3KS4A

Crystal structure of reston ebolavirus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
KPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Viral protein, rna binding protein
total genus 42
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ks4A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3ks4A02
4GHAA 4IBBA 4IBGA 4IBCA 5BPVA 3FKEA 3L2AA 4IBJA 4GHLA 3KS8A 3L25A 4IBKA 3L26A 4IJEA 3L28A 4IJFA 4IBFA 3L29A 4IBDA 4LG2A 3KS4A 3L27A 4IBEA 4GH9A 4IBIA
chains in the Genus database with same CATH superfamily
1DGGA 2BG1A 3IG5A 3VKGA 4IBBA 3WD4A 2Y0TA 3H4MA 2UXCM 1WGLA 4KHPM 1NVMA 2Y2IA 1IN8A 4M9ZA 3R8FA 2YFQA 1D0KA 4IBJA 2MGWA 1P3QQ 4LRSA 1OQYA 5C18A 3J7AS 4LF4M 4W5WA 3RE8A 1YLAA 3MQLA 2R18A 4FCWA 1WJ7A 4YY3M 4MGYE 2YNMD 2XF3A 3E21A 2UUBM 3C3DA 1E6PA 3GQ5A 2BWEA 1W5SA 2Y2KA 4B3SM 2XFSA 2QQ8A 1VEGA 4MB5A 3HSHA 2APLA 1J09A 2CFOA 3CGWA 1J7MA 3U6SA 3QYBA 5EXSA 4NXNM 2WSEF 3SAVA 2L4FA 5ITYA 4FCVA 3SAUA 3J2PB 4IBEA 3DOAA 4MGZE 4AKIA 2R65A 1OIPA 2OOBA 1MU5A 4B3TM 1IN7A 4OJ6A 2LVPC 4XK8F 1VG5A 5FTMA 2CV1A 2LHCA 3BXWA 3FUVA 2L09A 4Q7JA 4B7GA 2FE8A 4PDGA 3L2AA 1N77A 1E6ZA 3EIEA 4OJ5A 1YSYA 4DBGB 2DWNA 1SXJD 4P17A 2OO9A 3KXEC 4IBKA 1W1TA 1K82A 2D49A 2Y2GA 5ITQA 3GRRA 4DV1M 4LFCM 1LTMA 1YE9A 1ZMVA 2MH8A 1TDHA 2Y0QA 4I5SA 4QNMA 1H0IA 1XMQM 3K9OA 2ZTCA 3GPUA 5DYGA 1E8BA 2QZ4A 1GPFA 4NZ3A 4B7HA 4NYUA 2DVWB 1DGHB 3U60A 3E9SA 4AZFA 3UJNA 3GLFA 3GPPA 3HX3A 1Z5CA 1K3XA 2JY8A 2XFTA 3U5ZB 2X8AA 1WGNA 4DV3M 4DUZM 3K9PA 2CV0A 3RFWA 1G3IA 3FUXA 2RTSA 1NY6A 3KW6A 4LFBM 4OJOA 1ED7A 3GLIB 4I4LA 3CF2A 4YHHM 1MJGM 5FTNA 1F4IA 1CK7A 4Z2KA 3GPYA 4LF6M 2V1CA 3M6AA 2VDBB 2VF7A 3DFZA 4LZJA 1T43A 3V76A 2FNAA 2J7OA 4IIWA 2JY7A 4LGMA 1N33M 4QOSA 2LVOC 1Z5AA 3SYLA 8CATA 1HNZM 3J27B 2KW0A 1CXWA 3HHWA 3Q8GA 4OVZA 2XSZA 1EFUB 1XXHE 3WD3A 3GLHA 1R7RA 3KSJA 1R2ZA 3KS4A 4X62M 3PVSA 1Q02A 1D0MA 2DAGA 2JA2A 3U6DA 1E15A 2FFFB 2Y2LA 3KOYE 2MR9A 4DV0M 2L4EA 2JZ0A 2C98A 1NHGC 2QSFX 3K2LA 3ZC7B 2DZOB 2L6OA 2O5RA 4X66M 4JI1M 2JE5A 3I01M 4AKGA 1L1ZA 3K1JA 4LJ8A 2X49A 4MGKE 1YU4A 1N78A 4EIWA 3E4RA 4XBOA 1W1YA 3U61A 1XHBA 2DZNB 3SMSA 1G71A 1K3WA 3SYKA 4B08A 1N36M 3UGJA 4GC9A 1PDCA 3T38A 1HNWM 3CF0A 1QDRA 4QNRA 4A3VB 2EA0A 4DR4M 1NJGA 5ITXE 2LTUA 4NC6A 2UXDM 2R4JA 3QYEA 3SFZA 1TH3A 1QZMA 2CHGA 1HR0M 4NRVA 3MJ5A 4MGHA 3WHKA 4OJLA 4PDIA 1GL7A 1LV7A 4OUIA 1TF0B 3B9PA 2Y21A 1XB2B 3BBZA 4I8OA 2EO2A 1IFYA 3GQ4A 1DGFA 2LVAA 4RNAA 1E94E 3SMPA 1H8PA 1NV9A 4ZPXA 1N75A 1Z59A 2Z4SA 3LVWA 3UMMA 1E32A 3RGPA 1MN3A 2CUZA 2R46A 2G8LA 2DAEA 3ILKA 3TWMA 4HL4A 3L28A 2QHOB 1FNNA 3U6CA 3U6EA 2BJWA 4IBFA 2Y2HA 2J7NA 5DYIA 2DHYA 1SXJA 2A5YB 1IBMM 2V5OA 4LG2A 4I81A 4DV7M 4NRWA 2JP7A 4Z2LA 1XXHA 2CHQA 1FJGM 4LRTA 1JB0F 2F4VM 3HHZA 4L78A 4D82A 1E9SA 2DENA 2JY6B 3TPZA 2HKJA 2ZANA 2ZBKB 1SXJC 1ZV1A 3D8BA 4CGYB 2QCUA 1QVRA 4LCBA 2F5SA 4GHLA 2LBCA 4PD2A 5DNYA 2O01F 2V6ZM 4QHSA 4KLNA 3KDSE 2Y2JA 3T6PA 2M60A 3J80S 1NJFA 1WIVA 2JWSA 3T1HM 3VK7A 2XEPA 2R62A 3C9PA 1TDZA 3Q8XA 2D7HA 2HAKA 1NV8A 1OAOC 5IT9S 1G41A 4WP2A 1G59A 3DZDA 5ITXA 3C3EA 4AKHA 2HCBA 1IXSB 1IY2A 4IBIA 1ZMWA 4ANRA 3TE6A 3HU2A 2DWMA 4L15A 2BWBA 4Z2IA 4GHAA 1VEKA 3D8LA 3AL0C 3PNYA 2UUCM 4OJPA 3LQRA 2XGNA 1RU3A 3W0FA 4JI5M 3WD2A 4JI7M 2CRUA 4FCTA 4K0KM 5KPZA 1O6IA 5ITTA 2DZLA 4PCZA 1IQPA 4LY6A 1OJLA 1BVSA 1PJQA 5IWAM 3SASA 1GO5A 2C96A 2HWJA 2R6FA 3R9XB 1DGHA 2O25A 1YUEA 3LMMA 3E46A 4FWDA 4G6ZA 4HMDA 2VF8A 3F92A 3U5ZA 2WZJA 3NBXX 4NL4H 5FTJA 2L7HA 4NXMM 3HY5A 2XH9A 2UU9M 3VLFB 1QO6A 3GLIA 1Y8GA 2LHGA 5E6JA 1TH2A 3ZQJA 2ZAOA 3MHVC 3FUUA 3JR4A 2EKKA 1KFVA 5ITRA 4AI6A 1OGGA 3AJIB 1C1KA 1L8QA 1AIPC 1NNUC 4RF0A 1ORYB 1V33A 2KZUA 2QBYB 2YQZA 3T15A 4G3OA 5KQDA 3L26A 1VEJA 2KRUA 4LGYA 1TTEA 1QZEA 2VIIA 4M0WA 4CIZA 2D7GA 4LF9M 4GRIA 2LVNC 4JI0M 3ZCBB 2JNHA 4FVMA 1KYIA 3PFIA 2ZAMA 2DXIA 3L29A 4MM3B 5LMNM 2XZFA 2AHMA 1L2CA 3GPXA 