2MB9A

Human bcl10 card
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
EEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTREISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Architecture of the CARMA1/Bcl10/MALT1 Signalosome: Nucleation-Induced Filamentous Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords B-cell lymphoma/leukemia 10
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mb9A00
1C15A 4QOBA 4RHWA 2G7RA 2A9IA 4N1KA 4NQKA 1E3YA 2HM2Q 1WXPA 4O9FA 3MOPG 4FH0A 1A1WA 2LWEA 2B1WA 4EWIA 1YGOA 4M9ZA 2MS7A 2N97A 3KATA 2YVIA 4M9SA 2MB9A 1E41A 3MOPK 2N80A 2GF5A 1DGNA 1Z6TA 1NGRA 2F1SA 2IB1A 4O7QA 4N1JA 3EZQB 2KN6A 1UCPA 4IZ7B 1WH4A 4M9XA 2NZ7A 4P4HI 4I16A 3CRDA 2MS8A 3LQQA 3YGSC 4A2QA 4IZ5E 3QF2A 2DBGA 2O71A 2L6AA 1FADA 4N1LA 1N3KA 2LS7A 2YU0A 2YQFA 2OF5A 2DBHA 2L9MA 2DBDA 1ICHA 2OF5H 2P1HA 1WMGA 4UZ0A 2YGSA 4F44A 4JUPA 4O9LA 2LWDA 4P4HA 2N1FA 4DWNA 2NAQA 2MN4A 2A5YB 4O6XA 2NSNA 4D8OA 4IZAB 1CY5A 2VGQA 1PN5A 2DBFA 1DDFA 3EZQA 3J63A 4RHWE 2N83A 1D2ZB 2N00A 3MOPA 2N7ZA 1A1ZA 2D96A 4E9MA 4F42A 2BBRA 1CWWA 2DO9A 2MPCA 4ZBWA 1D2ZA 4A2WA 3J6JA 3CL3A 3LQRA 2BBZA 3T6PA 3YGSP 4LWDA 2M5VA 4JQWA 2KM6A
chains in the Genus database with same CATH superfamily
1C15A 4QOBA 4RHWA 2G7RA 2XV9A 2A9IA 4N1KA 4NQKA 1E3YA 2HM2Q 1WXPA 4O9FA 3MOPG 4FH0A 1A1WA 2LWEA 2B1WA 4EWIA 1YGOA 4M9ZA 2MS7A 2N97A 3KATA 2YVIA 4M9SA 2MB9A 1E41A 3MOPK 2N80A 2GF5A 1DGNA 1Z6TA 1NGRA 2F1SA 2IB1A 4O7QA 4N1JA 3EZQB 2KN6A 1UCPA 4IZ7B 1WH4A 4M9XA 2NZ7A 4P4HI 4I16A 3CRDA 2MJMA 2MS8A 3LQQA 3YGSC 4A2QA 4IZ5E 3QF2A 2DBGA 2O71A 2L6AA 1FADA 4N1LA 1N3KA 2LS7A 2YU0A 2YQFA 2OF5A 2DBHA 2L9MA 2DBDA 1ICHA 2OF5H 2P1HA 1WMGA 4UZ0A 2YGSA 4F44A 4JUPA 4O9LA 2LWDA 4P4HA 2N1FA 4DWNA 2NAQA 2MN4A 2A5YB 4O6XA 2NSNA 4D8OA 4IZAB 1CY5A 2VGQA 1PN5A 2DBFA 1DDFA 3EZQA 3J63A 4RHWE 2N83A 1D2ZB 2N00A 3MOPA 2N7ZA 1A1ZA 2D96A 4E9MA 4F42A 2BBRA 1CWWA 2DO9A 2MPCA 4ZBWA 1D2ZA 4A2WA 3J6JA 3CL3A 3LQRA 2BBZA 3T6PA 3YGSP 4LWDA 2M5VA 4JQWA 2KM6A
chains in the Genus database with same CATH topology
