2BBZA

Crystal structure of mc159 reveals molecular mechanism of disc assembly and vflip inhibition
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
SDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCYAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MC159 reveals molecular mechanism of DISC assembly and FLIP inhibition.
pubmed doi rcsb
source organism Molluscum contagiosum virus subtype 1
molecule tags Viral protein
molecule keywords Viral CASP8 and FADD-like apoptosis regulator
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbzA02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbzA01
4P4HA 2OF5H 4F44A 4M9SA 2DBHA 2YVIA 4NQKA 2N83A 3LQQA 4N1KA 1E3YA 4IZ7B 4A2QA 4M9ZA 1NGRA 3EZQB 2NSNA 2B1WA 1WXPA 3MOPK 1C15A 1WH4A 4D8OA 2DBGA 2F1SA 3KATA 2L6AA 1A1ZA 3J6JA 3T6PA 3YGSP 2IB1A 4I16A 3CL3A 3MOPA 3QF2A 2DO9A 2N97A 2HM2Q 3YGSC 2OF5A 2LWEA 1N3KA 1DDFA 2MPCA 2YQFA 4M9XA 2N80A 1A1WA 2DBDA 3J63A 4A2WA 1ICHA 4N1LA 1UCPA 4IZAB 4N1JA 1D2ZA 4RHWA 4O7QA 2O71A 2A9IA 4FH0A 2BBZA 2N1FA 2KN6A 2LWDA 2N00A 2NZ7A 3MOPG 2L9MA 1WMGA 2M5VA 4RHWE 4O6XA 2MS8A 4LWDA 2MB9A 4IZ5E 1DGNA 2GF5A 2YGSA 2MS7A 1PN5A 4F42A 3CRDA 4ZBWA 1CY5A 3LQRA 1E41A 2N7ZA 4P4HI 2YU0A 4EWIA 2P1HA 3EZQA 4JQWA 4JUPA 1D2ZB 1FADA 4E9MA 4O9FA 2DBFA 2KM6A 1Z6TA 2MN4A 4DWNA 1CWWA 2D96A 1YGOA 2VGQA 2G7RA 4QOBA 2LS7A 2NAQA 4UZ0A 4O9LA 2BBRA 2A5YB
chains in the Genus database with same CATH superfamily
4P4HA 2OF5H 4F44A 4M9SA 2DBHA 2YVIA 2XV9A 4NQKA 2N83A 3LQQA 4N1KA 1E3YA 4IZ7B 4A2QA 4M9ZA 1NGRA 3EZQB 2NSNA 2B1WA 1WXPA 3MOPK 1C15A 1WH4A 4D8OA 2DBGA 2F1SA 3KATA 2L6AA 1A1ZA 3J6JA 3T6PA 3YGSP 2IB1A 4I16A 3CL3A 3MOPA 3QF2A 2DO9A 2N97A 2HM2Q 3YGSC 2OF5A 2LWEA 1N3KA 1DDFA 2MPCA 2YQFA 4M9XA 2N80A 1A1WA 2DBDA 3J63A 4A2WA 1ICHA 4N1LA 1UCPA 4IZAB 4N1JA 1D2ZA 4RHWA 4O7QA 2O71A 2A9IA 4FH0A 2BBZA 2N1FA 2KN6A 2LWDA 2N00A 2NZ7A 3MOPG 2L9MA 1WMGA 2M5VA 4RHWE 4O6XA 2MS8A 4LWDA 2MB9A 2MJMA 4IZ5E 1DGNA 2GF5A 2YGSA 2MS7A 1PN5A 4F42A 3CRDA 4ZBWA 1CY5A 3LQRA 1E41A 2N7ZA 4P4HI 2YU0A 4EWIA 2P1HA 3EZQA 4JQWA 4JUPA 1D2ZB 1FADA 4E9MA 4O9FA 2DBFA 2KM6A 1Z6TA 2MN4A 4DWNA 1CWWA 2D96A 1YGOA 2VGQA 2G7RA 4QOBA 2LS7A 2NAQA 4UZ0A 4O9LA 2BBRA 2A5YB
