3KS4A

Crystal structure of reston ebolavirus vp35 rna binding domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
b'KPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Viral protein, rna binding protein
source organism Reston ebolavirus
publication title Ebolavirus VP35 uses a bimodal strategy to bind dsRNA for innate immune suppression.
pubmed doi rcsb
total genus 42
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ks4A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3ks4A02
4IBDA 4IBKA 4IBFA 3L28A 4IJFA 4GHLA 4IBBA 4GH9A 4IBJA 4IJEA 3L29A 5BPVA 4GHAA 4IBIA 3KS4A 3L27A 3L25A 4IBGA 4LG2A 3L26A 4IBEA 4IBCA 3FKEA 3L2AA 3KS8A
chains in the Genus database with same CATH superfamily
4FWGA 5FTMA 3MJ5A 4MH0E 3TPZA 4NZ3A 3BXWA 4LCBA 2L7HA 3U6OA 4M0DA 2VDBB 1TDZA 2FS1A 1CXWA 5FTLA 4Z2JA 5FLXS 2OOAA 1NSFA 1R2YA 3KFUG 4Z2GA 1K3WA 3LQQA 1PJJA 3HHXA 1WXQA 2LWXA 3SAVA 4HLQA 2DAMA 4LF5M 4GHAA 4LJ4A 3SMSA 3HJQA 3KP0E 1AIPC 2O01F 3LCVB 1Z5CA 4I5SA 3KP1E 3E46A 2QQ8A 4NC6A 4D80A 2UXCM 4Y28F 1H6UA 3H4JA 4W5WA 4ITQA 2UU9M 1IY2A 3L26A 3AFHA 4LRTA 3U5ZB 2V1CA 3FD9A 3VFDA 2DWNA 2QSFX 1D2NA 1NJGA 4NSRA 4Z6YA 2JY8A 3FYDA 1EAKA 2XF3A 3KOYE 1RU3A 4FWDA 4HMCA 2XFTA 1GL6A 1E15A 4GIPA 3HX3A 1R2ZA 1Z6TA 2OPFA 4NXNM 4X66M 4LJ6A 3UJNA 1R7RA 2V5OA 3HJ8A 4X64M 1OFHA 3B7ZA 1DO2A 2K47A 1D0MA 4DR7M 2D7HA 4MB7A 1IN5A 1IY1A 5KPRA 2KW0A 1EIJA 4JYAM 1IY0A 2DAKA 3GRUA 1G8PA 4WW0A 4ZPXA 3SYKA 1PM5A 5ITQA 4B7GA 1E6PA 1WHCA 4CJ6A 2G5GX 1XMQM 1UR8A 1E6RA 4JN6A 2QENA 4WP2A 2M60A 4LRSA 2KRKA 2LVAA 4I81A 4UN2B 2DKLA 3K8ZA 2EA0A 4R7GA 2E5LM 4DR4M 4IJFA 1G4AE 2D7GA 3JR4A 4G4NA 1IXZA 2L09A 4LGMA 4RF0A 3F92A 3GLIE 1K3XA 2KNVA 3HGIA 2JZ1A 5ITRA 3M0EA 1A5TA 5BR8M 3GLIA 1GOIA 5IT9S 1XWIA 1FNNA 4DR6M 2JA2A 3HU3A 4JXJA 4RKUF 1LV7A 2YR0A 1SXJC 3HONA 1R5LA 4NOOB 4B3MM 1YUBA 4FCWA 4KODA 4L6V6 2FFFB 2LVQD 2BJWA 3CTWB 1VG5A 4LF6M 1XB2B 3BBZA 2Y2MA 2UUCM 1YU2A 2EO2A 1OAIA 4FD2A 3KOXE 8CATA 4QHSA 2OOBA 2H5XA 3N3FA 2F5PA 1HT2E 2EKFA 2H1RA 4LF7M 3DOAA 2KZUA 3QYEA 2DXIA 2BWBA 1YSYA 4M9XA 4MGYE 2P5TA 1HT1E 2BG1A 1T3TA 3HZJA 3U6CA 3WD3A 4OVZA 4JI2M 4L8RC 4KLNA 3SC3A 3THGA 2OO9A 2C96A 1N75A 2FNAA 3NWLA 4R3DA 5JI3E 4IBGA 4CIZA 4TUWA 1KSFX 3T15A 7CATA 1UFZA 1E32A 4I4LA 2K6BA 4LJ7A 4YY3M 2UUBM 4Z2LA 1W5TA 1DGFA 3GLFE 2XGNA 3FRHA 4IIWA 1HNWM 4Z2IA 