1C15A 4QOBA 4RHWA 2G7RA 2XV9A 2A9IA 4N1KA 4NQKA 1E3YA 2HM2Q 1WXPA 4O9FA 3MOPG 4FH0A 1A1WA 2LWEA 2B1WA 4EWIA 1YGOA 4M9ZA 2MS7A 2N97A 3KATA 2YVIA 4M9SA 2MB9A 1E41A 3MOPK 2N80A 2GF5A 1DGNA 1Z6TA 1NGRA 2F1SA 2IB1A 4O7QA 4N1JA 3EZQB 2KN6A 1UCPA 4IZ7B 1WH4A 4M9XA 2NZ7A 4P4HI 4I16A 3CRDA 2MJMA 2MS8A 3LQQA 3YGSC 4A2QA 4IZ5E 3QF2A 2DBGA 2O71A 2L6AA 1FADA 4N1LA 1N3KA 2LS7A 2YU0A 2YQFA 2OF5A 2DBHA 2L9MA 2DBDA 1ICHA 2OF5H 2P1HA 1WMGA 4UZ0A 2YGSA 4F44A 4JUPA 4O9LA 2LWDA 4P4HA 2N1FA 4DWNA 2NAQA 2MN4A 2A5YB 4O6XA 2NSNA 4D8OA 4IZAB 1CY5A 2VGQA 1PN5A 2DBFA 1DDFA 3EZQA 3J63A 4RHWE 2N83A 1D2ZB 2N00A 3MOPA 2N7ZA 1A1ZA 2D96A 4E9MA 4F42A 2BBRA 1CWWA 2DO9A 2MPCA 4ZBWA 1D2ZA 4A2WA 3J6JA 3CL3A 3LQRA 2BBZA 3T6PA 3YGSP 4LWDA 2M5VA 4JQWA 2KM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C15 A;  4QOB A;  4RHW A;  2G7R A;  2A9I A;  4N1K A;  4NQK A;  1E3Y A;  2HM2 Q;  1WXP A;  4O9F A;  3MOP G;  4FH0 A;  1A1W A;  2LWE A;  2B1W A;  4EWI A;  1YGO A;  4M9Z A;  2MS7 A;  2N97 A;  3KAT A;  2YVI A;  4M9S A;  2MB9 A;  1E41 A;  3MOP K;  2N80 A;  2GF5 A;  1DGN A;  1Z6T A;  1NGR A;  2F1S A;  2IB1 A;  4O7Q A;  4N1J A;  3EZQ B;  2KN6 A;  1UCP A;  4IZ7 B;  1WH4 A;  4M9X A;  2NZ7 A;  4P4H I;  4I16 A;  3CRD A;  2MS8 A;  3LQQ A;  3YGS C;  4A2Q A;  4IZ5 E;  3QF2 A;  2DBG A;  2O71 A;  2L6A A;  1FAD A;  4N1L A;  1N3K A;  2LS7 A;  2YU0 A;  2YQF A;  2OF5 A;  2DBH A;  2L9M A;  2DBD A;  1ICH A;  2OF5 H;  2P1H A;  1WMG A;  4UZ0 A;  2YGS A;  4F44 A;  4JUP A;  4O9L A;  2LWD A;  4P4H A;  2N1F A;  4DWN A;  2NAQ A;  2MN4 A;  2A5Y B;  4O6X A;  2NSN A;  4D8O A;  4IZA B;  1CY5 A;  2VGQ A;  1PN5 A;  2DBF A;  1DDF A;  3EZQ A;  3J63 A;  4RHW E;  2N83 A;  1D2Z B;  2N00 A;  3MOP A;  2N7Z A;  1A1Z A;  2D96 A;  4E9M A;  4F42 A;  2BBR A;  1CWW A;  2DO9 A;  2MPC A;  4ZBW A;  1D2Z A;  4A2W A;  3J6J A;  3CL3 A;  3LQR A;  2BBZ A;  3T6P A;  3YGS P;  4LWD A;  2M5V A;  4JQW A;  2KM6 A; 
#chains in the Genus database with same CATH topology
