1KS0A

The first fibronectin type ii module from human matrix metalloproteinase 2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix Metalloproteinase 2
publication title The col-1 module of human matrix metalloproteinase-2 (MMP-2): structural/functional relatedness between gelatin-binding fibronectin type II modules and lysine-binding kringle domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 9
structure length 59
sequence length 59
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1ks0A00
1QO6A 1PDCA 1CK7A 3MQLA 3M7PA 1L6JA 1KS0A 1J7MA 2V5OA 1E88A 1H8PA 1GXDA 1CXWA 1E8BA 2FN2A 1EAKA
chains in the Genus database with same CATH superfamily
3L27A 1YU3A 2D49A 3KS8A 4IBGA 1O6IA 2JE5A 2Y2IA 1GOIA 2Y2QA 3N3FA 1ED7A 3WD2A 1GXDA 1E6RA 1PDCA 3KS4A 4Z2IA 4GH9A 4MB5A 3L28A 4Z2JA 2Y2LA 2JCHA 3MQLA 4Z2KA 4NYYA 4MB4A 2FFFB 4IJFA 4IBBA 4OJ5A 4NZ5A 1OGGA 3FKEA 1YU2A 2FN2A 3L2AA 2RTSA 2BG1A 1W1TA 1YU4A 4IBDA 1H8PA 1E8BA 2XD5A 4IBEA 1W1VA 5BPVA 1UR8A 2Y2HA 1E6NA 1W1PA 4OJLA 4HMCA 2Y2PA 4TX8A 4MB3A 4OJ6A 4HMDA 4IBCA 3WD1A 4NZ4A 1E6PA 1GPFA 2UWXA 4NY2A 4NZ3A 1YU0A 4HMEA 2Y2KA 4QNLA 1AIWA 2Y2JA 4IBJA 2XD1A 3HONA 4IBKA 1YUEA 3WD0A 1OGBA 4OJPA 4IBIA 1KS0A 4OUIA 4Z2LA 4GHAA 3L26A 1QO6A 1W1YA 1E15A 2V5OA 3L29A 1H0GA 1UR9A 4Z2HA 3HSHA 2Y2OA 2IOUA 2Y2MA 3WD4A 4NZ1A 4LG2A 1YU1A 1CXWA 1H0IA 1EAKA 1CK7A 4Z2GA 1L6JA 2Y2NA 4IJEA 4NYUA 1E6ZA 4GHLA 3M7PA 3WX7A 2Y2GA 3L25A 3WD3A 4OJOA 4IBFA 1J7MA 1E88A
chains in the Genus database with same CATH topology
1QO6A 1PDCA 1CK7A 3MQLA 3M7PA 1L6JA 1KS0A 1J7MA 2V5OA 1E88A 1H8PA 1GXDA 1CXWA 1E8BA 2FN2A 1EAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QO6 A;  1PDC A;  1CK7 A;  3MQL A;  3M7P A;  1L6J A;  1KS0 A;  1J7M A;  2V5O A;  1E88 A;  1H8P A;  1GXD A;  1CXW A;  1E8B A;  2FN2 A;  1EAK A; 
#chains in the Genus database with same CATH topology
 3L27 A;  1YU3 A;  2D49 A;  3KS8 A;  4IBG A;  1O6I A;  2JE5 A;  2Y2I A;  1GOI A;  2Y2Q A;  3N3F A;  1ED7 A;  3WD2 A;  1GXD A;  1E6R A;  1PDC A;  3KS4 A;  4Z2I A;  4GH9 A;  4MB5 A;  3L28 A;  4Z2J A;  2Y2L A;  2JCH A;  3MQL A;  4Z2K A;  4NYY A;  4MB4 A;  2FFF B;  4IJF A;  4IBB A;  4OJ5 A;  4NZ5 A;  1OGG A;  3FKE A;  1YU2 A;  2FN2 A;  3L2A A;  2RTS A;  2BG1 A;  1W1T A;  1YU4 A;  4IBD A;  1H8P A;  1E8B A;  2XD5 A;  4IBE A;  1W1V A;  5BPV A;  1UR8 A;  2Y2H A;  1E6N A;  1W1P A;  4OJL A;  4HMC A;  2Y2P A;  4TX8 A;  4MB3 A;  4OJ6 A;  4HMD A;  4IBC A;  3WD1 A;  4NZ4 A;  1E6P A;  1GPF A;  2UWX A;  4NY2 A;  4NZ3 A;  1YU0 A;  4HME A;  2Y2K A;  4QNL A;  1AIW A;  2Y2J A;  4IBJ A;  2XD1 A;  3HON A;  4IBK A;  1YUE A;  3WD0 A;  1OGB A;  4OJP A;  4IBI A;  1KS0 A;  4OUI A;  4Z2L A;  4GHA A;  3L26 A;  1QO6 A;  1W1Y A;  1E15 A;  2V5O A;  3L29 A;  1H0G A;  1UR9 A;  4Z2H A;  3HSH A;  2Y2O A;  2IOU A;  2Y2M A;  3WD4 A;  4NZ1 A;  4LG2 A;  1YU1 A;  1CXW A;  1H0I A;  1EAK A;  1CK7 A;  4Z2G A;  1L6J A;  2Y2N A;  4IJE A;  4NYU A;  1E6Z A;  4GHL A;  3M7P A;  3WX7 A;  2Y2G A;  3L25 A;  3WD3 A;  4OJO A;  4IBF A;  1J7M A;  1E88 A; 
#chains in the Genus database with same CATH homology
 1QO6 A;  1PDC A;  1CK7 A;  3MQL A;  3M7P A;  1L6J A;  1KS0 A;  1J7M A;  2V5O A;  1E88 A;  1H8P A;  1GXD A;  1CXW A;  1E8B A;  2FN2 A;  1EAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...