3AOEC 5EP2A 4BLCA 1AUAA 1N32M 1IXSA 3PNYA 4HL4A 1OAOC 1QAOA 3K1JA 2JWSA 1ZMVA 4NYUA 2CWBA 1WJ7A 2R46A 5KQDA 4IBJA 1TH2A 2A5YB 1IXRC 2AHMA 3D8LA 1HNZM 2UUAM 2APLA 3CF2A 2C98A 3GRYA 1KS0A 1GLNA 2O25A 4IBIA 3J80S 5EP1A 1NV9A 2EJSA 2J7OA 2YNMD 3FYCA 3SFZA 1IBLM 2IOUA 1NHWC 4GKJM 3KVWA 3W0FA 3U61A 1NV8A 3GLIB 1WGNA 3IG5A 3M7PA 3DFZA 1NY5A 2HHHM 3PNVA 3GLFB 1JR3E 2LBCA 2CE7A 3FTEA 3KS8A 2RGHA 1NJFA 3U6PA 3M7GA 4DR3M 1K82A 2DAEA 1DV0A 2BNKA 4FWHA 3HHYA 2QZ4A 4P16A 4GKKM 3LMMA 1GVNA 2KRUA 4LFCM 2FN2A 4NRVA 5C1BA 2VQEM 1VEKA 4FVMA 1VEGA 2WSCF 4D82A 2ZAOA 3CGWA 1T6OA 4OUIA 3KOZE 4JI6M 1YU3A 1JR3D 2C9OA 2Y20A 5A2QS 5FTKA 3GQ3A 1IN4A 4NZ4A 1N77A 1TR8A 1PGYA 2L2DA 3Q8XA 3L25A 4LG2A 5KO3A 2HKJA 1QYRA 2MGWA 3FE3A 4IBCA 5EXSA 4PCZA 3HWSA 4YHHM 2BWEA 3FUXA 3J7BA 4I8OA 1PJQA 5E26A 3HY5A 3PXGA 3MMPA 3ILKA 3C58A 2DAGA 2Q2EB 4XGIA 4QOZC 4GEWA 4GHLA 3GRVA 4AG6A 1QDRA 3LVWA 3T1YM 2RTSA 2QBYA 3C3EA 1IBKM 2Y2KA 4GH9A 5FTNA 1ZMWA 1N33M 3FUWA 3BOSA 2DAIA 3JAMS 4CISA 4KHPM 3H4MA 2LVOC 2J5YA 3KXEC 3FTCA 3HU2A 4FCVA 3GLHB 3MHVC 4G3OA 3R8FA 2I7PA 4Z2HA 3A42A 5EXXA 2Z3XA 1H0GA 2V1UA 4F2LA 2BJVA 2KXEA 5KPZA 2F5QA 2JE5A 2CHVA 4GMQA 1W1YA 2ZTDA 4AZFA 5FSWA 2VF8A 1L1ZA 4MGKE 2F4VM 2K0BX 3PFIA 1TDHA 4KO8A 1J7MA 4IBKA 4AKIA 3TE6A 2RGOA 4IBFA 1HJPA 1FJGM 3SATA 3FUVA 3U6SA 3HHZA 1XXHE 2NQ8C 1MN3A 3NBXX 3EIHA 3U6EA 4LZZA 2Y2IA 4NRWA 1IM2A 2JZ0A 1E94E 4MGZE 1PJSA 4WURA 4JI5M 2X8AA 2DWLA 1H0IA 3K2LA 1O6IA 3KOWE 5EP3A 4R71A 3VK7A 1WGLA 4II7A 3ZC7B 4QNMA 1N78A 3V76A 4OJOA 4RF1A 4AG5A 2B3TA 3U5ZA 2CV0A 1E6NA 3DA1A 2XZUA 3AJIB 2XLJA 3GPXA 1W5SA 1QDTA 2KHHA 2CV2A 3SAUA 3A45A 3C3DA 1J09A 4X65M 2X4AA 2XSZD 4LZJA 3SBJA 3LVVA 1E6ZA 2LH0A 1Q3BA 2Y2GA 1ED7A 1NY6A 1JQJC 3GLGB 1KYIA 1MX0A 1SXJE 2I7NA 4JI0M 1IFYA 3KSXA 4B08A 1V34A 1SXJB 2JY6B 1EFUB 4QHTA 3SMPA 4LJ8A 1HNXM 4TX8A 4S12A 2F5OA 4B3SM 2C99A 2R6FA 2Y2HA 4LY6A 1C1KA 2Z8YM 2HWJA 3RGSA 1DGGA 1UM8A 2LVPC 2L7IA 4G4QA 5IZ7D 3FTDA 4BB9A 1E9RA 3UMMA 4Z2KA 4LFAM 3GO8A 3DZDA 2XD5A 1G71A 4GC9A 5EXPA 2RRUA 4NYYA 4OU7A 1OGBA 2R45A 1L2CA 2DZLA 1TGUA 4DV7M 3AKZA 2CEAA 4PDIA 4L78A 4AW4A 1PJTA 4MGIE 3FRIA 1AIWA 1PDCA 1OGGA 5EXTA 3I04M 1QUTA 3AOEA 2EKKA 4M9ZA 5FTJA 2DHYA 3E4RA 1W1TA 4AI6A 4EIWA 1Q02A 4Q7JA 4NL4H 2EUCA 4JI4M 3KW6A 2XEPA 3A46A 2Y2OA 3OTOM 1L2BA 2DI0A 3VLFB 2DWZB 2M5ZA 3B89A 1H8PA 1ORYB 