4D80A 2CWBA 3FRIA 4QHTA 1EIJA 2QP9X 3I4VA 3DA1A 3HHXA 3SAWA 1QDTA 4LZZA 2CE7A 2YR0A 3N3FA 2K0BX 4UN2B 3A45A 4GEWA 1UFZA 1IBKM 5L8RF 1X37A 4L6V6 1JR3E 4M9XA 3TWLA 1QUTA 1XNQM 5F3WA 1SG9A 1PJIA 3GRVA 5KO3A 1S3SA 1GABA 1KS0A 4S12A 2E5LM 1E6NA 3KSXA 1QYRA 2Y2MA 2P5TA 1AUAA 4HMEA 4II7A 3GLGE 3B7QA 4FD2A 4GMQA 4IJEA 4ITQA 4OW0A 2I7PA 3THGA 4JV5M 3LVVA 2XD1A 2EKFA 4IJFA 5JI3E 1OAIA 1Q39A 4FW9A 3KOXE 1XC8A 3J81S 2F5QA 1PM5A 1UM8A 4MGIE 4DR6M 1YU2A 4HLQA 3HJ8A 2OQ4A 4LJ5A 2R0IA 4JXJA 4OU7A 2G3QA 4GKJM 4TX8A 3UZUA 5GKNA 1YU0A 1L2BA 4RF1A 2HL7A 3B89A 2VQFM 2RGHA 4GITA 2DKLA 7CATA 1KSFX 4NYYA 2MROB 3GO8A 1J5EM 2DHRA 4JI3M 2UUAM 3FTCA 3HKPA 5EP4A 1Q3BA 4HMCA 1QAOA 1N34M 1GXDA 3SC3A 2CP8A 4TUWA 1AIWA 4NZ5A 5ITUA 1IY0A 3VDUA 4OX9M 4JI4M 3JR5A 1MX0A 1V92A 3SHFA 3U6QA 2LH0A 1OGBA 1GOIA 2C5RA 3GQ3A 3KFUG 3TQSA 2Z7JA 3M7GA 2XLJA 4NZ4A 1WXQA 2QNJA 2IOUA 1W5TA 4LF8M 2K47A 3SHGB 3HU3A 4NSOB 1HT2E 1E88A 5FSWA 3LCUA 1G4AE 3K92A 2ZM6M 2VQEM 1PGYA 4LJ7A 4MB7A 1PRBA 4P16A 3MMPA 2K9DA 1TGUA 1R4GA 1GKIA 4JI8M 3TL4X 3C58A 3WX7A 5EP1A 4IBCA 4L8RC 3FTEA 3U6PA 1OIZA 2XZUA 3FYDA 2F5NA 3KS8A 3PNVA 2MJ5B 4X65M 3FE3A 4GKKM 1R2YA 1I94M 1NSFA 3AFHA 4G4OA 2DAIA 1IBLM 1IN6A 2Y20A 2R44A 2EJSA 3FYCA 1UR9A 3EIHA 3JAMS 1L6JA 2JXNA 1OFIA 3FRHA 5E26A 3VDPA 2L2DA 1L2DA 3HGIA 3GLGB 3HJSA 2N35A 4L16A 3FTFA 3KOWE 1EE8A 1Q3CA 3FTDA 3HHYA 5DFLA 3KP0E 2WSFF 1NY5A 2Z3XA 1NNJA 4Z2HA 4AG5A 4G4RA 1IY1A 3FD9A 4FWHA 3I51A 1PJJA 2LNHC 4DV5M 5BPVA 2RKOA 3SARA 1VDLA 1R6BX 1HQYE 4GC5A 5H37D 2CV2A 4Z2JA 1ZAEA 3K8ZA 3QWLA 4REZA 1DGBA 3L25A 2ERCA 3AOEC 4JI2M 3IECA 3HU1A 2UXBM 1VQ1A 4FWGA 2I7NA 2R4EA 1V34A 1XWIA 1OTRA 3GLHE 5EQTA 3SATA 2B3TA 2W82A 4QOZC 3QAUA 2QENA 3M0EA 2JUJA 5LMUM 4DR3M 3U6LA 4KO8A 4IBDA 3AKZA 4DUYM 2HHHM 4CISA 1IM2A 2C99A 1ZMUA 1WR1B 2DNAA 3L27A 2CEAA 1EAKA 3VKHA 3RGSA 2Y2OA 1JR3D 2Z4RA 3M7PA 3WD1A 2WSCF 4BLCA 4LJ4A 3GP1A 2Y2PA 4QNLA 1T6OA 4JN6A 3A98B 1NHWC 1PJTA 2L7IA 2X4AA 3AOGA 2H1RA 4DR7M 4IBGA 3HWSA 2QBYA 1TR8A 3FKEA 1IXRC 5KQ8A 4Z6YA 1A5TA 4NSRA 4WURA 2NQ8C 4B7FA 3B7NA 4B3RM 5EXTA 4CJ6A 5FTKA 3CF6E 4MB4A 3I04M 1HNXM 4DV6M 1J7KA 2Y2QA 4B3MM 4X64M 4JYAM 4MB3A 2KNAA 4NZ1A 4DV4M 2DWLA 1DO0A 2FN2A 3T1YM 3B7ZA 4XGIA 1XMOM 1TH4A 2ZTDA 5JI2E 1GLNA 4NY2A 1PJSA 1Z5BA 1QANA 3U6OA 1W1VA 3U60B 4L4UA 3GLFB 4GIPA 1D2NA 2KHHA 1GJTA 2KNZA 3GRUA 2Q2EB 1WHCA 2XD5A 3BOSA 2FOIC 3LQQA 1ZQ9A 4LF5M 5EXXA 2JY5A 2QPAA 2C9OA 3A42A 1E9RA 2BJVA 2FS1A 3NWLA 4DR2M 4LJ6A 4AW4A 4JI6M 3W0LB 2V1UA 1GVNA 1HT1E 4R7GA 2F5PA 4M0DA 2FH0A 1E6RA 2KZSA 4NOOB 3ZH9B 5EXPA 1SXJE 4LFAM 2KRKA 2KNVA 2JZ1A 1W1PA 3W68A 1IN4A 3MK6A 5A2QS 1IN5A 2D7EA 5FTLA 1OKSA 3UK6A 4OVZB 5BR8M 1VDDA 2GQFA 3GLHB 4AG6A 1H0GA 1XNRM 3FUWA 4PT5A 4CHTB 4MH0E 1QUSA 2LVQD 5C1BA 1HJPA 3NBIA 2LXEA 2M5ZA 2OPFA 3CTWB 4LF7M 4BB9A 3HONA 4HEOA 4G4NA 4LJAA 3LW5F 3PXGA 3H4JA 3IG8A 2EUCA 1JQJC 4DV2M 4F1IA 2OOAA 1IXZA 3HZJA 3GRYA 3U61B 1CUKA 1QAMA 1GJSA 2CHVA 2Y2NA 4KT0F 4G4QA 3A46A 2UWXA 2DI0A 5KPTA 3KP1E 3VK8A 1QAQA 2KDLA 2FFJA 3IHPA 4R3DA 4R71A 1N32M 3W67A 3OTOM 1Z6TA 4Y28F 5KPRA 5EJCA 3J7BA 3I4YA 4M9SA 5EP3A 3VFDA 1G8PA 2JCHA 2BNKA 4LJ9A 4WW0A 3U6MA 3AV0A 1DV0A 2DAMA 3KVWA 3LCVB 4Z8XA 4DR1M 1L1TA 2F5OA 3FUTA 1I4WA 1OFHA 3SBJA 4F2LA 1HQCA 3HJQA 5IZ7D 5IREB 1C7YA 3KOZE 2R45A 1YU1A 1JR3A 2DAKA 2G5GX 2RGOA 2XSZD 4KODA 3TWKA 1QQWA 4DR5M 4BBAA 1T3TA 4D81A 4AQYM 1NO1A 2DWZB 4RKUF 5FLXS 2J5YA 2RRUA 3WHLA 1UR8A 3WD0A 4Z2GA 1GL6A 2C9CA 2KXEA 2H5XA 3GLGA 3GLFE 2KEBA 2K6BA 2GNOA 1YUBA 5EP2A 3GLIE 1YU3A 2KA6B 2Z8YM 1IXSA 3B74A 1SXJB 4GH9A 1D0LA 3AOEA 1DO2A 1H6UA 1XXHB 1R5LA 2LWXA
chains in the Genus database with same CATH topology
