2BBZA

Crystal structure of mc159 reveals molecular mechanism of disc assembly and vflip inhibition
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
SDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCYAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MC159 reveals molecular mechanism of DISC assembly and FLIP inhibition.
pubmed doi rcsb
source organism Molluscum contagiosum virus subtype 1
molecule tags Viral protein
molecule keywords Viral CASP8 and FADD-like apoptosis regulator
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbzA02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbzA01
2D96A 4E9MA 4IZ5E 1E41A 1NGRA 4JQWA 2LWDA 4ZBWA 2L9MA 1YGOA 2N1FA 4A2WA 3MOPG 1N3KA 2LS7A 1Z6TA 4EWIA 2O71A 2GF5A 1CY5A 3EZQB 1WH4A 3CRDA 2VGQA 2YGSA 1DDFA 2NSNA 2OF5H 4RHWE 4N1KA 4JUPA 3J63A 2MPCA 4NQKA 2MN4A 2DBDA 4O7QA 4F42A 4O9LA 4UZ0A 2YQFA 2A9IA 4M9XA 2NZ7A 1DGNA 3YGSC 3MOPK 2P1HA 2MS8A 2N97A 3KATA 2YU0A 4DWNA 4O9FA 3J6JA 1A1ZA 4A2QA 2N80A 1E3YA 3LQQA 1CWWA 2B1WA 3MOPA 4LWDA 1WMGA 1PN5A 1UCPA 1ICHA 4FH0A 4N1JA 4M9ZA 3CL3A 2LWEA 2N00A 2IB1A 1FADA 2DBGA 3QF2A 4IZ7B 4RHWA 2BBRA 4D8OA 4F44A 2HM2Q 4I16A 2L6AA 4P4HI 2N83A 4N1LA 2DBFA 2G7RA 4IZAB 1D2ZA 2F1SA 4QOBA 3T6PA 1D2ZB 2M5VA 2KN6A 4P4HA 2BBZA 2N7ZA 2DBHA 2NAQA 4O6XA 2MS7A 2OF5A 3YGSP 2YVIA 2DO9A 3LQRA 3EZQA 2A5YB 2MB9A 4M9SA 2KM6A 1WXPA 1C15A 1A1WA
chains in the Genus database with same CATH superfamily
2D96A 4E9MA 4IZ5E 1E41A 1NGRA 4JQWA 2LWDA 4ZBWA 2L9MA 1YGOA 2N1FA 4A2WA 3MOPG 1N3KA 2LS7A 1Z6TA 4EWIA 2O71A 2GF5A 1CY5A 3EZQB 1WH4A 3CRDA 2VGQA 2YGSA 1DDFA 2NSNA 2OF5H 4RHWE 4N1KA 4JUPA 3J63A 2MPCA 4NQKA 2MN4A 2DBDA 4O7QA 4F42A 4O9LA 4UZ0A 2YQFA 2A9IA 4M9XA 2NZ7A 1DGNA 3YGSC 3MOPK 2P1HA 2MS8A 2N97A 3KATA 2YU0A 4DWNA 4O9FA 3J6JA 1A1ZA 4A2QA 2N80A 1E3YA 3LQQA 1CWWA 2B1WA 3MOPA 4LWDA 2XV9A 1WMGA 1PN5A 1UCPA 1ICHA 4FH0A 4N1JA 4M9ZA 2MJMA 3CL3A 2LWEA 2N00A 2IB1A 1FADA 2DBGA 3QF2A 4IZ7B 4RHWA 2BBRA 4D8OA 4F44A 2HM2Q 4I16A 2L6AA 4P4HI 2N83A 4N1LA 2DBFA 2G7RA 4IZAB 1D2ZA 2F1SA 4QOBA 3T6PA 1D2ZB 2M5VA 2KN6A 4P4HA 2BBZA 2N7ZA 2DBHA 2NAQA 4O6XA 2MS7A 2OF5A 3YGSP 2YVIA 2DO9A 3LQRA 3EZQA 2A5YB 2MB9A 4M9SA 2KM6A 1WXPA 1C15A 1A1WA