4MB4A 2J7NA 3TQSA 4K0KM 3J2PB 3SARA 1NHGC 2FOIC 2Y2NA 3CF0A 4L15A 2L4FA 2HL7A 4GC5A 4JI8M 2WZJA 3ZH9B 1XXHB 2WSEF 2CRUA 3KDSE 3HHWA 3LCUA 1VDLA 2LHGA 2CFOA 4B7FA 2XD1A 2CHQA 2GQFA 2QNJA 4L4UA 1SXJD 2KZSA 2MJ5B 2LNHC 3NBIA 4IBEA 1YLAA 1GJTA 2XSZA 2GNOA 5DYIA 3W0LB 3GQ4A 2UXBM 1WR1B 5ITYA 2R4EA 4KT0F 2KDLA 5KQ8A 3GQ5A 3E21A 3IG8A 2Y0TA 2ZANA 1D0LA 3SHGB 5L8RF 4DUZM 4NZ5A 3WD4A 3WD2A 3A98B 1QAQA 3U6DA 1J5EM 4CGYB 1MU5A 2KA6B 3GLFA 1DO0A 2DHRA 2L4EA 4NXMM 3L29A 1QZEA 3J27B 3AL0C 1GPFA 1GKIA 3VDUA 2MROB 1GJSA 3CF6E 1GABA 2L6OA 3ZQJA 2JCHA 1V33A 2JNHA 4M9SA 3J81S 1QANA 2QP9X 3RE8A 2DENA 3K92A 4MM3B 4GITA 1OIPA 2LTUA 3I01M 3SYLA 4A3VB 4PDGA 3TWMA 2R44A 2Y2JA 1QAMA 2YQZA 4DV3M 1PJIA 1YUEA 5C18A 5F3WA 2C9CA 2F5SA 2V6ZM 2JY7A 1GO5A 1OKSA 1GL7A 2KEBA 2VF7A 1TTEA 4MB5A 2G8LA 3JR5A 1Q3CA 2R18A 3IHPA 3ZCBB 4DR5M 1XC8A 1J7KA 1C7YA 4B3RM 4LGYA 3HJSA 2OQ4A 2XFSA 3GLGE 1YU4A 4NZ1A 4JI3M 1YU0A 4QNLA 4JI7M 2ZBKB 3GPUA 2XZFA 1XMOM 3GLGA 3LQRA 1EE8A 1VEJA 3W68A 5KPTA 4DV2M 4L16A 3U6LA 1W1VA 3WX7A 2DNAA 1PRBA 3M6AA 3C9PA 4GRIA 4B3TM 1JB0F 1BVSA 2ERCA 2R65A 4DV4M 1X37A 2DWMA 1N34M 4HMDA 1MJGM 1NO1A 4MGHA 3B7QA 3GPPA 1E8BA 3MQLA 2D7EA 2YFQA 1GXDA 2DZOB 3WD0A 1VQ1A 5DYGA 2FFJA 4DV5M 3EIEA 2LVNC 1JR3A 4OW0A 4M0WA 2DVWB 2DZNB 2QHOB 5DFLA 3D8BA 1S3SA 1L2DA 4D81A 3WD1A 5ITTA 2R4JA 4PT5A 4IJEA 3WHKA 2VQFM 2CUZA 3R9XB 3HU1A 1DGHB 2MH8A 1W1PA 2Y0QA 1T43A 3T1HM 1R4GA 3GLHE 2FE8A 3I51A 4OJ5A 1NNUC 2G3QA 2VIIA 3AV0A 3VKHA 1SG9A 3KSJA 3TWKA 1SXJA 4X62M 2ZM6M 4OJPA 3LW5F 4LF9M 1XNQM 1QQWA 2R0IA 4DR2M 1L1TA 2UXDM 4F1IA 3U61B 3L2AA 5DNYA 3UGJA 1NVMA 2RKOA 4PD2A 5EP4A 4G4OA 2HCBA 3T38A 4RNAA 4DBGB 3L28A 4DUYM 3VK8A 1N36M 3U60A 3SASA 1QUSA 5ITXA 2Z4SA 4NSOB 3I4YA 1CUKA 3K9OA 4IBBA 2W82A 4CHTB 5GKNA 2R62A 3FUUA 1LTMA 2N35A 3FUTA 3U6QA 3Q8GA 4LJ9A 3WHLA 1KFVA 1DGBA 2CHGA 2HAKA 2LXEA 1XXHA 1NNJA 1WIVA 3HSHA 1XHBA 1YU1A 1I4WA 2D49A 2CP8A 4DV6M 1L6JA 4HMEA 1Z59A 3L27A 3TWLA 2FH0A 2Z4RA 2Z7JA 2QPAA 3I4VA 4FW9A 5E6JA 1OTRA 5ITUA 3U60B 4LJAA 3T6PA 5H37D 2C5RA 3UZUA 1I94M 1IN8A 2X49A 2QBYB 4AKHA 5EQTA 1E88A 1ZQ9A 3RFWA 3QYBA 1QO6A 2O5RA 3RGPA 1DGHA 3SAWA 1HR0M 1Y8GA 3GRRA 3W67A 2Y2PA 2JP7A 4LF8M 4ANRA 3QAUA 4P17A 3GP1A 1VDDA 1D0KA 1Z5AA 3GLHA 1P3QQ 3E9SA 1G59A 4OJLA 4REZA 4XK8F 4MB3A 3B9PA 1UR9A 4G4RA 2MR9A 1TF0B 5LMUM 2K9DA 4G6ZA 1G3IA 