1DGGA 2BG1A 3IG5A 3VKGA 4IBBA 2Y0TA 3H4MA 2UXCM 4KHPM 1NVMA 2Y2IA 1IN8A 4M9ZA 3R8FA 2YFQA 4IBJA 3J7AS 4LRSA 5C18A 4LF4M 4W5WA 3RE8A 2R18A 4FCWA 4YY3M 2UUBM 4MGYE 2YNMD 2XF3A 3GQ5A 1W5SA 2Y2KA 4B3SM 2XFSA 3HSHA 1J09A 2CFOA 3U6SA 5EXSA 4NXNM 3SAVA 5ITYA 4FCVA 3SAUA 3J2PB 4IBEA 3DOAA 4MGZE 2R65A 1MU5A 4B3TM 1IN7A 4OJ6A 5FTMA 2CV1A 3FUVA 2L09A 4B7GA 2FE8A 4PDGA 3L2AA 1N77A 3EIEA 4OJ5A 1YSYA 2DWNA 1SXJD 3KXEC 4IBKA 1K82A 2Y2GA 5ITQA 3GRRA 4DV1M 4LFCM 1YE9A 4I5SA 4QNMA 1TDHA 2Y0QA 1XMQM 3GPUA 4NZ3A 5DYGA 2QZ4A 4B7HA 4NYUA 2DVWB 1DGHB 3U60A 3E9SA 4AZFA 3UJNA 3GLFA 3GPPA 1Z5CA 1K3XA 2XFTA 3U5ZB 2X8AA 4DV3M 4DUZM 2CV0A 3RFWA 1G3IA 3FUXA 4OJOA 1NY6A 3KW6A 4LFBM 3GLIB 4I4LA 3CF2A 4YHHM 5FTNA 3GPYA 4LF6M 2V1CA 3M6AA 3DFZA 4LZJA 2FNAA 2J7OA 4IIWA 4LGMA 1N33M 4QOSA 1Z5AA 3SYLA 8CATA 1HNZM 3J27B 2KW0A 3HHWA 4OVZA 2XSZA 3GLHA 1R7RA 3KSJA 1R2ZA 3KS4A 4X62M 3PVSA 2JA2A 3U6DA 2FFFB 2Y2LA 3KOYE 4DV0M 2C98A 1NHGC 3K2LA 3ZC7B 2JE5A 2DZOB 2L6OA 2O5RA 4X66M 4JI1M 4AKGA 1L1ZA 3K1JA 4LJ8A 2X49A 4MGKE 1YU4A 1N78A 4EIWA 3E4RA 4XBOA 3U61A 1XHBA 2DZNB 3SMSA 1K3WA 3SYKA 4B08A 1N36M 3UGJA 4GC9A 3T38A 3CF0A 4QNRA 4A3VB 2EA0A 4DR4M 1NJGA 5ITXE 2UXDM 2R4JA 3SFZA 1TH3A 1QZMA 2CHGA 1HR0M 4NRVA 3MJ5A 4MGHA 3WHKA 4OJLA 4PDIA 1GL7A 1LV7A 4OUIA 3B9PA 2Y21A 4I8OA 2EO2A 3GQ4A 1DGFA 4RNAA 1E94E 3SMPA 4ZPXA 1N75A 1Z59A 2Z4SA 3LVWA 3UMMA 1E32A 3RGPA 2CUZA 2R46A 2G8LA 3ILKA 3TWMA 4HL4A 3L28A 1FNNA 3U6CA 3U6EA 2BJWA 4IBFA 2Y2HA 2J7NA 5DYIA 1SXJA 2A5YB 1IBMM 4LG2A 4I81A 4DV7M 4NRWA 1XXHA 2CHQA 1FJGM 4LRTA 2F4VM 3HHZA 4L78A 4D82A 1E9SA 3TPZA 2HKJA 2ZANA 2ZBKB 1SXJC 3D8BA 4CGYB 2QCUA 1QVRA 4LCBA 2F5SA 4GHLA 4PD2A 5DNYA 2V6ZM 4QHSA 4KLNA 3KDSE 2Y2JA 2M60A 3J80S 1NJFA 3T1HM 3VK7A 2XEPA 2R62A 1TDZA 3Q8XA 2D7HA 5IT9S 1G41A 1G59A 3DZDA 5ITXA 4AKHA 2HCBA 1IXSB 1IY2A 4IBIA 3TE6A 3HU2A 2DWMA 4L15A 4GHAA 3D8LA 3AL0C 3PNYA 2UUCM 4OJPA 3LQRA 2XGNA 3W0FA 4JI5M 4JI7M 4FCTA 4K0KM 5KPZA 5ITTA 4PCZA 1IQPA 4LY6A 1OJLA 3SASA 5IWAM 2C96A 3R9XB 1DGHA 1YUEA 3LMMA 4FWDA 4G6ZA 3U5ZA 4NL4H 5FTJA 2L7HA 4NXMM 2XH9A 2UU9M 3VLFB 3GLIA 5E6JA 1TH2A 2ZAOA 3MHVC 3FUUA 3JR4A 1KFVA 5ITRA 4AI6A 3AJIB 1C1KA 1L8QA 1NNUC 4RF0A 1ORYB 2KZUA 2QBYB 2YQZA 3T15A 5KQDA 3L26A 2KRUA 4LGYA 2VIIA 4M0WA 2D7GA 4LF9M 4GRIA 3ZCBB 4JI0M 4FVMA 1KYIA 3PFIA 2ZAMA 2DXIA 3L29A 4MM3B 5LMNM 2XZFA 2AHMA 1L2CA 3GPXA 4D80A 4QHTA 2QP9X 3I4VA 3DA1A 3HHXA 3SAWA 4LZZA 2CE7A 2YR0A 3N3FA 3A45A 1IBKM 1X37A 4M9XA 3TWLA 1XNQM 5F3WA 1PJIA 3GRVA 5KO3A 1S3SA 4S12A 2E5LM 3KSXA 1QYRA 2Y2MA 2P5TA 4II7A 4FD2A 4GMQA 4IJEA 4ITQA 4OW0A 2I7PA 3THGA 4JV5M 3LVVA 2XD1A 4IJFA 5JI3E 1Q39A 4FW9A 3KOXE 1XC8A 3J81S 2F5QA 1PM5A 1UM8A 4MGIE 4DR6M 1YU2A 4HLQA 3HJ8A 2OQ4A 4LJ5A 4JXJA 4OU7A 4GKJM 3UZUA 5GKNA 1YU0A 1L2BA 4RF1A 2HL7A 2VQFM 2RGHA 4GITA 7CATA 1KSFX 4NYYA 1J5EM 3GO8A 2UUAM 2DHRA 4JI3M 3HKPA 3FTCA 5EP4A 1Q3BA 1QAOA 1N34M 3SC3A 4TUWA 4NZ5A 5ITUA 1IY0A 3VDUA 4OX9M 4JI4M 3JR5A 1MX0A 3U6QA 3SHFA 2LH0A 2C5RA 3GQ3A 3KFUG 3TQSA 2Z7JA 3M7GA 2XLJA 4NZ4A 1WXQA 2IOUA 1W5TA 4LF8M 2K47A 3SHGB 3HU3A 4NSOB 1HT2E 5FSWA 1G4AE 3K92A 2ZM6M 2VQEM 4LJ7A 4MB7A 4P16A 1TGUA 4JI8M 1GKIA 3WX7A 3TL4X 3C58A 5EP1A 4IBCA 4L8RC 3FTEA 3U6PA 2XZUA 3FYDA 2F5NA 3KS8A 3PNVA 4X65M 4GKKM 1R2YA 1I94M 1NSFA 3AFHA 4G4OA 1IBLM 1IN6A 2Y20A 3FYCA 3EIHA 3JAMS 1OFIA 5E26A 3VDPA 1L2DA 3HGIA 3GLGB 3HJSA 4L16A 3FTFA 3KOWE 1EE8A 1Q3CA 3FTDA 3HHYA 3KP0E 1NY5A 2Z3XA 1NNJA 4AG5A 4G4RA 1IY1A 3FD9A 4FWHA 3I51A 1PJJA 2LNHC 4DV5M 5BPVA 2RKOA 3SARA 1R6BX 1HQYE 4GC5A 5H37D 2CV2A 1ZAEA 3K8ZA 3QWLA 4REZA 1DGBA 3L25A 2ERCA 3AOEC 4JI2M 3HU1A 2UXBM 4FWGA 2I7NA 2R4EA 1XWIA 5EQTA 3SATA 2W82A 4QOZC 3QAUA 2QENA 3M0EA 5LMUM 4DR3M 3U6LA 4KO8A 4IBDA 3AKZA 4DUYM 2HHHM 4CISA 1IM2A 2C99A 3L27A 2CEAA 3VKHA 3RGSA 2Y2OA 1JR3D 2Z4RA 4BLCA 4LJ4A 3GP1A 2Y2PA 4QNLA 4JN6A 3A98B 1NHWC 4DR7M 2L7IA 2X4AA 3AOGA 2H1RA 4IBGA 3HWSA 2QBYA 3FKEA 1IXRC 5KQ8A 4Z6YA 4NSRA 4WURA 2NQ8C 4B7FA 4B3RM 5EXTA 5FTKA 3CF6E 1HNXM 4DV6M 1J7KA 2Y2QA 4B3MM 4X64M 4JYAM 4NZ1A 4DV4M 2DWLA 1DO0A 3T1YM 4XGIA 1XMOM 1TH4A 5JI2E 1GLNA 4NY2A 1Z5BA 1QANA 3U6OA 