chains in the Genus database with same CATH topology
2D96A 4E9MA 4IZ5E 1E41A 1NGRA 4JQWA 2LWDA 4ZBWA 2L9MA 1YGOA 2N1FA 4A2WA 3MOPG 1N3KA 2LS7A 1Z6TA 4EWIA 2O71A 2GF5A 1CY5A 3EZQB 1WH4A 3CRDA 2VGQA 2YGSA 1DDFA 2NSNA 2OF5H 4RHWE 4N1KA 4JUPA 3J63A 2MPCA 4NQKA 2MN4A 2DBDA 4O7QA 4F42A 4O9LA 4UZ0A 2YQFA 2A9IA 4M9XA 2NZ7A 1DGNA 3YGSC 3MOPK 2P1HA 2MS8A 2N97A 3KATA 2YU0A 4DWNA 4O9FA 3J6JA 1A1ZA 4A2QA 2N80A 1E3YA 3LQQA 1CWWA 2B1WA 3MOPA 4LWDA 2XV9A 1WMGA 1PN5A 1UCPA 1ICHA 4FH0A 4N1JA 4M9ZA 2MJMA 3CL3A 2LWEA 2N00A 2IB1A 1FADA 2DBGA 3QF2A 4IZ7B 4RHWA 2BBRA 4D8OA 4F44A 2HM2Q 4I16A 2L6AA 4P4HI 2N83A 4N1LA 2DBFA 2G7RA 4IZAB 1D2ZA 2F1SA 4QOBA 3T6PA 1D2ZB 2M5VA 2KN6A 4P4HA 2BBZA 2N7ZA 2DBHA 2NAQA 4O6XA 2MS7A 2OF5A 3YGSP 2YVIA 2DO9A 3LQRA 3EZQA 2A5YB 2MB9A 4M9SA 2KM6A 1WXPA 1C15A 1A1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D96 A;  4E9M A;  4IZ5 E;  1E41 A;  1NGR A;  4JQW A;  2LWD A;  4ZBW A;  2L9M A;  1YGO A;  2N1F A;  4A2W A;  3MOP G;  1N3K A;  2LS7 A;  1Z6T A;  4EWI A;  2O71 A;  2GF5 A;  1CY5 A;  3EZQ B;  1WH4 A;  3CRD A;  2VGQ A;  2YGS A;  1DDF A;  2NSN A;  2OF5 H;  4RHW E;  4N1K A;  4JUP A;  3J63 A;  2MPC A;  4NQK A;  2MN4 A;  2DBD A;  4O7Q A;  4F42 A;  4O9L A;  4UZ0 A;  2YQF A;  2A9I A;  4M9X A;  2NZ7 A;  1DGN A;  3YGS C;  3MOP K;  2P1H A;  2MS8 A;  2N97 A;  3KAT A;  2YU0 A;  4DWN A;  4O9F A;  3J6J A;  1A1Z A;  4A2Q A;  2N80 A;  1E3Y A;  3LQQ A;  1CWW A;  2B1W A;  3MOP A;  4LWD A;  1WMG A;  1PN5 A;  1UCP A;  1ICH A;  4FH0 A;  4N1J A;  4M9Z A;  3CL3 A;  2LWE A;  2N00 A;  2IB1 A;  1FAD A;  2DBG A;  3QF2 A;  4IZ7 B;  4RHW A;  2BBR A;  4D8O A;  4F44 A;  2HM2 Q;  4I16 A;  2L6A A;  4P4H I;  2N83 A;  4N1L A;  2DBF A;  2G7R A;  4IZA B;  1D2Z A;  2F1S A;  4QOB A;  3T6P A;  1D2Z B;  2M5V A;  2KN6 A;  4P4H A;  2BBZ A;  2N7Z A;  2DBH A;  2NAQ A;  4O6X A;  2MS7 A;  2OF5 A;  3YGS P;  2YVI A;  2DO9 A;  3LQR A;  3EZQ A;  2A5Y B;  2MB9 A;  4M9S A;  2KM6 A;  1WXP A;  1C15 A;  1A1W A; 
#chains in the Genus database with same CATH topology