2Y2LA 2Y21A 3SHFA 3J7AS 2KNZA 5LMNM 1IN7A 1CK7A 2JY5A 2KNAA 4HEOA 4NY2A 3B74A 1G41A 4BBAA 4AKGA 2XH9A 1ZMUA 3VDPA 4DV1M 1HQYE 5IREB 4LF4M 2F5NA 3FTFA 3VKGA 4OVZB 2UWXA 1Q39A 3TL4X 4IBDA 4QOSA 3QWLA 1YE9A 5EJCA 3MK6A 1QZMA 4LJ5A 1L8QA 1ZAEA 4AQYM 1HQCA 1OFIA 2WSFF 4DV0M 3IECA 1TH3A 4QNRA 1QVRA 2LHCA 3PVSA 4OX9M 1F4IA 4Z8XA 2CV1A 1TH4A 1V92A 1R6BX 1OIZA 5IWAM 4DR1M 2JXNA 5BPVA 3B7NA 4JV5M 1IXSB 2QCUA 3HKPA 4XBOA 3GPYA 1ZV1A 4FCTA 1OJLA 2ZAMA 3KS4A 3U6MA 1IBMM 1IN6A 4LFBM 4B7HA 3AOGA 1E9SA 3K9PA 5JI2E 2Y2QA 4OJ6A 5ITXE 3UK6A 1Z5BA 2ZTCA 4JI1M 1IQPA 3FKEA 1OQYA 2JUJA 1XNRM
chains in the Genus database with same CATH topology
4FWGA 5FTMA 3MJ5A 4MH0E 3TPZA 4NZ3A 4LCBA 2L7HA 3U6OA 4M0DA 1TDZA 5FTLA 5FLXS 1NSFA 1R2YA 3KFUG 1K3WA 3LQQA 1PJJA 3HHXA 1WXQA 2LWXA 3SAVA 4HLQA 4GHAA 4LF5M 4LJ4A 3SMSA 3HJQA 3KP0E 4D80A 1Z5CA 4I5SA 3KP1E 2UXCM 1H6UA 4W5WA 4ITQA 2UU9M 1IY2A 3L26A 3AFHA 4LRTA 3U5ZB 2V1CA 3FD9A 3VFDA 2DWNA 1D2NA 1NJGA 4NSRA 4Z6YA 3FYDA 2XF3A 3KOYE 4FWDA 2XFTA 1GL6A 4GIPA 1R2ZA 1Z6TA 2OPFA 4NXNM 4X66M 4LJ6A 3UJNA 1R7RA 3HJ8A 4X64M 1OFHA 1DO2A 2K47A 2D7HA 4MB7A 1IN5A 1IY1A 5KPRA 2KW0A 4JYAM 1IY0A 3GRUA 1G8PA 4WW0A 4ZPXA 3SYKA 1PM5A 5ITQA 4B7GA 1XMQM 2G5GX 4JN6A 2QENA 2EA0A 2M60A 4LRSA 2KRKA 4I81A 3J7AS 4DR4M 5IT9S 3K8ZA 2E5LM 4R7GA 4IJFA 1G4AE 2D7GA 3JR4A 4G4NA 1IXZA 2L09A 4LGMA 4RF0A 1K3XA 3HGIA 5ITRA 3M0EA 5BR8M 3GLIA 1XWIA 1FNNA 4DR6M 2JA2A 3HU3A 4JXJA 1LV7A 2YR0A 1SXJC 4NOOB 4B3MM 1YUBA 4FCWA 4KODA 2FFFB 2BJWA 3CTWB 4LF6M 2Y2MA 2UUCM 1YU2A 2EO2A 4FD2A 3KOXE 8CATA 4QHSA 3N3FA 2F5PA 1HT2E 2H1RA 4LF7M 3DOAA 2KZUA 2DXIA 1YSYA 4M9XA 4MGYE 2P5TA 1HT1E 2BG1A 1T3TA 3U6CA 4OVZA 4JI2M 4L8RC 4KLNA 3THGA 2C96A 1N75A 2FNAA 3NWLA 4R3DA 5JI3E 4IBGA 4TUWA 1KSFX 3T15A 7CATA 1E32A 4I4LA 4YY3M 4LJ7A 2UUBM 1W5TA 1DGFA 2XGNA 4IIWA 1HNWM 3AOEC 5EP2A 4BLCA 1N32M 3PNYA 4HL4A 1QAOA 3K1JA 4NYUA 2R46A 5KQDA 4IBJA 1TH2A 2A5YB 1IXRC 2AHMA 3D8LA 1HNZM 2UUAM 3CF2A 2C98A 3GRYA 1GLNA 4IBIA 3J80S 5EP1A 2J7OA 2YNMD 3FYCA 3SFZA 1IBLM 2IOUA 1NHWC 4GKJM 3KVWA 3W0FA 3U61A 3GLIB 3IG5A 3DFZA 1NY5A 2HHHM 3PNVA 3GLFB 3KS8A 3FTEA 2CE7A 2RGHA 1NJFA 3U6PA 3M7GA 4DR3M 1K82A 2BNKA 4FWHA 3HHYA 2QZ4A 4P16A 4GKKM 3LMMA 1GVNA 2KRUA 4LFCM 4NRVA 5C1BA 2VQEM 4FVMA 4D82A 2ZAOA 4OUIA 3KOZE 4JI6M 1YU3A 1JR3D 2C9OA 2Y20A 5A2QS 5FTKA 3GQ3A 1IN4A 4NZ4A 