chains in the Genus database with same CATH topology
4P4HA 2OF5H 4F44A 4M9SA 2DBHA 2YVIA 2XV9A 4NQKA 2N83A 3LQQA 4N1KA 1E3YA 4IZ7B 4A2QA 4M9ZA 1NGRA 3EZQB 2NSNA 2B1WA 1WXPA 3MOPK 1C15A 1WH4A 4D8OA 2DBGA 2F1SA 3KATA 2L6AA 1A1ZA 3J6JA 3T6PA 3YGSP 2IB1A 4I16A 3CL3A 3MOPA 3QF2A 2DO9A 2N97A 2HM2Q 3YGSC 2OF5A 2LWEA 1N3KA 1DDFA 2MPCA 2YQFA 4M9XA 2N80A 1A1WA 2DBDA 3J63A 4A2WA 1ICHA 4N1LA 1UCPA 4IZAB 4N1JA 1D2ZA 4RHWA 4O7QA 2O71A 2A9IA 4FH0A 2BBZA 2N1FA 2KN6A 2LWDA 2N00A 2NZ7A 3MOPG 2L9MA 1WMGA 2M5VA 4RHWE 4O6XA 2MS8A 4LWDA 2MB9A 2MJMA 4IZ5E 1DGNA 2GF5A 2YGSA 2MS7A 1PN5A 4F42A 3CRDA 4ZBWA 1CY5A 3LQRA 1E41A 2N7ZA 4P4HI 2YU0A 4EWIA 2P1HA 3EZQA 4JQWA 4JUPA 1D2ZB 1FADA 4E9MA 4O9FA 2DBFA 2KM6A 1Z6TA 2MN4A 4DWNA 1CWWA 2D96A 1YGOA 2VGQA 2G7RA 4QOBA 2LS7A 2NAQA 4UZ0A 4O9LA 2BBRA 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4H A;  2OF5 H;  4F44 A;  4M9S A;  2DBH A;  2YVI A;  4NQK A;  2N83 A;  3LQQ A;  4N1K A;  1E3Y A;  4IZ7 B;  4A2Q A;  4M9Z A;  1NGR A;  3EZQ B;  2NSN A;  2B1W A;  1WXP A;  3MOP K;  1C15 A;  1WH4 A;  4D8O A;  2DBG A;  2F1S A;  3KAT A;  2L6A A;  1A1Z A;  3J6J A;  3T6P A;  3YGS P;  2IB1 A;  4I16 A;  3CL3 A;  3MOP A;  3QF2 A;  2DO9 A;  2N97 A;  2HM2 Q;  3YGS C;  2OF5 A;  2LWE A;  1N3K A;  1DDF A;  2MPC A;  2YQF A;  4M9X A;  2N80 A;  1A1W A;  2DBD A;  3J63 A;  4A2W A;  1ICH A;  4N1L A;  1UCP A;  4IZA B;  4N1J A;  1D2Z A;  4RHW A;  4O7Q A;  2O71 A;  2A9I A;  4FH0 A;  2BBZ A;  2N1F A;  2KN6 A;  2LWD A;  2N00 A;  2NZ7 A;  3MOP G;  2L9M A;  1WMG A;  2M5V A;  4RHW E;  4O6X A;  2MS8 A;  4LWD A;  2MB9 A;  4IZ5 E;  1DGN A;  2GF5 A;  2YGS A;  2MS7 A;  1PN5 A;  4F42 A;  3CRD A;  4ZBW A;  1CY5 A;  3LQR A;  1E41 A;  2N7Z A;  4P4H I;  2YU0 A;  4EWI A;  2P1H A;  3EZQ A;  4JQW A;  4JUP A;  1D2Z B;  1FAD A;  4E9M A;  4O9F A;  2DBF A;  2KM6 A;  1Z6T A;  2MN4 A;  4DWN A;  1CWW A;  2D96 A;  1YGO A;  2VGQ A;  2G7R A;  4QOB A;  2LS7 A;  2NAQ A;  4UZ0 A;  4O9L A;  2BBR A;  2A5Y B; 
#chains in the Genus database with same CATH topology
