2NSNA

Crystal structure of caspace activation and recruitment domain (card) of nod1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
SHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Nod1 caspase activation and recruitment domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Caspase recruitment domain-containing protein 4
total genus 37
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2nsnA00
2P1HA 4A2QA 3LQRA 4UZ0A 4IZ7B 1PN5A 2LWEA 1Z6TA 2L9MA 1NGRA 2N1FA 3CRDA 2B1WA 2A5YB 1D2ZA 4O9LA 2GF5A 3J6JA 2KM6A 2A9IA 2DBFA 4RHWE 2N80A 2YGSA 4DWNA 2N97A 4P4HI 3MOPG 1YGOA 2HM2Q 1WMGA 2DBDA 1A1ZA 4EWIA 4IZ5E 1CWWA 2F1SA 2L6AA 2G7RA 4I16A 1CY5A 4NQKA 2MS8A 1FADA 4M9ZA 4O9FA 2IB1A 4E9MA 4A2WA 3CL3A 1E41A 2NZ7A 4O6XA 4F44A 3YGSP 1DGNA 2D96A 1WXPA 2MB9A 2NSNA 3MOPA 4M9XA 1WH4A 2MN4A 3J63A 2YVIA 2OF5H 3EZQA 3LQQA 2N83A 4O7QA 2DBHA 3EZQB 2N7ZA 4N1JA 4ZBWA 1A1WA 2BBZA 4FH0A 1N3KA 2M5VA 4N1KA 2LWDA 4LWDA 4N1LA 1E3YA 2N00A 3MOPK 1ICHA 1D2ZB 2KN6A 3KATA 3YGSC 3QF2A 4JQWA 2YU0A 2DBGA 4RHWA 4D8OA 2LS7A 1C15A 2OF5A 3T6PA 2NAQA 2MS7A 4P4HA 1UCPA 4IZAB 2VGQA 2DO9A 4F42A 4QOBA 2O71A 4M9SA 2YQFA 2MPCA 2BBRA 4JUPA 1DDFA
chains in the Genus database with same CATH superfamily
2P1HA 4A2QA 3LQRA 4UZ0A 4IZ7B 1PN5A 2LWEA 1Z6TA 2L9MA 1NGRA 2N1FA 3CRDA 2B1WA 2A5YB 1D2ZA 2MJMA 4O9LA 2GF5A 3J6JA 2KM6A 2A9IA 2DBFA 4RHWE 2N80A 2YGSA 4DWNA 2N97A 4P4HI 3MOPG 1YGOA 2HM2Q 1WMGA 2DBDA 1A1ZA 4EWIA 4IZ5E 1CWWA 2F1SA 2L6AA 2G7RA 4I16A 1CY5A 4NQKA 2MS8A 1FADA 4M9ZA 4O9FA 2IB1A 4E9MA 4A2WA 3CL3A 1E41A 2NZ7A 2XV9A 4O6XA 4F44A 3YGSP 1DGNA 2D96A 1WXPA 2MB9A 2NSNA 3MOPA 4M9XA 1WH4A 2MN4A 3J63A 2YVIA 2OF5H 3EZQA 3LQQA 2N83A 4O7QA 2DBHA 3EZQB 2N7ZA 4N1JA 4ZBWA 1A1WA 2BBZA 4FH0A 1N3KA 2M5VA 4N1KA 2LWDA 4LWDA 4N1LA 1E3YA 2N00A 3MOPK 1ICHA 1D2ZB 2KN6A 3KATA 3YGSC 3QF2A 4JQWA 2YU0A 2DBGA 4RHWA 4D8OA 2LS7A 1C15A 2OF5A 3T6PA 2NAQA 2MS7A 4P4HA 1UCPA 4IZAB 2VGQA 2DO9A 4F42A 4QOBA 2O71A 4M9SA 2YQFA 2MPCA 2BBRA 4JUPA 1DDFA
chains in the Genus database with same CATH topology