1N77A 3Q8XA 3L25A 4LG2A 5KO3A 2HKJA 1QYRA 4IBCA 5EXSA 4PCZA 3HWSA 4YHHM 3FUXA 3J7BA 4I8OA 5E26A 3PXGA 3C58A 3ILKA 2Q2EB 4XGIA 4QOZC 4GHLA 3GRVA 4AG6A 3LVWA 3T1YM 2QBYA 1IBKM 2Y2KA 4GH9A 5FTNA 1N33M 3FUWA 3BOSA 3JAMS 4CISA 4KHPM 3H4MA 3KXEC 3FTCA 3HU2A 4FCVA 3GLHB 3MHVC 3R8FA 2I7PA 3A42A 5EXXA 2Z3XA 2V1UA 2F5QA 2BJVA 2KXEA 5KPZA 2JE5A 2CHVA 4GMQA 4AZFA 5FSWA 1L1ZA 4MGKE 2F4VM 3PFIA 1TDHA 4KO8A 4IBKA 4AKIA 3TE6A 2RGOA 4IBFA 1FJGM 3SATA 3FUVA 3U6SA 3HHZA 2NQ8C 3U6EA 3EIHA 2Y2IA 4LZZA 4NRWA 1IM2A 1E94E 4MGZE 4WURA 4JI5M 2X8AA 2DWLA 3K2LA 3KOWE 5EP3A 3VK7A 4II7A 3ZC7B 4QNMA 1N78A 4OJOA 4RF1A 4AG5A 3U5ZA 2CV0A 3DA1A 2XZUA 3AJIB 2XLJA 3GPXA 1W5SA 2CV2A 3SAUA 3A45A 1J09A 4X65M 2X4AA 2XSZD 4LZJA 3SBJA 3LVVA 2Y2GA 2LH0A 1Q3BA 1NY6A 1JQJC 3GLGB 1KYIA 1MX0A 1SXJE 2I7NA 4JI0M 3KSXA 4B08A 1SXJB 4QHTA 3SMPA 4LJ8A 1HNXM 4S12A 2F5OA 4B3SM 2C99A 2Y2HA 4LY6A 1C1KA 3RGSA 1DGGA 1UM8A 2L7IA 4G4QA 5IZ7D 3FTDA 4BB9A 1E9RA 3UMMA 4LFAM 3GO8A 3DZDA 2XD5A 4GC9A 5EXPA 4NYYA 4OU7A 2R45A 1L2CA 1TGUA 4DV7M 3AKZA 2CEAA 4PDIA 4L78A 4AW4A 4MGIE 5EXTA 3AOEA 4M9ZA 5FTJA 3E4RA 4AI6A 4EIWA 4JI4M 4NL4H 2EUCA 3KW6A 2XEPA 3A46A 2Y2OA 3OTOM 1L2BA 3VLFB 2DWZB 2M5ZA 1ORYB 2J7NA 3TQSA 4K0KM 3J2PB 3SARA 1NHGC 2FOIC 2Y2NA 3CF0A 4L15A 4GC5A 2HL7A 4JI8M 3ZH9B 1XXHB 3KDSE 3HHWA 2CFOA 4B7FA 2XD1A 3HONA 2CHQA 5IWAM 4L4UA 4DR7M 1SXJD 2KZSA 4IBEA 2LNHC 3NBIA 5DYIA 3W0LB 2XSZA 3GQ4A 4LF8M 2UXBM 5ITYA 2R4EA 5KQ8A 3GQ5A 3IG8A 2Y0TA 2ZANA 3SHGB 4DUZM 4NZ5A 3A98B 1QAQA 3U6DA 1J5EM 4CGYB 1MU5A 2KA6B 3GLFA 1DO0A 2DHRA 4NXMM 3AL0C 3L29A 3J27B 1GKIA 3VDUA 3CF6E 2L6OA 2JCHA 4M9SA 3J81S 1QANA 2QP9X 3RE8A 3K92A 4MM3B 4GITA 3SYLA 4A3VB 4PDGA 3TWMA 2Y2JA 1QAMA 2YQZA 4DV3M 1PJIA 1YUEA 5C18A 5F3WA 2C9CA 2F5SA 2V6ZM 1GL7A 2KEBA 2G8LA 3JR5A 1Q3CA 2R18A 3ZCBB 4DR5M 1XC8A 4B3RM 1J7KA 4LGYA 3HJSA 2OQ4A 2XFSA 1YU4A 4NZ1A 4JI3M 1YU0A 4QNLA 4JI7M 2ZBKB 3GPUA 2XZFA 1XMOM 3GLGA 3LQRA 1EE8A 5KPTA 3WX7A 4DV2M 3U6LA 4L16A 3M6AA 4GRIA 4B3TM 4DV4M 2R65A 2ERCA 1X37A 2DWMA 1N34M 4MGHA 3GPPA 2D7EA 2YFQA 2DZOB 5DYGA 2FFJA 4DV5M 3EIEA 1JR3A 4OW0A 4M0WA 2DVWB 2DZNB 3D8BA 1S3SA 1L2DA 4D81A 5ITTA 2R4JA 4PT5A 4IJEA 3WHKA 2VQFM 2CUZA 3R9XB 3HU1A 1DGHB 2Y0QA 3T1HM 2FE8A 3I51A 4OJ5A 1NNUC 2VIIA 3AV0A 3VKHA 3TWKA 3KSJA 1SXJA 4X62M 2ZM6M 4OJPA 4LF9M 1XNQM 1QQWA 1L1TA 4DR2M 2UXDM 3U61B 