1CXWA

The second type ii module from human matrix metalloproteinase 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
TALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MATRIX METALLOPROTEINASE 2
publication title The second type II module from human matrix metalloproteinase 2: structure, function and dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 60
sequence length 60
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 1999-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1cxwA00
1KS0A 1J7MA 1E88A 1QO6A 1GXDA 1L6JA 1CK7A 1E8BA 3MQLA 1EAKA 1PDCA 2FN2A 2V5OA 1CXWA 1H8PA 3M7PA
chains in the Genus database with same CATH superfamily
1YU3A 3L26A 1E15A 4IBIA 4MB5A 1EAKA 5BPVA 2Y2HA 1OGGA 1H8PA 3KS4A 4NY2A 3WX7A 4OJ5A 1E88A 4NYYA 2D49A 4GH9A 2Y2LA 4MB3A 4OJPA 3L25A 4GHLA 2Y2JA 1PDCA 1H0GA 3L29A 4Z2LA 2IOUA 2Y2MA 3WD2A 2Y2PA 4NZ1A 3L27A 3KS8A 1E6ZA 2XD1A 3N3FA 2BG1A 2UWXA 3WD4A 4HMDA 4IJEA 4IBDA 1E8BA 1GOIA 3HONA 1UR8A 4OJ6A 2Y2GA 4OJOA 2Y2NA 3WD1A 3HSHA 4IBBA 2JE5A 4GHAA 4TX8A 1E6NA 2V5OA 4NZ3A 2XD5A 1O6IA 1QO6A 3L2AA 1W1VA 4Z2GA 4LG2A 1W1TA 4NYUA 3WD3A 3WD0A 4HMEA 4IBGA 1OGBA 3M7PA 2Y2KA 1H0IA 1E6RA 2Y2QA 4OJLA 3L28A 1J7MA 1W1PA 2Y2IA 1KS0A 1YU0A 1YU2A 4Z2JA 4QNLA 1UR9A 4Z2KA 2FN2A 1CXWA 4NZ4A 2Y2OA 1YU4A 1AIWA 2JCHA 4Z2HA 4OUIA 2FFFB 4HMCA 1CK7A 2RTSA 4Z2IA 4IJFA 4IBFA 4MB4A 1YUEA 4IBJA 1YU1A 1ED7A 1GXDA 3FKEA 1E6PA 1W1YA 4NZ5A 4IBEA 1L6JA 4IBKA 1GPFA 3MQLA 4IBCA
chains in the Genus database with same CATH topology
1KS0A 1J7MA 1E88A 1QO6A 1GXDA 1L6JA 1CK7A 1E8BA 3MQLA 1EAKA 1PDCA 2FN2A 2V5OA 1CXWA 1H8PA 3M7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KS0 A;  1J7M A;  1E88 A;  1QO6 A;  1GXD A;  1L6J A;  1CK7 A;  1E8B A;  3MQL A;  1EAK A;  1PDC A;  2FN2 A;  2V5O A;  1CXW A;  1H8P A;  3M7P A; 
#chains in the Genus database with same CATH topology
 1YU3 A;  3L26 A;  1E15 A;  4IBI A;  4MB5 A;  1EAK A;  5BPV A;  2Y2H A;  1OGG A;  1H8P A;  3KS4 A;  4NY2 A;  3WX7 A;  4OJ5 A;  1E88 A;  4NYY A;  2D49 A;  4GH9 A;  2Y2L A;  4MB3 A;  4OJP A;  3L25 A;  4GHL A;  2Y2J A;  1PDC A;  1H0G A;  3L29 A;  4Z2L A;  2IOU A;  2Y2M A;  3WD2 A;  2Y2P A;  4NZ1 A;  3L27 A;  3KS8 A;  1E6Z A;  2XD1 A;  3N3F A;  2BG1 A;  2UWX A;  3WD4 A;  4HMD A;  4IJE A;  4IBD A;  1E8B A;  1GOI A;  3HON A;  1UR8 A;  4OJ6 A;  2Y2G A;  4OJO A;  2Y2N A;  3WD1 A;  3HSH A;  4IBB A;  2JE5 A;  4GHA A;  4TX8 A;  1E6N A;  2V5O A;  4NZ3 A;  2XD5 A;  1O6I A;  1QO6 A;  3L2A A;  1W1V A;  4Z2G A;  4LG2 A;  1W1T A;  4NYU A;  3WD3 A;  3WD0 A;  4HME A;  4IBG A;  1OGB A;  3M7P A;  2Y2K A;  1H0I A;  1E6R A;  2Y2Q A;  4OJL A;  3L28 A;  1J7M A;  1W1P A;  2Y2I A;  1KS0 A;  1YU0 A;  1YU2 A;  4Z2J A;  4QNL A;  1UR9 A;  4Z2K A;  2FN2 A;  1CXW A;  4NZ4 A;  2Y2O A;  1YU4 A;  1AIW A;  2JCH A;  4Z2H A;  4OUI A;  2FFF B;  4HMC A;  1CK7 A;  2RTS A;  4Z2I A;  4IJF A;  4IBF A;  4MB4 A;  1YUE A;  4IBJ A;  1YU1 A;  1ED7 A;  1GXD A;  3FKE A;  1E6P A;  1W1Y A;  4NZ5 A;  4IBE A;  1L6J A;  4IBK A;  1GPF A;  3MQL A;  4IBC A; 
#chains in the Genus database with same CATH homology
 1KS0 A;  1J7M A;  1E88 A;  1QO6 A;  1GXD A;  1L6J A;  1CK7 A;  1E8B A;  3MQL A;  1EAK A;  1PDC A;  2FN2 A;  2V5O A;  1CXW A;  1H8P A;  3M7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...