3U60B 4L4UA 3GLFB 4GIPA 1D2NA 3GRUA 2Q2EB 2XD5A 3BOSA 2FOIC 3LQQA 1ZQ9A 4LF5M 5EXXA 2QPAA 2C9OA 3A42A 1E9RA 2BJVA 3NWLA 4DR2M 1HNWM 4LJ6A 4AW4A 4JI6M 3W0LB 2V1UA 1GVNA 1HT1E 4R7GA 2F5PA 4M0DA 2KZSA 4NOOB 3ZH9B 5EXPA 1SXJE 4LFAM 2KRKA 1IN4A 3MK6A 5A2QS 1IN5A 2D7EA 5FTLA 3UK6A 4OVZB 5BR8M 1VDDA 3GLHB 4AG6A 1XNRM 3FUWA 4PT5A 4CHTB 4MH0E 5C1BA 3NBIA 2LXEA 2M5ZA 2OPFA 3CTWB 4LF7M 4BB9A 3HONA 4G4NA 4LJAA 3PXGA 3IG8A 2EUCA 1JQJC 4DV2M 1IXZA 3GRYA 3U61B 1QAMA 2CHVA 2Y2NA 4G4QA 3A46A 2UWXA 5KPTA 3KP1E 3VK8A 1QAQA 4R3DA 2FFJA 1N32M 3OTOM 1Z6TA 5KPRA 5EJCA 3J7BA 3I4YA 4M9SA 5EP3A 3VFDA 1G8PA 2JCHA 2BNKA 4LJ9A 4WW0A 3U6MA 3AV0A 3KVWA 4DR1M 4Z8XA 1L1TA 2F5OA 3FUTA 1I4WA 1OFHA 3SBJA 3HJQA 1HQCA 5IZ7D 5IREB 3KOZE 2R45A 1YU1A 1JR3A 2XSZD 2G5GX 2RGOA 4KODA 3TWKA 1QQWA 4DR5M 4BBAA 1T3TA 4D81A 4AQYM 2DWZB 5FLXS 3WHLA 1GL6A 2C9CA 2KXEA 3GLGA 2KEBA 1YUBA 5EP2A 1YU3A 2KA6B 1SXJB 4GH9A 3AOEA 1DO2A 1H6UA 1XXHB 4AKIA 2LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4IBB A;  4IBG A;  4IBC A;  5BPV A;  3FKE A;  3L2A A;  4IBJ A;  4GHL A;  3KS8 A;  3L25 A;  4IBK A;  3L26 A;  4IJE A;  3L28 A;  4IJF A;  4IBF A;  3L29 A;  4IBD A;  4LG2 A;  3KS4 A;  3L27 A;  4IBE A;  4GH9 A;  4IBI A; 
#chains in the Genus database with same CATH topology
 1DGG A;  2BG1 A;  3IG5 A;  3VKG A;  4IBB A;  3WD4 A;  2Y0T A;  3H4M A;  2UXC M;  1WGL A;  4KHP M;  1NVM A;  2Y2I A;  1IN8 A;  4M9Z A;  3R8F A;  2YFQ A;  1D0K A;  4IBJ A;  2MGW A;  1P3Q Q;  4LRS A;  1OQY A;  5C18 A;  3J7A S;  4LF4 M;  4W5W A;  3RE8 A;  1YLA A;  3MQL A;  2R18 A;  4FCW A;  1WJ7 A;  4YY3 M;  4MGY E;  2YNM D;  2XF3 A;  3E21 A;  2UUB M;  3C3D A;  1E6P A;  3GQ5 A;  2BWE A;  1W5S A;  2Y2K A;  4B3S M;  2XFS A;  2QQ8 A;  1VEG A;  4MB5 A;  3HSH A;  2APL A;  1J09 A;  2CFO A;  3CGW A;  1J7M A;  3U6S A;  3QYB A;  5EXS A;  4NXN M;  2WSE F;  3SAV A;  2L4F A;  5ITY A;  4FCV A;  3SAU A;  3J2P B;  4IBE A;  3DOA A;  4MGZ E;  4AKI A;  2R65 A;  1OIP A;  2OOB A;  1MU5 A;  4B3T M;  1IN7 A;  4OJ6 A;  2LVP C;  4XK8 F;  1VG5 A;  5FTM A;  2CV1 A;  2LHC A;  3BXW A;  3FUV A;  2L09 A;  4Q7J A;  4B7G A;  2FE8 A;  4PDG A;  3L2A A;  1N77 A;  1E6Z A;  3EIE A;  4OJ5 A;  1YSY A;  4DBG B;  2DWN A;  1SXJ D;  4P17 A;  2OO9 A;  3KXE C;  4IBK A;  1W1T A;  1K82 A;  2D49 A;  2Y2G A;  5ITQ A;  3GRR A;  4DV1 M;  4LFC M;  1LTM A;  1YE9 A;  1ZMV A;  2MH8 A;  1TDH A;  2Y0Q A;  4I5S A;  4QNM A;  1H0I A;  1XMQ M;  3K9O A;  2ZTC A;  3GPU A;  5DYG A;  1E8B A;  2QZ4 A;  1GPF A;  4NZ3 A;  4B7H A;  4NYU A;  2DVW B;  1DGH B;  3U60 A;  3E9S A;  4AZF A;  3UJN A;  3GLF A;  3GPP A;  3HX3 A;  1Z5C A;  1K3X A;  2JY8 A;  2XFT A;  3U5Z B;  2X8A A;  1WGN A;  4DV3 M;  4DUZ M;  3K9P A;  2CV0 A;  3RFW A;  1G3I A;  3FUX A;  2RTS A;  1NY6 A;  3KW6 A;  4LFB M;  4OJO A;  1ED7 A;  3GLI B;  4I4L A;  3CF2 A;  4YHH M;  1MJG M;  5FTN A;  1F4I A;  1CK7 A;  4Z2K A;  3GPY A;  4LF6 M;  2V1C A;  3M6A A;  2VDB B;  2VF7 A;  3DFZ A;  4LZJ A;  1T43 A;  3V76 A;  2FNA A;  2J7O A;  4IIW A;  2JY7 A;  4LGM A;  1N33 M;  4QOS A;  2LVO C;  1Z5A A;  3SYL A;  8CAT A;  1HNZ M;  3J27 B;  2KW0 A;  1CXW A;  3HHW A;  3Q8G A;  4OVZ A;  2XSZ A;  1EFU B;  1XXH E;  3WD3 A;  3GLH A;  1R7R A;  3KSJ A;  1R2Z A;  3KS4 A;  4X62 M;  3PVS A;  1Q02 A;  1D0M A;  2DAG A;  2JA2 A;  3U6D A;  1E15 A;  2FFF B;  2Y2L A;  3KOY E;  2MR9 A;  4DV0 M;  2L4E A;  2JZ0 A;  2C98 A;  1NHG C;  2QSF X;  3K2L A;  3ZC7 B;  2DZO B;  2L6O A;  2O5R A;  4X66 M;  4JI1 M;  2JE5 A;  3I01 M;  4AKG A;  1L1Z A;  3K1J A;  4LJ8 A;  2X49 A;  4MGK E;  1YU4 A;  1N78 A;  4EIW A;  3E4R A;  4XBO A;  1W1Y A;  3U61 A;  1XHB A;  2DZN B;  3SMS A;  1G71 A;  1K3W A;  3SYK A;  4B08 A;  1N36 M;  3UGJ A;  4GC9 A;  1PDC A;  3T38 A;  1HNW M;  3CF0 A;  1QDR A;  4QNR A;  4A3V B;  2EA0 A;  4DR4 M;  1NJG A;  5ITX E;  2LTU A;  4NC6 A;  2UXD M;  