3L2AA 5DNYA 3UGJA 1NVMA 2RKOA 4PD2A 5EP4A 4G4OA 2HCBA 3T38A 4RNAA 3VK8A 3L28A 4DUYM 1N36M 3SASA 3U60A 5ITXA 2Z4SA 4NSOB 3I4YA 4IBBA 2W82A 4CHTB 5GKNA 2R62A 3FUUA 3FUTA 3U6QA 3WHLA 4LJ9A 1KFVA 1DGBA 2CHGA 2LXEA 1XXHA 1NNJA 3HSHA 1XHBA 1YU1A 1I4WA 4DV6M 3L27A 1Z59A 3TWLA 2Z7JA 2Z4RA 3I4VA 2QPAA 4FW9A 5E6JA 3U60B 2C5RA 5ITUA 1I94M 4LJAA 5H37D 3UZUA 4AKHA 1IN8A 2X49A 2QBYB 5EQTA 1ZQ9A 3RFWA 2O5RA 3RGPA 1DGHA 3SAWA 1HR0M 3GRRA 2Y2PA 3QAUA 3GP1A 1VDDA 1Z5AA 4OJLA 3GLHA 3E9SA 1G59A 4REZA 3B9PA 4G4RA 5LMUM 4G6ZA 1G3IA 2Y2LA 2Y21A 3SHFA 5LMNM 1IN7A 4NY2A 1G41A 4BBAA 4AKGA 2XH9A 4LF4M 3VDPA 4DV1M 1HQYE 5IREB 3FTFA 2F5NA 3VKGA 2UWXA 4OVZB 1Q39A 3TL4X 4IBDA 4QOSA 3QWLA 1YE9A 5EJCA 3MK6A 1QZMA 4LJ5A 1L8QA 1ZAEA 4AQYM 1HQCA 1OFIA 4DV0M 4QNRA 1TH3A 1QVRA 3PVSA 4OX9M 4Z8XA 2CV1A 1TH4A 1R6BX 4DR1M 5BPVA 4JV5M 1IXSB 2QCUA 3HKPA 4XBOA 3GPYA 4FCTA 1OJLA 2ZAMA 3KS4A 3U6MA 1IBMM 1IN6A 4LFBM 4B7HA 3AOGA 1E9SA 5JI2E 2Y2QA 4OJ6A 5ITXE 3UK6A 1Z5BA 4JI1M 1IQPA 3FKEA 3SC3A 1XNRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBD A;  4IBK A;  4IBF A;  3L28 A;  4IJF A;  4GHL A;  4IBB A;  4GH9 A;  4IBJ A;  4IJE A;  3L29 A;  5BPV A;  4GHA A;  4IBI A;  3KS4 A;  3L27 A;  3L25 A;  4IBG A;  4LG2 A;  3L26 A;  4IBE A;  4IBC A;  3FKE A;  3L2A A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 4FWG A;  5FTM A;  3MJ5 A;  4MH0 E;  3TPZ A;  4NZ3 A;  3BXW A;  4LCB A;  2L7H A;  3U6O A;  4M0D A;  2VDB B;  1TDZ A;  2FS1 A;  1CXW A;  5FTL A;  4Z2J A;  5FLX S;  2OOA A;  1NSF A;  1R2Y A;  3KFU G;  4Z2G A;  1K3W A;  3LQQ A;  1PJJ A;  3HHX A;  1WXQ A;  2LWX A;  3SAV A;  4HLQ A;  2DAM A;  4LF5 M;  4GHA A;  4LJ4 A;  3SMS A;  3HJQ A;  3KP0 E;  1AIP C;  2O01 F;  3LCV B;  1Z5C A;  4I5S A;  3KP1 E;  3E46 A;  2QQ8 A;  4NC6 A;  4D80 A;  2UXC M;  4Y28 F;  1H6U A;  3H4J A;  4W5W A;  4ITQ A;  2UU9 M;  1IY2 A;  3L26 A;  3AFH A;  4LRT A;  3U5Z B;  2V1C A;  3FD9 A;  3VFD A;  2DWN A;  2QSF X;  1D2N A;  1NJG A;  4NSR A;  4Z6Y A;  2JY8 A;  3FYD A;  1EAK A;  2XF3 A;  3KOY E;  1RU3 A;  4FWD A;  4HMC A;  2XFT A;  1GL6 A;  1E15 A;  4GIP A;  3HX3 A;  1R2Z A;  1Z6T A;  2OPF A;  4NXN M;  4X66 M;  4LJ6 A;  3UJN A;  1R7R A;  2V5O A;  3HJ8 A;  4X64 M;  1OFH A;  3B7Z A;  1DO2 A;  2K47 A;  1D0M A;  4DR7 M;  2D7H A;  4MB7 A;  1IN5 A;  1IY1 A;  5KPR A;  2KW0 A;  