1KS0A

The first fibronectin type ii module from human matrix metalloproteinase 2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The col-1 module of human matrix metalloproteinase-2 (MMP-2): structural/functional relatedness between gelatin-binding fibronectin type II modules and lysine-binding kringle domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Matrix Metalloproteinase 2
total genus 9
structure length 59
sequence length 59
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ks0A00
1E8BA 1H8PA 1E88A 1GXDA 1CXWA 1PDCA 1L6JA 1J7MA 3MQLA 3M7PA 1KS0A 1CK7A 1QO6A 1EAKA 2V5OA 2FN2A
chains in the Genus database with same CATH superfamily
4GHLA 1W1VA 2Y2IA 2BG1A 1E6ZA 4Z2LA 2XD1A 1J7MA 4NYYA 1OGGA 1GOIA 2Y2LA 1W1PA 2XD5A 3L26A 4OJ5A 1L6JA 1W1YA 3L2AA 4IBEA 4IJEA 2RTSA 3L25A 4NZ5A 1GXDA 4OJPA 1KS0A 4GH9A 4OUIA 4Z2JA 4NZ3A 2JE5A 4IBBA 4IJFA 4OJOA 4IBCA 1CXWA 4IBJA 1H0IA 2Y2MA 2IOUA 3WD4A 1AIWA 4TX8A 1YU2A 2FFFB 4MB5A 3L27A 4IBIA 1CK7A 3WD1A 4LG2A 1E8BA 3L28A 2Y2NA 2Y2JA 4IBDA 1W1TA 1ED7A 2Y2OA 4NY2A 3KS8A 1E6PA 1YUEA 1EAKA 2V5OA 1YU1A 4NYUA 2Y2HA 1PDCA 3MQLA 4HMCA 3M7PA 3WX7A 4MB3A 4GHAA 4NZ4A 2D49A 1OGBA 4NZ1A 3WD3A 1E88A 4HMDA 4IBFA 1UR8A 3KS4A 3WD2A 2UWXA 3WD0A 4HMEA 1QO6A 3FKEA 1O6IA 3L29A 4Z2KA 4Z2GA 2JCHA 4IBKA 5BPVA 1E6RA 1E15A 1YU0A 1E6NA 4QNLA 1YU3A 4Z2IA 1UR9A 1GPFA 2Y2GA 4MB4A 2Y2KA 3HSHA 4IBGA 2Y2QA 1H0GA 4Z2HA 4OJLA 1H8PA 3N3FA 4OJ6A 1YU4A 3HONA 2Y2PA 2FN2A
chains in the Genus database with same CATH topology
1E8BA 1H8PA 1E88A 1GXDA 1CXWA 1PDCA 1L6JA 1J7MA 3MQLA 3M7PA 1KS0A 1CK7A 1QO6A 1EAKA 2V5OA 2FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8B A;  1H8P A;  1E88 A;  1GXD A;  1CXW A;  1PDC A;  1L6J A;  1J7M A;  3MQL A;  3M7P A;  1KS0 A;  1CK7 A;  1QO6 A;  1EAK A;  2V5O A;  2FN2 A; 
#chains in the Genus database with same CATH topology
 4GHL A;  1W1V A;  2Y2I A;  2BG1 A;  1E6Z A;  4Z2L A;  2XD1 A;  1J7M A;  4NYY A;  1OGG A;  1GOI A;  2Y2L A;  1W1P A;  2XD5 A;  3L26 A;  4OJ5 A;  1L6J A;  1W1Y A;  3L2A A;  4IBE A;  4IJE A;  2RTS A;  3L25 A;  4NZ5 A;  1GXD A;  4OJP A;  1KS0 A;  4GH9 A;  4OUI A;  4Z2J A;  4NZ3 A;  2JE5 A;  4IBB A;  4IJF A;  4OJO A;  4IBC A;  1CXW A;  4IBJ A;  1H0I A;  2Y2M A;  2IOU A;  3WD4 A;  1AIW A;  4TX8 A;  1YU2 A;  2FFF B;  4MB5 A;  3L27 A;  4IBI A;  1CK7 A;  3WD1 A;  4LG2 A;  1E8B A;  3L28 A;  2Y2N A;  2Y2J A;  4IBD A;  1W1T A;  1ED7 A;  2Y2O A;  4NY2 A;  3KS8 A;  1E6P A;  1YUE A;  1EAK A;  2V5O A;  1YU1 A;  4NYU A;  2Y2H A;  1PDC A;  3MQL A;  4HMC A;  3M7P A;  3WX7 A;  4MB3 A;  4GHA A;  4NZ4 A;  2D49 A;  1OGB A;  4NZ1 A;  3WD3 A;  1E88 A;  4HMD A;  4IBF A;  1UR8 A;  3KS4 A;  3WD2 A;  2UWX A;  3WD0 A;  4HME A;  1QO6 A;  3FKE A;  1O6I A;  3L29 A;  4Z2K A;  4Z2G A;  2JCH A;  4IBK A;  5BPV A;  1E6R A;  1E15 A;  1YU0 A;  1E6N A;  4QNL A;  1YU3 A;  4Z2I A;  1UR9 A;  1GPF A;  2Y2G A;  4MB4 A;  2Y2K A;  3HSH A;  4IBG A;  2Y2Q A;  1H0G A;  4Z2H A;  4OJL A;  1H8P A;  3N3F A;  4OJ6 A;  1YU4 A;  3HON A;  2Y2P A;  2FN2 A; 
#chains in the Genus database with same CATH homology
 1E8B A;  1H8P A;  1E88 A;  1GXD A;  1CXW A;  1PDC A;  1L6J A;  1J7M A;  3MQL A;  3M7P A;  1KS0 A;  1CK7 A;  1QO6 A;  1EAK A;  2V5O A;  2FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...