2R4J A;  3QYE A;  3SFZ A;  1TH3 A;  1QZM A;  2CHG A;  1HR0 M;  4NRV A;  3MJ5 A;  4MGH A;  3WHK A;  4OJL A;  4PDI A;  1GL7 A;  1LV7 A;  4OUI A;  1TF0 B;  3B9P A;  2Y21 A;  1XB2 B;  3BBZ A;  4I8O A;  2EO2 A;  1IFY A;  3GQ4 A;  1DGF A;  2LVA A;  4RNA A;  1E94 E;  3SMP A;  1H8P A;  1NV9 A;  4ZPX A;  1N75 A;  1Z59 A;  2Z4S A;  3LVW A;  3UMM A;  1E32 A;  3RGP A;  1MN3 A;  2CUZ A;  2R46 A;  2G8L A;  2DAE A;  3ILK A;  3TWM A;  4HL4 A;  3L28 A;  2QHO B;  1FNN A;  3U6C A;  3U6E A;  2BJW A;  4IBF A;  2Y2H A;  2J7N A;  5DYI A;  2DHY A;  1SXJ A;  2A5Y B;  1IBM M;  2V5O A;  4LG2 A;  4I81 A;  4DV7 M;  4NRW A;  2JP7 A;  4Z2L A;  1XXH A;  2CHQ A;  1FJG M;  4LRT A;  1JB0 F;  2F4V M;  3HHZ A;  4L78 A;  4D82 A;  1E9S A;  2DEN A;  2JY6 B;  3TPZ A;  2HKJ A;  2ZAN A;  2ZBK B;  1SXJ C;  1ZV1 A;  3D8B A;  4CGY B;  2QCU A;  1QVR A;  4LCB A;  2F5S A;  4GHL A;  2LBC A;  4PD2 A;  5DNY A;  2O01 F;  2V6Z M;  4QHS A;  4KLN A;  3KDS E;  2Y2J A;  3T6P A;  2M60 A;  3J80 S;  1NJF A;  1WIV A;  2JWS A;  3T1H M;  3VK7 A;  2XEP A;  2R62 A;  3C9P A;  1TDZ A;  3Q8X A;  2D7H A;  2HAK A;  1NV8 A;  1OAO C;  5IT9 S;  1G41 A;  4WP2 A;  1G59 A;  3DZD A;  5ITX A;  3C3E A;  4AKH A;  2HCB A;  1IXS B;  1IY2 A;  4IBI A;  1ZMW A;  4ANR A;  3TE6 A;  3HU2 A;  2DWM A;  4L15 A;  2BWB A;  4Z2I A;  4GHA A;  1VEK A;  3D8L A;  3AL0 C;  3PNY A;  2UUC M;  4OJP A;  3LQR A;  2XGN A;  1RU3 A;  3W0F A;  4JI5 M;  3WD2 A;  4JI7 M;  2CRU A;  4FCT A;  4K0K M;  5KPZ A;  1O6I A;  5ITT A;  2DZL A;  4PCZ A;  1IQP A;  4LY6 A;  1OJL A;  1BVS A;  1PJQ A;  5IWA M;  3SAS A;  1GO5 A;  2C96 A;  2HWJ A;  2R6F A;  3R9X B;  1DGH A;  2O25 A;  1YUE A;  3LMM A;  3E46 A;  4FWD A;  4G6Z A;  4HMD A;  2VF8 A;  3F92 A;  3U5Z A;  2WZJ A;  3NBX X;  4NL4 H;  5FTJ A;  2L7H A;  4NXM M;  3HY5 A;  2XH9 A;  2UU9 M;  3VLF B;  1QO6 A;  3GLI A;  1Y8G A;  2LHG A;  5E6J A;  1TH2 A;  3ZQJ A;  2ZAO A;  3MHV C;  3FUU A;  3JR4 A;  2EKK A;  1KFV A;  5ITR A;  4AI6 A;  1OGG A;  3AJI B;  1C1K A;  1L8Q A;  1AIP C;  1NNU C;  4RF0 A;  1ORY B;  1V33 A;  2KZU A;  2QBY B;  2YQZ A;  3T15 A;  4G3O A;  5KQD A;  3L26 A;  1VEJ A;  2KRU A;  4LGY A;  1TTE A;  1QZE A;  2VII A;  4M0W A;  4CIZ A;  2D7G A;  4LF9 M;  4GRI A;  2LVN C;  4JI0 M;  3ZCB B;  2JNH A;  4FVM A;  1KYI A;  3PFI A;  2ZAM A;  2DXI A;  3L29 A;  4MM3 B;  5LMN M;  2XZF A;  2AHM A;  1L2C A;  3GPX A;  4D80 A;  2CWB A;  3FRI A;  4QHT A;  1EIJ A;  2QP9 X;  3I4V A;  3DA1 A;  3HHX A;  3SAW A;  1QDT A;  4LZZ A;  2CE7 A;  2YR0 A;  3N3F A;  2K0B X;  4UN2 B;  3A45 A;  4GEW A;  1UFZ A;  1IBK M;  5L8R F;  1X37 A;  4L6V 6;  1JR3 E;  4M9X A;  3TWL A;  1QUT A;  1XNQ M;  5F3W A;  1SG9 A;  1PJI A;  3GRV A;  5KO3 A;  1S3S A;  1GAB A;  1KS0 A;  4S12 A;  2E5L M;  1E6N A;  3KSX A;  1QYR A;  2Y2M A;  2P5T A;  1AUA A;  4HME A;  4II7 A;  3GLG E;  3B7Q A;  4FD2 A;  4GMQ A;  4IJE A;  4ITQ A;  4OW0 A;  2I7P A;  3THG A;  4JV5 M;  3LVV A;  2XD1 A;  2EKF A;  4IJF A;  5JI3 E;  1OAI A;  1Q39 A;  4FW9 A;  3KOX E;  1XC8 A;  3J81 S;  2F5Q A;  1PM5 A;  1UM8 A;  4MGI E;  4DR6 M;  1YU2 A;  4HLQ A;  3HJ8 A;  2OQ4 A;  4LJ5 A;  2R0I A;  4JXJ A;  4OU7 A;  2G3Q A;  4GKJ M;  4TX8 A;  3UZU A;  5GKN A;  1YU0 A;  1L2B A;  4RF1 A;  2HL7 A;  3B89 A;  2VQF M;  2RGH A;  4GIT A;  2DKL A;  7CAT A;  1KSF X;  4NYY A;  2MRO B;  3GO8 A;  1J5E M;  2DHR A;  4JI3 M;  2UUA M;  3FTC A;  3HKP A;  5EP4 A;  1Q3B A;  4HMC A;  1QAO A;  1N34 M;  1GXD A;  3SC3 A;  2CP8 A;  4TUW A;  1AIW A;  4NZ5 A;  5ITU A;  1IY0 A;  3VDU A;  4OX9 M;  4JI4 M;  3JR5 A;  1MX0 A;  1V92 A;  3SHF A;  3U6Q A;  2LH0 A;  1OGB A;  1GOI A;  2C5R A;  3GQ3 A;  3KFU G;  3TQS A;  2Z7J A;  3M7G A;  2XLJ A;  4NZ4 A;  1WXQ A;  2QNJ A;  2IOU A;  1W5T A;  4LF8 M;  2K47 A;  3SHG B;  3HU3 A;  4NSO B;  1HT2 E;  1E88 A;  5FSW A;  3LCU A;  1G4A E;  3K92 A;  2ZM6 M;  2VQE M;  