1EIJ A;  4JYA M;  1IY0 A;  2DAK A;  3GRU A;  1G8P A;  4WW0 A;  4ZPX A;  3SYK A;  1PM5 A;  5ITQ A;  4B7G A;  1E6P A;  1WHC A;  4CJ6 A;  2G5G X;  1XMQ M;  1UR8 A;  1E6R A;  4JN6 A;  2QEN A;  4WP2 A;  2M60 A;  4LRS A;  2KRK A;  2LVA A;  4I81 A;  4UN2 B;  2DKL A;  3K8Z A;  2EA0 A;  4R7G A;  2E5L M;  4DR4 M;  4IJF A;  1G4A E;  2D7G A;  3JR4 A;  4G4N A;  1IXZ A;  2L09 A;  4LGM A;  4RF0 A;  3F92 A;  3GLI E;  1K3X A;  2KNV A;  3HGI A;  2JZ1 A;  5ITR A;  3M0E A;  1A5T A;  5BR8 M;  3GLI A;  1GOI A;  5IT9 S;  1XWI A;  1FNN A;  4DR6 M;  2JA2 A;  3HU3 A;  4JXJ A;  4RKU F;  1LV7 A;  2YR0 A;  1SXJ C;  3HON A;  1R5L A;  4NOO B;  4B3M M;  1YUB A;  4FCW A;  4KOD A;  4L6V 6;  2FFF B;  2LVQ D;  2BJW A;  3CTW B;  1VG5 A;  4LF6 M;  1XB2 B;  3BBZ A;  2Y2M A;  2UUC M;  1YU2 A;  2EO2 A;  1OAI A;  4FD2 A;  3KOX E;  8CAT A;  4QHS A;  2OOB A;  2H5X A;  3N3F A;  2F5P A;  1HT2 E;  2EKF A;  2H1R A;  4LF7 M;  3DOA A;  2KZU A;  3QYE A;  2DXI A;  2BWB A;  1YSY A;  4M9X A;  4MGY E;  2P5T A;  1HT1 E;  2BG1 A;  1T3T A;  3HZJ A;  3U6C A;  3WD3 A;  4OVZ A;  4JI2 M;  4L8R C;  4KLN A;  3SC3 A;  3THG A;  2OO9 A;  2C96 A;  1N75 A;  2FNA A;  3NWL A;  4R3D A;  5JI3 E;  4IBG A;  4CIZ A;  4TUW A;  1KSF X;  3T15 A;  7CAT A;  1UFZ A;  1E32 A;  4I4L A;  2K6B A;  4LJ7 A;  4YY3 M;  2UUB M;  4Z2L A;  1W5T A;  1DGF A;  3GLF E;  2XGN A;  3FRH A;  4IIW A;  1HNW M;  4Z2I A;  3AOE C;  5EP2 A;  4BLC A;  1AUA A;  1N32 M;  1IXS A;  3PNY A;  4HL4 A;  1OAO C;  1QAO A;  3K1J A;  2JWS A;  1ZMV A;  4NYU A;  2CWB A;  1WJ7 A;  2R46 A;  5KQD A;  4IBJ A;  1TH2 A;  2A5Y B;  1IXR C;  2AHM A;  3D8L A;  1HNZ M;  2UUA M;  2APL A;  3CF2 A;  2C98 A;  3GRY A;  1KS0 A;  1GLN A;  2O25 A;  4IBI A;  3J80 S;  5EP1 A;  1NV9 A;  2EJS A;  2J7O A;  2YNM D;  3FYC A;  3SFZ A;  1IBL M;  2IOU A;  1NHW C;  4GKJ M;  3KVW A;  3W0F A;  3U61 A;  1NV8 A;  3GLI B;  1WGN A;  3IG5 A;  3M7P A;  3DFZ A;  1NY5 A;  2HHH M;  3PNV A;  3GLF B;  1JR3 E;  2LBC A;  2CE7 A;  3FTE A;  3KS8 A;  2RGH A;  1NJF A;  3U6P A;  3M7G A;  4DR3 M;  1K82 A;  2DAE A;  1DV0 A;  2BNK A;  4FWH A;  3HHY A;  2QZ4 A;  4P16 A;  4GKK M;  3LMM A;  1GVN A;  2KRU A;  4LFC M;  2FN2 A;  4NRV A;  5C1B A;  2VQE M;  1VEK A;  4FVM A;  1VEG A;  2WSC F;  4D82 A;  2ZAO A;  3CGW A;  1T6O A;  4OUI A;  3KOZ E;  4JI6 M;  1YU3 A;  1JR3 