8 A;  2D96 A;  2YGS A;  2YQF A;  2HM2 Q;  4ZBW A;  4E9M A;  1A1W A;  2M5V A;  4P4H A;  1CWW A;  4LWD A;  2LWD A;  3YGS C;  3MOP A;  3J6J A;  2MPC A;  3CRD A;  2P1H A;  3J63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...