2P1HA 4A2QA 3LQRA 4UZ0A 4IZ7B 1PN5A 2LWEA 1Z6TA 2L9MA 1NGRA 2N1FA 3CRDA 2B1WA 2A5YB 1D2ZA 2MJMA 4O9LA 2GF5A 3J6JA 2KM6A 2A9IA 2DBFA 4RHWE 2N80A 2YGSA 4DWNA 2N97A 4P4HI 3MOPG 1YGOA 2HM2Q 1WMGA 2DBDA 1A1ZA 4EWIA 4IZ5E 1CWWA 2F1SA 2L6AA 2G7RA 4I16A 1CY5A 4NQKA 2MS8A 1FADA 4M9ZA 4O9FA 2IB1A 4E9MA 4A2WA 3CL3A 1E41A 2NZ7A 2XV9A 4O6XA 4F44A 3YGSP 1DGNA 2D96A 1WXPA 2MB9A 2NSNA 3MOPA 4M9XA 1WH4A 2MN4A 3J63A 2YVIA 2OF5H 3EZQA 3LQQA 2N83A 4O7QA 2DBHA 3EZQB 2N7ZA 4N1JA 4ZBWA 1A1WA 2BBZA 4FH0A 1N3KA 2M5VA 4N1KA 2LWDA 4LWDA 4N1LA 1E3YA 2N00A 3MOPK 1ICHA 1D2ZB 2KN6A 3KATA 3YGSC 3QF2A 4JQWA 2YU0A 2DBGA 4RHWA 4D8OA 2LS7A 1C15A 2OF5A 3T6PA 2NAQA 2MS7A 4P4HA 1UCPA 4IZAB 2VGQA 2DO9A 4F42A 4QOBA 2O71A 4M9SA 2YQFA 2MPCA 2BBRA 4JUPA 1DDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1H A;  4A2Q A;  3LQR A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2LWE A;  1Z6T A;  2L9M A;  1NGR A;  2N1F A;  3CRD A;  2B1W A;  2A5Y B;  1D2Z A;  4O9L A;  2GF5 A;  3J6J A;  2KM6 A;  2A9I A;  2DBF A;  4RHW E;  2N80 A;  2YGS A;  4DWN A;  2N97 A;  4P4H I;  3MOP G;  1YGO A;  2HM2 Q;  1WMG A;  2DBD A;  1A1Z A;  4EWI A;  4IZ5 E;  1CWW A;  2F1S A;  2L6A A;  2G7R A;  4I16 A;  1CY5 A;  4NQK A;  2MS8 A;  1FAD A;  4M9Z A;  4O9F A;  2IB1 A;  4E9M A;  4A2W A;  3CL3 A;  1E41 A;  2NZ7 A;  4O6X A;  4F44 A;  3YGS P;  1DGN A;  2D96 A;  1WXP A;  2MB9 A;  2NSN A;  3MOP A;  4M9X A;  1WH4 A;  2MN4 A;  3J63 A;  2YVI A;  2OF5 H;  3EZQ A;  3LQQ A;  2N83 A;  4O7Q A;  2DBH A;  3EZQ B;  2N7Z A;  4N1J A;  4ZBW A;  1A1W A;  2BBZ A;  4FH0 A;  1N3K A;  2M5V A;  4N1K A;  2LWD A;  4LWD A;  4N1L A;  1E3Y A;  2N00 A;  3MOP K;  1ICH A;  1D2Z B;  2KN6 A;  3KAT A;  3YGS C;  3QF2 A;  4JQW A;  2YU0 A;  2DBG A;  4RHW A;  4D8O A;  2LS7 A;  1C15 A;  2OF5 A;  3T6P A;  2NAQ A;  2MS7 A;  4P4H A;  1UCP A;  4IZA B;  2VGQ A;  2DO9 A;  4F42 A;  4QOB A;  2O71 A;  4M9S A;  2YQF A;  2MPC A;  2BBR A;  4JUP A;  1DDF A; 
#chains in the Genus database with same CATH topology
