1KS0A

The first fibronectin type ii module from human matrix metalloproteinase 2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix Metalloproteinase 2
publication title The col-1 module of human matrix metalloproteinase-2 (MMP-2): structural/functional relatedness between gelatin-binding fibronectin type II modules and lysine-binding kringle domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 9
structure length 59
sequence length 59
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ks0A00
2V5OA 1EAKA 1H8PA 3MQLA 1KS0A 1CXWA 1CK7A 1L6JA 3M7PA 1J7MA 1PDCA 1QO6A 1E88A 1E8BA 1GXDA 2FN2A
chains in the Genus database with same CATH superfamily
4QNLA 1CK7A 4NZ3A 1O6IA 2D49A 1E8BA 1E88A 4NYUA 2Y2JA 4IBBA 3WD1A 1YUEA 1W1VA 3KS8A 4MB4A 1ED7A 1GPFA 2XD1A 3WD3A 4Z2JA 1E6PA 3HONA 2JCHA 4NZ1A 2Y2MA 1W1TA 1H0IA 1YU3A 2Y2QA 2Y2HA 1H0GA 3L28A 2UWXA 4IBCA 1E6ZA 3WX7A 3MQLA 2Y2LA 3L29A 3WD0A 2IOUA 1GOIA 2Y2PA 1J7MA 2RTSA 5BPVA 4IJFA 3L25A 2Y2KA 4LG2A 4IJEA 4TX8A 1QO6A 2FFFB 4IBIA 1KS0A 2BG1A 4OJPA 4OUIA 3L26A 3KS4A 4GHAA 1CXWA 4Z2IA 4IBKA 4Z2HA 4NY2A 1GXDA 4GHLA 1YU0A 4NZ5A 3WD2A 3M7PA 4IBJA 4NYYA 2XD5A 4IBEA 3L2AA 2V5OA 3WD4A 4Z2GA 4IBFA 1PDCA 2Y2IA 1UR8A 1H8PA 1E6RA 4HMEA 4NZ4A 4IBGA 1OGBA 4GH9A 2FN2A 4MB3A 3N3FA 1E15A 1E6NA 1OGGA 3HSHA 1L6JA 1YU1A 1W1YA 4MB5A 4OJ6A 4Z2KA 2Y2GA 3L27A 2Y2OA 4IBDA 1YU4A 4OJOA 4Z2LA 1W1PA 4OJ5A 4HMDA 1YU2A 2Y2NA 1UR9A 1EAKA 1AIWA 3FKEA 4OJLA 2JE5A 4HMCA
chains in the Genus database with same CATH topology
2V5OA 1EAKA 1H8PA 3MQLA 1KS0A 1CXWA 1CK7A 1L6JA 3M7PA 1J7MA 1PDCA 1QO6A 1E88A 1E8BA 1GXDA 2FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5O A;  1EAK A;  1H8P A;  3MQL A;  1KS0 A;  1CXW A;  1CK7 A;  1L6J A;  3M7P A;  1J7M A;  1PDC A;  1QO6 A;  1E88 A;  1E8B A;  1GXD A;  2FN2 A; 
#chains in the Genus database with same CATH topology
 4QNL A;  1CK7 A;  4NZ3 A;  1O6I A;  2D49 A;  1E8B A;  1E88 A;  4NYU A;  2Y2J A;  4IBB A;  3WD1 A;  1YUE A;  1W1V A;  3KS8 A;  4MB4 A;  1ED7 A;  1GPF A;  2XD1 A;  3WD3 A;  4Z2J A;  1E6P A;  3HON A;  2JCH A;  4NZ1 A;  2Y2M A;  1W1T A;  1H0I A;  1YU3 A;  2Y2Q A;  2Y2H A;  1H0G A;  3L28 A;  2UWX A;  4IBC A;  1E6Z A;  3WX7 A;  3MQL A;  2Y2L A;  3L29 A;  3WD0 A;  2IOU A;  1GOI A;  2Y2P A;  1J7M A;  2RTS A;  5BPV A;  4IJF A;  3L25 A;  2Y2K A;  4LG2 A;  4IJE A;  4TX8 A;  1QO6 A;  2FFF B;  4IBI A;  1KS0 A;  2BG1 A;  4OJP A;  4OUI A;  3L26 A;  3KS4 A;  4GHA A;  1CXW A;  4Z2I A;  4IBK A;  4Z2H A;  4NY2 A;  1GXD A;  4GHL A;  1YU0 A;  4NZ5 A;  3WD2 A;  3M7P A;  4IBJ A;  4NYY A;  2XD5 A;  4IBE A;  3L2A A;  2V5O A;  3WD4 A;  4Z2G A;  4IBF A;  1PDC A;  2Y2I A;  1UR8 A;  1H8P A;  1E6R A;  4HME A;  4NZ4 A;  4IBG A;  1OGB A;  4GH9 A;  2FN2 A;  4MB3 A;  3N3F A;  1E15 A;  1E6N A;  1OGG A;  3HSH A;  1L6J A;  1YU1 A;  1W1Y A;  4MB5 A;  4OJ6 A;  4Z2K A;  2Y2G A;  3L27 A;  2Y2O A;  4IBD A;  1YU4 A;  4OJO A;  4Z2L A;  1W1P A;  4OJ5 A;  4HMD A;  1YU2 A;  2Y2N A;  1UR9 A;  1EAK A;  1AIW A;  3FKE A;  4OJL A;  2JE5 A;  4HMC A; 
#chains in the Genus database with same CATH homology
 2V5O A;  1EAK A;  1H8P A;  3MQL A;  1KS0 A;  1CXW A;  1CK7 A;  1L6J A;  3M7P A;  1J7M A;  1PDC A;  1QO6 A;  1E88 A;  1E8B A;  1GXD A;  2FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...