1PGY A;  4LJ7 A;  4MB7 A;  1PRB A;  4P16 A;  3MMP A;  2K9D A;  1TGU A;  1R4G A;  1GKI A;  4JI8 M;  3TL4 X;  3C58 A;  3WX7 A;  5EP1 A;  4IBC A;  4L8R C;  3FTE A;  3U6P A;  1OIZ A;  2XZU A;  3FYD A;  2F5N A;  3KS8 A;  3PNV A;  2MJ5 B;  4X65 M;  3FE3 A;  4GKK M;  1R2Y A;  1I94 M;  1NSF A;  3AFH A;  4G4O A;  2DAI A;  1IBL M;  1IN6 A;  2Y20 A;  2R44 A;  2EJS A;  3FYC A;  1UR9 A;  3EIH A;  3JAM S;  1L6J A;  2JXN A;  1OFI A;  3FRH A;  5E26 A;  3VDP A;  2L2D A;  1L2D A;  3HGI A;  3GLG B;  3HJS A;  2N35 A;  4L16 A;  3FTF A;  3KOW E;  1EE8 A;  1Q3C A;  3FTD A;  3HHY A;  5DFL A;  3KP0 E;  2WSF F;  1NY5 A;  2Z3X A;  1NNJ A;  4Z2H A;  4AG5 A;  4G4R A;  1IY1 A;  3FD9 A;  4FWH A;  3I51 A;  1PJJ A;  2LNH C;  4DV5 M;  5BPV A;  2RKO A;  3SAR A;  1VDL A;  1R6B X;  1HQY E;  4GC5 A;  5H37 D;  2CV2 A;  4Z2J A;  1ZAE A;  3K8Z A;  3QWL A;  4REZ A;  1DGB A;  3L25 A;  2ERC A;  3AOE C;  4JI2 M;  3IEC A;  3HU1 A;  2UXB M;  1VQ1 A;  4FWG A;  2I7N A;  2R4E A;  1V34 A;  1XWI A;  1OTR A;  3GLH E;  5EQT A;  3SAT A;  2B3T A;  2W82 A;  4QOZ C;  3QAU A;  2QEN A;  3M0E A;  2JUJ A;  5LMU M;  4DR3 M;  3U6L A;  4KO8 A;  4IBD A;  3AKZ A;  4DUY M;  2HHH M;  4CIS A;  1IM2 A;  2C99 A;  1ZMU A;  1WR1 B;  2DNA A;  3L27 A;  2CEA A;  1EAK A;  3VKH A;  3RGS A;  2Y2O A;  1JR3 D;  2Z4R A;  3M7P A;  3WD1 A;  2WSC F;  4BLC A;  4LJ4 A;  3GP1 A;  2Y2P A;  4QNL A;  1T6O A;  4JN6 A;  3A98 B;  1NHW C;  1PJT A;  2L7I A;  2X4A A;  3AOG A;  2H1R A;  4DR7 M;  4IBG A;  3HWS A;  2QBY A;  1TR8 A;  3FKE A;  1IXR C;  5KQ8 A;  4Z6Y A;  1A5T A;  4NSR A;  4WUR A;  2NQ8 C;  4B7F A;  3B7N A;  4B3R M;  5EXT A;  4CJ6 A;  5FTK A;  3CF6 E;  4MB4 A;  3I04 M;  1HNX M;  4DV6 M;  1J7K A;  2Y2Q A;  4B3M M;  4X64 M;  4JYA M;  4MB3 A;  2KNA A;  4NZ1 A;  4DV4 M;  2DWL A;  1DO0 A;  2FN2 A;  3T1Y M;  3B7Z A;  4XGI A;  1XMO M;  1TH4 A;  2ZTD A;  5JI2 E;  1GLN A;  4NY2 A;  1PJS A;  1Z5B A;  1QAN A;  3U6O A;  1W1V A;  3U60 B;  4L4U A;  3GLF B;  4GIP A;  1D2N A;  2KHH A;  1GJT A;  2KNZ A;  3GRU A;  2Q2E B;  1WHC A;  2XD5 A;  3BOS A;  2FOI C;  3LQQ A;  1ZQ9 A;  4LF5 M;  5EXX A;  2JY5 A;  2QPA A;  2C9O A;  3A42 A;  1E9R A;  2BJV A;  2FS1 A;  3NWL A;  4DR2 M;  4LJ6 A;  4AW4 A;  4JI6 M;  3W0L B;  2V1U A;  1GVN A;  1HT1 E;  4R7G A;  2F5P A;  4M0D A;  2FH0 A;  1E6R A;  2KZS A;  4NOO B;  3ZH9 B;  5EXP A;  1SXJ E;  4LFA M;  2KRK A;  2KNV A;  2JZ1 A;  1W1P A;  3W68 A;  1IN4 A;  3MK6 A;  5A2Q S;  1IN5 A;  2D7E A;  5FTL A;  1OKS A;  3UK6 A;  4OVZ B;  5BR8 M;  1VDD A;  2GQF A;  3GLH B;  4AG6 A;  1H0G A;  1XNR M;  3FUW A;  4PT5 A;  4CHT B;  4MH0 E;  1QUS A;  2LVQ D;  5C1B A;  1HJP A;  3NBI A;  2LXE A;  2M5Z A;  2OPF A;  3CTW B;  4LF7 M;  4BB9 A;  3HON A;  4HEO A;  4G4N A;  4LJA A;  3LW5 F;  3PXG A;  3H4J A;  3IG8 A;  2EUC A;  1JQJ C;  4DV2 M;  4F1I A;  2OOA A;  1IXZ A;  3HZJ A;  3GRY A;  3U61 B;  1CUK A;  1QAM A;  1GJS A;  2CHV A;  2Y2N A;  4KT0 F;  4G4Q A;  3A46 A;  2UWX A;  2DI0 A;  5KPT A;  3KP1 E;  3VK8 A;  1QAQ A;  2KDL A;  2FFJ A;  3IHP A;  4R3D A;  4R71 A;  1N32 M;  3W67 A;  3OTO M;  1Z6T A;  4Y28 F;  5KPR A;  5EJC A;  3J7B A;  3I4Y A;  4M9S A;  5EP3 A;  3VFD A;  1G8P A;  2JCH A;  2BNK A;  4LJ9 A;  4WW0 A;  3U6M A;  3AV0 A;  1DV0 A;  2DAM A;  3KVW A;  3LCV B;  4Z8X A;  4DR1 M;  1L1T A;  2F5O A;  3FUT A;  1I4W A;  1OFH A;  3SBJ A;  4F2L A;  1HQC A;  3HJQ A;  5IZ7 D;  5IRE B;  1C7Y A;  3KOZ E;  2R45 A;  1YU1 A;  1JR3 A;  2DAK A;  2G5G X;  2RGO A;  2XSZ D;  4KOD A;  3TWK A;  1QQW A;  4DR5 M;  4BBA A;  1T3T A;  4D81 A;  4AQY M;  1NO1 A;  2DWZ B;  4RKU F;  5FLX S;  2J5Y A;  2RRU A;  3WHL A;  1UR8 A;  3WD0 A;  4Z2G A;  1GL6 A;  2C9C A;  2KXE A;  2H5X A;  3GLG A;  3GLF E;  2KEB A;  2K6B A;  2GNO A;  1YUB A;  5EP2 A;  3GLI E;  1YU3 A;  2KA6 B;  2Z8Y M;  1IXS A;  3B74 A;  1SXJ B;  4GH9 A;  1D0L A;  3AOE A;  1DO2 A;  1H6U A;  1XXH B;  1R5L A;  2LWX A; 