 4P4H A;  2OF5 H;  4F44 A;  4M9S A;  2DBH A;  2YVI A;  2XV9 A;  4NQK A;  2N83 A;  3LQQ A;  4N1K A;  1E3Y A;  4IZ7 B;  4A2Q A;  4M9Z A;  1NGR A;  3EZQ B;  2NSN A;  2B1W A;  1WXP A;  3MOP K;  1C15 A;  1WH4 A;  4D8O A;  2DBG A;  2F1S A;  3KAT A;  2L6A A;  1A1Z A;  3J6J A;  3T6P A;  3YGS P;  2IB1 A;  4I16 A;  3CL3 A;  3MOP A;  3QF2 A;  2DO9 A;  2N97 A;  2HM2 Q;  3YGS C;  2OF5 A;  2LWE A;  1N3K A;  1DDF A;  2MPC A;  2YQF A;  4M9X A;  2N80 A;  1A1W A;  2DBD A;  3J63 A;  4A2W A;  1ICH A;  4N1L A;  1UCP A;  4IZA B;  4N1J A;  1D2Z A;  4RHW A;  4O7Q A;  2O71 A;  2A9I A;  4FH0 A;  2BBZ A;  2N1F A;  2KN6 A;  2LWD A;  2N00 A;  2NZ7 A;  3MOP G;  2L9M A;  1WMG A;  2M5V A;  4RHW E;  4O6X A;  2MS8 A;  4LWD A;  2MB9 A;  2MJM A;  4IZ5 E;  1DGN A;  2GF5 A;  2YGS A;  2MS7 A;  1PN5 A;  4F42 A;  3CRD A;  4ZBW A;  1CY5 A;  3LQR A;  1E41 A;  2N7Z A;  4P4H I;  2YU0 A;  4EWI A;  2P1H A;  3EZQ A;  4JQW A;  4JUP A;  1D2Z B;  1FAD A;  4E9M A;  4O9F A;  2DBF A;  2KM6 A;  1Z6T A;  2MN4 A;  4DWN A;  1CWW A;  2D96 A;  1YGO A;  2VGQ A;  2G7R A;  4QOB A;  2LS7 A;  2NAQ A;  4UZ0 A;  4O9L A;  2BBR A;  2A5Y B; 
#chains in the Genus database with same CATH homology
 4P4H A;  2OF5 H;  4F44 A;  4M9S A;  2DBH A;  2YVI A;  2XV9 A;  4NQK A;  2N83 A;  3LQQ A;  4N1K A;  1E3Y A;  4IZ7 B;  4A2Q A;  4M9Z A;  1NGR A;  3EZQ B;  2NSN A;  2B1W A;  1WXP A;  3MOP K;  1C15 A;  1WH4 A;  4D8O A;  2DBG A;  2F1S A;  3KAT A;  2L6A A;  1A1Z A;  3J6J A;  3T6P A;  3YGS P;  2IB1 A;  4I16 A;  3CL3 A;  3MOP A;  3QF2 A;  2DO9 A;  2N97 A;  2HM2 Q;  3YGS C;  2OF5 A;  2LWE A;  1N3K A;  1DDF A;  2MPC A;  2YQF A;  4M9X A;  2N80 A;  1A1W A;  2DBD A;  3J63 A;  4A2W A;  1ICH A;  4N1L A;  1UCP A;  4IZA B;  4N1J A;  1D2Z A;  4RHW A;  4O7Q A;  2O71 A;  2A9I A;  4FH0 A;  2BBZ A;  2N1F A;  2KN6 A;  2LWD A;  2N00 A;  2NZ7 A;  3MOP G;  2L9M A;  1WMG A;  2M5V A;  4RHW E;  4O6X A;  2MS8 A;  4LWD A;  2MB9 A;  2MJM A;  4IZ5 E;  1DGN A;  2GF5 A;  2YGS A;  2MS7 A;  1PN5 A;  4F42 A;  3CRD A;  4ZBW A;  1CY5 A;  3LQR A;  1E41 A;  2N7Z A;  4P4H I;  2YU0 A;  4EWI A;  2P1H A;  3EZQ A;  4JQW A;  4JUP A;  1D2Z B;  1FAD A;  4E9M A;  4O9F A;  2DBF A;  2KM6 A;  1Z6T A;  2MN4 A;  4DWN A;  1CWW A;  2D96 A;  1YGO A;  2VGQ A;  2G7R A;  4QOB A;  2LS7 A;  2NAQ A;  4UZ0 A;  4O9L A;  2BBR A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...