 2P1H A;  4A2Q A;  3LQR A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2LWE A;  1Z6T A;  2L9M A;  1NGR A;  2N1F A;  3CRD A;  2B1W A;  2A5Y B;  1D2Z A;  2MJM A;  4O9L A;  2GF5 A;  3J6J A;  2KM6 A;  2A9I A;  2DBF A;  4RHW E;  2N80 A;  2YGS A;  4DWN A;  2N97 A;  4P4H I;  3MOP G;  1YGO A;  2HM2 Q;  1WMG A;  2DBD A;  1A1Z A;  4EWI A;  4IZ5 E;  1CWW A;  2F1S A;  2L6A A;  2G7R A;  4I16 A;  1CY5 A;  4NQK A;  2MS8 A;  1FAD A;  4M9Z A;  4O9F A;  2IB1 A;  4E9M A;  4A2W A;  3CL3 A;  1E41 A;  2NZ7 A;  2XV9 A;  4O6X A;  4F44 A;  3YGS P;  1DGN A;  2D96 A;  1WXP A;  2MB9 A;  2NSN A;  3MOP A;  4M9X A;  1WH4 A;  2MN4 A;  3J63 A;  2YVI A;  2OF5 H;  3EZQ A;  3LQQ A;  2N83 A;  4O7Q A;  2DBH A;  3EZQ B;  2N7Z A;  4N1J A;  4ZBW A;  1A1W A;  2BBZ A;  4FH0 A;  1N3K A;  2M5V A;  4N1K A;  2LWD A;  4LWD A;  4N1L A;  1E3Y A;  2N00 A;  3MOP K;  1ICH A;  1D2Z B;  2KN6 A;  3KAT A;  3YGS C;  3QF2 A;  4JQW A;  2YU0 A;  2DBG A;  4RHW A;  4D8O A;  2LS7 A;  1C15 A;  2OF5 A;  3T6P A;  2NAQ A;  2MS7 A;  4P4H A;  1UCP A;  4IZA B;  2VGQ A;  2DO9 A;  4F42 A;  4QOB A;  2O71 A;  4M9S A;  2YQF A;  2MPC A;  2BBR A;  4JUP A;  1DDF A; 
#chains in the Genus database with same CATH homology
 2P1H A;  4A2Q A;  3LQR A;  4UZ0 A;  4IZ7 B;  1PN5 A;  2LWE A;  1Z6T A;  2L9M A;  1NGR A;  2N1F A;  3CRD A;  2B1W A;  2A5Y B;  1D2Z A;  2MJM A;  4O9L A;  2GF5 A;  3J6J A;  2KM6 A;  2A9I A;  2DBF A;  4RHW E;  2N80 A;  2YGS A;  4DWN A;  2N97 A;  4P4H I;  3MOP G;  1YGO A;  2HM2 Q;  1WMG A;  2DBD A;  1A1Z A;  4EWI A;  4IZ5 E;  1CWW A;  2F1S A;  2L6A A;  2G7R A;  4I16 A;  1CY5 A;  4NQK A;  2MS8 A;  1FAD A;  4M9Z A;  4O9F A;  2IB1 A;  4E9M A;  4A2W A;  3CL3 A;  1E41 A;  2NZ7 A;  2XV9 A;  4O6X A;  4F44 A;  3YGS P;  1DGN A;  2D96 A;  1WXP A;  2MB9 A;  2NSN A;  3MOP A;  4M9X A;  1WH4 A;  2MN4 A;  3J63 A;  2YVI A;  2OF5 H;  3EZQ A;  3LQQ A;  2N83 A;  4O7Q A;  2DBH A;  3EZQ B;  2N7Z A;  4N1J A;  4ZBW A;  1A1W A;  2BBZ A;  4FH0 A;  1N3K A;  2M5V A;  4N1K A;  2LWD A;  4LWD A;  4N1L A;  1E3Y A;  2N00 A;  3MOP K;  1ICH A;  1D2Z B;  2KN6 A;  3KAT A;  3YGS C;  3QF2 A;  4JQW A;  2YU0 A;  2DBG A;  4RHW A;  4D8O A;  2LS7 A;  1C15 A;  2OF5 A;  3T6P A;  2NAQ A;  2MS7 A;  4P4H A;  1UCP A;  4IZA B;  2VGQ A;  2DO9 A;  4F42 A;  4QOB A;  2O71 A;  4M9S A;  2YQF A;  2MPC A;  2BBR A;  4JUP A;  1DDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...