#chains in the Genus database with same CATH homology
 1DGG A;  2BG1 A;  3IG5 A;  3VKG A;  4IBB A;  2Y0T A;  3H4M A;  2UXC M;  4KHP M;  1NVM A;  2Y2I A;  1IN8 A;  4M9Z A;  3R8F A;  2YFQ A;  4IBJ A;  3J7A S;  4LRS A;  5C18 A;  4LF4 M;  4W5W A;  3RE8 A;  2R18 A;  4FCW A;  4YY3 M;  2UUB M;  4MGY E;  2YNM D;  2XF3 A;  3GQ5 A;  1W5S A;  2Y2K A;  4B3S M;  2XFS A;  3HSH A;  1J09 A;  2CFO A;  3U6S A;  5EXS A;  4NXN M;  3SAV A;  5ITY A;  4FCV A;  3SAU A;  3J2P B;  4IBE A;  3DOA A;  4MGZ E;  2R65 A;  1MU5 A;  4B3T M;  1IN7 A;  4OJ6 A;  5FTM A;  2CV1 A;  3FUV A;  2L09 A;  4B7G A;  2FE8 A;  4PDG A;  3L2A A;  1N77 A;  3EIE A;  4OJ5 A;  1YSY A;  2DWN A;  1SXJ D;  3KXE C;  4IBK A;  1K82 A;  2Y2G A;  5ITQ A;  3GRR A;  4DV1 M;  4LFC M;  1YE9 A;  4I5S A;  4QNM A;  1TDH A;  2Y0Q A;  1XMQ M;  3GPU A;  4NZ3 A;  5DYG A;  2QZ4 A;  4B7H A;  4NYU A;  2DVW B;  1DGH B;  3U60 A;  3E9S A;  4AZF A;  3UJN A;  3GLF A;  3GPP A;  1Z5C A;  1K3X A;  2XFT A;  3U5Z B;  2X8A A;  4DV3 M;  4DUZ M;  2CV0 A;  3RFW A;  1G3I A;  3FUX A;  4OJO A;  1NY6 A;  3KW6 A;  4LFB M;  3GLI B;  4I4L A;  3CF2 A;  4YHH M;  5FTN A;  3GPY A;  4LF6 M;  2V1C A;  3M6A A;  3DFZ A;  4LZJ A;  2FNA A;  2J7O A;  4IIW A;  4LGM A;  1N33 M;  4QOS A;  1Z5A A;  3SYL A;  8CAT A;  1HNZ M;  3J27 B;  2KW0 A;  3HHW A;  4OVZ A;  2XSZ A;  3GLH A;  1R7R A;  3KSJ A;  1R2Z A;  3KS4 A;  4X62 M;  3PVS A;  2JA2 A;  3U6D A;  2FFF B;  2Y2L A;  3KOY E;  4DV0 M;  2C98 A;  1NHG C;  3K2L A;  3ZC7 B;  2JE5 A;  2DZO B;  2L6O A;  2O5R A;  4X66 M;  4JI1 M;  4AKG A;  1L1Z A;  3K1J A;  4LJ8 A;  2X49 A;  4MGK E;  1YU4 A;  1N78 A;  4EIW A;  3E4R A;  4XBO A;  3U61 A;  1XHB A;  2DZN B;  3SMS A;  1K3W A;  3SYK A;  4B08 A;  1N36 M;  3UGJ A;  4GC9 A;  3T38 A;  3CF0 A;  4QNR A;  4A3V B;  2EA0 A;  4DR4 M;  1NJG A;  5ITX E;  2UXD M;  2R4J A;  3SFZ A;  1TH3 A;  1QZM A;  2CHG A;  1HR0 M;  4NRV A;  3MJ5 A;  4MGH A;  3WHK A;  4OJL A;  4PDI A;  1GL7 A;  1LV7 A;  4OUI A;  3B9P A;  2Y21 A;  4I8O A;  2EO2 A;  3GQ4 A;  1DGF A;  4RNA A;  1E94 E;  3SMP A;  4ZPX A;  1N75 A;  1Z59 A;  2Z4S A;  3LVW A;  3UMM A;  1E32 A;  3RGP A;  2CUZ A;  2R46 A;  2G8L A;  3ILK A;  3TWM A;  4HL4 A;  3L28 A;  1FNN A;  3U6C A;  3U6E A;  2BJW A;  4IBF A;  2Y2H A;  2J7N A;  5DYI A;  1SXJ A;  2A5Y B;  1IBM M;  4LG2 A;  4I81 A;  4DV7 M;  4NRW A;  1XXH A;  2CHQ A;  1FJG M;  4LRT A;  2F4V M;  3HHZ A;  4L78 A;  4D82 A;  1E9S A;  3TPZ A;  2HKJ A;  2ZAN A;  2ZBK B;  1SXJ C;  3D8B A;  4CGY B;  2QCU A;  1QVR A;  4LCB A;  2F5S A;  4GHL A;  4PD2 A;  5DNY A;  2V6Z M;  4QHS A;  4KLN A;  3KDS E;  2Y2J A;  2M60 A;  3J80 S;  1NJF A;  3T1H M;  3VK7 A;  2XEP A;  2R62 A;  1TDZ A;  3Q8X A;  2D7H A;  5IT9 S;  1G41 A;  1G59 A;  3DZD A;  5ITX A;  4AKH A;  2HCB A;  1IXS B;  1IY2 A;  4IBI A;  3TE6 A;  3HU2 A;  2DWM A;  4L15 A;  4GHA A;  3D8L A;  3AL0 C;  3PNY A;  2UUC M;  4OJP A;  3LQR A;  2XGN A;  3W0F A;  4JI5 M;  4JI7 M;  4FCT A;  4K0K M;  5KPZ A;  5ITT A;  4PCZ A;  1IQP A;  4LY6 A;  1OJL A;  3SAS A;  5IWA M;  2C96 A;  3R9X B;  1DGH A;  1YUE A;  3LMM A;  4FWD A;  4G6Z A;  3U5Z A;  4NL4 H;  5FTJ A;  2L7H A;  4NXM M;  2XH9 A;  2UU9 M;  3VLF B;  3GLI A;  5E6J A;  1TH2 A;  2ZAO A;  3MHV C;  3FUU A;  3JR4 A;  1KFV A;  5ITR A;  4AI6 A;  3AJI B;  1C1K A;  1L8Q A;  1NNU C;  4RF0 A;  1ORY B;  2KZU A;  2QBY B;  2YQZ A;  3T15 A;  5KQD A;  3L26 A;  2KRU A;  4LGY A;  2VII A;  4M0W A;  2D7G A;  4LF9 M;  4GRI A;  3ZCB B;  4JI0 M;  4FVM A;  1KYI A;  3PFI A;  2ZAM A;  2DXI A;  3L29 A;  4MM3 B;  5LMN M;  2XZF A;  2AHM A;  1L2C A;  3GPX A;  4D80 A;  4QHT A;  2QP9 X;  3I4V A;  3DA1 A;  3HHX A;  3SAW A;  4LZZ A;  2CE7 A;  2YR0 A;  3N3F A;  3A45 A;  1IBK M;  1X37 A;  4M9X A;  3TWL A;  1XNQ M;  5F3W A;  1PJI A;  3GRV A;  5KO3 A;  1S3S A;  4S12 