 1C15 A;  4QOB A;  4RHW A;  2G7R A;  2XV9 A;  2A9I A;  4N1K A;  4NQK A;  1E3Y A;  2HM2 Q;  1WXP A;  4O9F A;  3MOP G;  4FH0 A;  1A1W A;  2LWE A;  2B1W A;  4EWI A;  1YGO A;  4M9Z A;  2MS7 A;  2N97 A;  3KAT A;  2YVI A;  4M9S A;  2MB9 A;  1E41 A;  3MOP K;  2N80 A;  2GF5 A;  1DGN A;  1Z6T A;  1NGR A;  2F1S A;  2IB1 A;  4O7Q A;  4N1J A;  3EZQ B;  2KN6 A;  1UCP A;  4IZ7 B;  1WH4 A;  4M9X A;  2NZ7 A;  4P4H I;  4I16 A;  3CRD A;  2MJM A;  2MS8 A;  3LQQ A;  3YGS C;  4A2Q A;  4IZ5 E;  3QF2 A;  2DBG A;  2O71 A;  2L6A A;  1FAD A;  4N1L A;  1N3K A;  2LS7 A;  2YU0 A;  2YQF A;  2OF5 A;  2DBH A;  2L9M A;  2DBD A;  1ICH A;  2OF5 H;  2P1H A;  1WMG A;  4UZ0 A;  2YGS A;  4F44 A;  4JUP A;  4O9L A;  2LWD A;  4P4H A;  2N1F A;  4DWN A;  2NAQ A;  2MN4 A;  2A5Y B;  4O6X A;  2NSN A;  4D8O A;  4IZA B;  1CY5 A;  2VGQ A;  1PN5 A;  2DBF A;  1DDF A;  3EZQ A;  3J63 A;  4RHW E;  2N83 A;  1D2Z B;  2N00 A;  3MOP A;  2N7Z A;  1A1Z A;  2D96 A;  4E9M A;  4F42 A;  2BBR A;  1CWW A;  2DO9 A;  2MPC A;  4ZBW A;  1D2Z A;  4A2W A;  3J6J A;  3CL3 A;  3LQR A;  2BBZ A;  3T6P A;  3YGS P;  4LWD A;  2M5V A;  4JQW A;  2KM6 A; 
#chains in the Genus database with same CATH homology
 1C15 A;  4QOB A;  4RHW A;  2G7R A;  2XV9 A;  2A9I A;  4N1K A;  4NQK A;  1E3Y A;  2HM2 Q;  1WXP A;  4O9F A;  3MOP G;  4FH0 A;  1A1W A;  2LWE A;  2B1W A;  4EWI A;  1YGO A;  4M9Z A;  2MS7 A;  2N97 A;  3KAT A;  2YVI A;  4M9S A;  2MB9 A;  1E41 A;  3MOP K;  2N80 A;  2GF5 A;  1DGN A;  1Z6T A;  1NGR A;  2F1S A;  2IB1 A;  4O7Q A;  4N1J A;  3EZQ B;  2KN6 A;  1UCP A;  4IZ7 B;  1WH4 A;  4M9X A;  2NZ7 A;  4P4H I;  4I16 A;  3CRD A;  2MJM A;  2MS8 A;  3LQQ A;  3YGS C;  4A2Q A;  4IZ5 E;  3QF2 A;  2DBG A;  2O71 A;  2L6A A;  1FAD A;  4N1L A;  1N3K A;  2LS7 A;  2YU0 A;  2YQF A;  2OF5 A;  2DBH A;  2L9M A;  2DBD A;  1ICH A;  2OF5 H;  2P1H A;  1WMG A;  4UZ0 A;  2YGS A;  4F44 A;  4JUP A;  4O9L A;  2LWD A;  4P4H A;  2N1F A;  4DWN A;  2NAQ A;  2MN4 A;  2A5Y B;  4O6X A;  2NSN A;  4D8O A;  4IZA B;  1CY5 A;  2VGQ A;  1PN5 A;  2DBF A;  1DDF A;  3EZQ A;  3J63 A;  4RHW E;  2N83 A;  1D2Z B;  2N00 A;  3MOP A;  2N7Z A;  1A1Z A;  2D96 A;  4E9M A;  4F42 A;  2BBR A;  1CWW A;  2DO9 A;  2MPC A;  4ZBW A;  1D2Z A;  4A2W A;  3J6J A;  3CL3 A;  3LQR A;  2BBZ A;  3T6P A;  3YGS P;  4LWD A;  2M5V A;  4JQW A;  2KM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...