 2D96 A;  4E9M A;  4IZ5 E;  1E41 A;  1NGR A;  4JQW A;  2LWD A;  4ZBW A;  2L9M A;  1YGO A;  2N1F A;  4A2W A;  3MOP G;  1N3K A;  2LS7 A;  1Z6T A;  4EWI A;  2O71 A;  2GF5 A;  1CY5 A;  3EZQ B;  1WH4 A;  3CRD A;  2VGQ A;  2YGS A;  1DDF A;  2NSN A;  2OF5 H;  4RHW E;  4N1K A;  4JUP A;  3J63 A;  2MPC A;  4NQK A;  2MN4 A;  2DBD A;  4O7Q A;  4F42 A;  4O9L A;  4UZ0 A;  2YQF A;  2A9I A;  4M9X A;  2NZ7 A;  1DGN A;  3YGS C;  3MOP K;  2P1H A;  2MS8 A;  2N97 A;  3KAT A;  2YU0 A;  4DWN A;  4O9F A;  3J6J A;  1A1Z A;  4A2Q A;  2N80 A;  1E3Y A;  3LQQ A;  1CWW A;  2B1W A;  3MOP A;  4LWD A;  2XV9 A;  1WMG A;  1PN5 A;  1UCP A;  1ICH A;  4FH0 A;  4N1J A;  4M9Z A;  2MJM A;  3CL3 A;  2LWE A;  2N00 A;  2IB1 A;  1FAD A;  2DBG A;  3QF2 A;  4IZ7 B;  4RHW A;  2BBR A;  4D8O A;  4F44 A;  2HM2 Q;  4I16 A;  2L6A A;  4P4H I;  2N83 A;  4N1L A;  2DBF A;  2G7R A;  4IZA B;  1D2Z A;  2F1S A;  4QOB A;  3T6P A;  1D2Z B;  2M5V A;  2KN6 A;  4P4H A;  2BBZ A;  2N7Z A;  2DBH A;  2NAQ A;  4O6X A;  2MS7 A;  2OF5 A;  3YGS P;  2YVI A;  2DO9 A;  3LQR A;  3EZQ A;  2A5Y B;  2MB9 A;  4M9S A;  2KM6 A;  1WXP A;  1C15 A;  1A1W A; 
#chains in the Genus database with same CATH homology
 2D96 A;  4E9M A;  4IZ5 E;  1E41 A;  1NGR A;  4JQW A;  2LWD A;  4ZBW A;  2L9M A;  1YGO A;  2N1F A;  4A2W A;  3MOP G;  1N3K A;  2LS7 A;  1Z6T A;  4EWI A;  2O71 A;  2GF5 A;  1CY5 A;  3EZQ B;  1WH4 A;  3CRD A;  2VGQ A;  2YGS A;  1DDF A;  2NSN A;  2OF5 H;  4RHW E;  4N1K A;  4JUP A;  3J63 A;  2MPC A;  4NQK A;  2MN4 A;  2DBD A;  4O7Q A;  4F42 A;  4O9L A;  4UZ0 A;  2YQF A;  2A9I A;  4M9X A;  2NZ7 A;  1DGN A;  3YGS C;  3MOP K;  2P1H A;  2MS8 A;  2N97 A;  3KAT A;  2YU0 A;  4DWN A;  4O9F A;  3J6J A;  1A1Z A;  4A2Q A;  2N80 A;  1E3Y A;  3LQQ A;  1CWW A;  2B1W A;  3MOP A;  4LWD A;  2XV9 A;  1WMG A;  1PN5 A;  1UCP A;  1ICH A;  4FH0 A;  4N1J A;  4M9Z A;  2MJM A;  3CL3 A;  2LWE A;  2N00 A;  2IB1 A;  1FAD A;  2DBG A;  3QF2 A;  4IZ7 B;  4RHW A;  2BBR A;  4D8O A;  4F44 A;  2HM2 Q;  4I16 A;  2L6A A;  4P4H I;  2N83 A;  4N1L A;  2DBF A;  2G7R A;  4IZA B;  1D2Z A;  2F1S A;  4QOB A;  3T6P A;  1D2Z B;  2M5V A;  2KN6 A;  4P4H A;  2BBZ A;  2N7Z A;  2DBH A;  2NAQ A;  4O6X A;  2MS7 A;  2OF5 A;  3YGS P;  2YVI A;  2DO9 A;  3LQR A;  3EZQ A;  2A5Y B;  2MB9 A;  4M9S A;  2KM6 A;  1WXP A;  1C15 A;  1A1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...