A;  2E5L M;  3KSX A;  1QYR A;  2Y2M A;  2P5T A;  4II7 A;  4FD2 A;  4GMQ A;  4IJE A;  4ITQ A;  4OW0 A;  2I7P A;  3THG A;  4JV5 M;  3LVV A;  2XD1 A;  4IJF A;  5JI3 E;  1Q39 A;  4FW9 A;  3KOX E;  1XC8 A;  3J81 S;  2F5Q A;  1PM5 A;  1UM8 A;  4MGI E;  4DR6 M;  1YU2 A;  4HLQ A;  3HJ8 A;  2OQ4 A;  4LJ5 A;  4JXJ A;  4OU7 A;  4GKJ M;  3UZU A;  5GKN A;  1YU0 A;  1L2B A;  4RF1 A;  2HL7 A;  2VQF M;  2RGH A;  4GIT A;  7CAT A;  1KSF X;  4NYY A;  1J5E M;  3GO8 A;  2UUA M;  2DHR A;  4JI3 M;  3HKP A;  3FTC A;  5EP4 A;  1Q3B A;  1QAO A;  1N34 M;  3SC3 A;  4TUW A;  4NZ5 A;  5ITU A;  1IY0 A;  3VDU A;  4OX9 M;  4JI4 M;  3JR5 A;  1MX0 A;  3U6Q A;  3SHF A;  2LH0 A;  2C5R A;  3GQ3 A;  3KFU G;  3TQS A;  2Z7J A;  3M7G A;  2XLJ A;  4NZ4 A;  1WXQ A;  2IOU A;  1W5T A;  4LF8 M;  2K47 A;  3SHG B;  3HU3 A;  4NSO B;  1HT2 E;  5FSW A;  1G4A E;  3K92 A;  2ZM6 M;  2VQE M;  4LJ7 A;  4MB7 A;  4P16 A;  1TGU A;  4JI8 M;  1GKI A;  3WX7 A;  3TL4 X;  3C58 A;  5EP1 A;  4IBC A;  4L8R C;  3FTE A;  3U6P A;  2XZU A;  3FYD A;  2F5N A;  3KS8 A;  3PNV A;  4X65 M;  4GKK M;  1R2Y A;  1I94 M;  1NSF A;  3AFH A;  4G4O A;  1IBL M;  1IN6 A;  2Y20 A;  3FYC A;  3EIH A;  3JAM S;  1OFI A;  5E26 A;  3VDP A;  1L2D A;  3HGI A;  3GLG B;  3HJS A;  4L16 A;  3FTF A;  3KOW E;  1EE8 A;  1Q3C A;  3FTD A;  3HHY A;  3KP0 E;  1NY5 A;  2Z3X A;  1NNJ A;  4AG5 A;  4G4R A;  1IY1 A;  3FD9 A;  4FWH A;  3I51 A;  1PJJ A;  2LNH C;  4DV5 M;  5BPV A;  2RKO A;  3SAR A;  1R6B X;  1HQY E;  4GC5 A;  5H37 D;  2CV2 A;  1ZAE A;  3K8Z A;  3QWL A;  4REZ A;  1DGB A;  3L25 A;  2ERC A;  3AOE C;  4JI2 M;  3HU1 A;  2UXB M;  4FWG A;  2I7N A;  2R4E A;  1XWI A;  5EQT A;  3SAT A;  2W82 A;  4QOZ C;  3QAU A;  2QEN A;  3M0E A;  5LMU M;  4DR3 M;  3U6L A;  4KO8 A;  4IBD A;  3AKZ A;  4DUY M;  2HHH M;  4CIS A;  1IM2 A;  2C99 A;  3L27 A;  2CEA A;  3VKH A;  3RGS A;  2Y2O A;  1JR3 D;  2Z4R A;  4BLC A;  4LJ4 A;  3GP1 A;  2Y2P A;  4QNL A;  4JN6 A;  3A98 B;  1NHW C;  4DR7 M;  2L7I A;  2X4A A;  3AOG A;  2H1R A;  4IBG A;  3HWS A;  2QBY A;  3FKE A;  1IXR C;  5KQ8 A;  4Z6Y A;  4NSR A;  4WUR A;  2NQ8 C;  4B7F A;  4B3R M;  5EXT A;  5FTK A;  3CF6 E;  1HNX M;  4DV6 M;  1J7K A;  2Y2Q A;  4B3M M;  4X64 M;  4JYA M;  4NZ1 A;  4DV4 M;  2DWL A;  1DO0 A;  3T1Y M;  4XGI A;  1XMO M;  1TH4 A;  5JI2 E;  1GLN A;  4NY2 A;  1Z5B A;  1QAN A;  3U6O A;  3U60 B;  4L4U A;  3GLF B;  4GIP A;  1D2N A;  3GRU A;  2Q2E B;  2XD5 A;  3BOS A;  2FOI C;  3LQQ A;  1ZQ9 A;  4LF5 M;  5EXX A;  2QPA A;  2C9O A;  3A42 A;  1E9R A;  2BJV A;  3NWL A;  4DR2 M;  1HNW M;  4LJ6 A;  4AW4 A;  4JI6 M;  3W0L B;  2V1U A;  1GVN A;  1HT1 E;  4R7G A;  2F5P A;  4M0D A;  2KZS A;  4NOO B;  3ZH9 B;  5EXP A;  1SXJ E;  4LFA M;  2KRK A;  1IN4 A;  3MK6 A;  5A2Q S;  1IN5 A;  2D7E A;  5FTL A;  3UK6 A;  4OVZ B;  5BR8 M;  1VDD A;  3GLH B;  4AG6 A;  1XNR M;  3FUW A;  4PT5 A;  4CHT B;  4MH0 E;  5C1B A;  3NBI A;  2LXE A;  2M5Z A;  2OPF A;  3CTW B;  4LF7 M;  4BB9 A;  3HON A;  4G4N A;  4LJA A;  3PXG A;  3IG8 A;  2EUC A;  1JQJ C;  4DV2 M;  1IXZ A;  3GRY A;  3U61 B;  1QAM A;  2CHV A;  2Y2N A;  4G4Q A;  3A46 A;  2UWX A;  5KPT A;  3KP1 E;  3VK8 A;  1QAQ A;  4R3D A;  2FFJ A;  1N32 M;  3OTO M;  1Z6T A;  5KPR A;  5EJC A;  3J7B A;  3I4Y A;  4M9S A;  5EP3 A;  3VFD A;  1G8P A;  2JCH A;  2BNK A;  4LJ9 A;  4WW0 A;  3U6M A;  3AV0 A;  3KVW A;  4DR1 M;  4Z8X A;  1L1T A;  2F5O A;  3FUT A;  1I4W A;  1OFH A;  3SBJ A;  3HJQ A;  1HQC A;  5IZ7 D;  5IRE B;  3KOZ E;  2R45 A;  1YU1 A;  1JR3 A;  2XSZ D;  2G5G X;  2RGO A;  4KOD A;  3TWK A;  1QQW A;  4DR5 M;  4BBA A;  1T3T A;  4D81 A;  4AQY M;  2DWZ B;  5FLX S;  3WHL A;  1GL6 A;  2C9C A;  2KXE A;  3GLG A;  2KEB A;  1YUB A;  5EP2 A;  1YU3 A;  2KA6 B;  1SXJ B;  4GH9 A;  3AOE A;  1DO2 A;  1H6U A;  1XXH B;  4AKI A;  2LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...