D;  2C9O A;  2Y20 A;  5A2Q S;  5FTK A;  3GQ3 A;  1IN4 A;  4NZ4 A;  1N77 A;  1TR8 A;  1PGY A;  2L2D A;  3Q8X A;  3L25 A;  4LG2 A;  5KO3 A;  2HKJ A;  1QYR A;  2MGW A;  3FE3 A;  4IBC A;  5EXS A;  4PCZ A;  3HWS A;  4YHH M;  2BWE A;  3FUX A;  3J7B A;  4I8O A;  1PJQ A;  5E26 A;  3HY5 A;  3PXG A;  3MMP A;  3ILK A;  3C58 A;  2DAG A;  2Q2E B;  4XGI A;  4QOZ C;  4GEW A;  4GHL A;  3GRV A;  4AG6 A;  1QDR A;  3LVW A;  3T1Y M;  2RTS A;  2QBY A;  3C3E A;  1IBK M;  2Y2K A;  4GH9 A;  5FTN A;  1ZMW A;  1N33 M;  3FUW A;  3BOS A;  2DAI A;  3JAM S;  4CIS A;  4KHP M;  3H4M A;  2LVO C;  2J5Y A;  3KXE C;  3FTC A;  3HU2 A;  4FCV A;  3GLH B;  3MHV C;  4G3O A;  3R8F A;  2I7P A;  4Z2H A;  3A42 A;  5EXX A;  2Z3X A;  1H0G A;  2V1U A;  4F2L A;  2BJV A;  2KXE A;  5KPZ A;  2F5Q A;  2JE5 A;  2CHV A;  4GMQ A;  1W1Y A;  2ZTD A;  4AZF A;  5FSW A;  2VF8 A;  1L1Z A;  4MGK E;  2F4V M;  2K0B X;  3PFI A;  1TDH A;  4KO8 A;  1J7M A;  4IBK A;  4AKI A;  3TE6 A;  2RGO A;  4IBF A;  1HJP A;  1FJG M;  3SAT A;  3FUV A;  3U6S A;  3HHZ A;  1XXH E;  2NQ8 C;  1MN3 A;  3NBX X;  3EIH A;  3U6E A;  4LZZ A;  2Y2I A;  4NRW A;  1IM2 A;  2JZ0 A;  1E94 E;  4MGZ E;  1PJS A;  4WUR A;  4JI5 M;  2X8A A;  2DWL A;  1H0I A;  3K2L A;  1O6I A;  3KOW E;  5EP3 A;  4R71 A;  3VK7 A;  1WGL A;  4II7 A;  3ZC7 B;  4QNM A;  1N78 A;  3V76 A;  4OJO A;  4RF1 A;  4AG5 A;  2B3T A;  3U5Z A;  2CV0 A;  1E6N A;  3DA1 A;  2XZU A;  3AJI B;  2XLJ A;  3GPX A;  1W5S A;  1QDT A;  2KHH A;  2CV2 A;  3SAU A;  3A45 A;  3C3D A;  1J09 A;  4X65 M;  2X4A A;  2XSZ D;  4LZJ A;  3SBJ A;  3LVV A;  1E6Z A;  2LH0 A;  1Q3B A;  2Y2G A;  1ED7 A;  1NY6 A;  1JQJ C;  3GLG B;  1KYI A;  1MX0 A;  1SXJ E;  2I7N A;  4JI0 M;  1IFY A;  3KSX A;  4B08 A;  1V34 A;  1SXJ B;  2JY6 B;  1EFU B;  4QHT A;  3SMP A;  4LJ8 A;  1HNX M;  4TX8 A;  4S12 A;  2F5O A;  4B3S M;  2C99 A;  2R6F A;  2Y2H A;  4LY6 A;  1C1K A;  2Z8Y M;  2HWJ A;  3RGS A;  1DGG A;  1UM8 A;  2LVP C;  2L7I A;  4G4Q A;  5IZ7 D;  3FTD A;  4BB9 A;  1E9R A;  3UMM A;  4Z2K A;  4LFA M;  3GO8 A;  3DZD A;  2XD5 A;  1G71 A;  4GC9 A;  5EXP A;  2RRU A;  4NYY A;  4OU7 A;  1OGB A;  2R45 A;  1L2C A;  2DZL A;  1TGU A;  4DV7 M;  3AKZ A;  2CEA A;  4PDI A;  4L78 A;  4AW4 A;  1PJT A;  4MGI E;  3FRI A;  1AIW A;  1PDC A;  1OGG A;  5EXT A;  3I04 M;  1QUT A;  3AOE A;  2EKK A;  4M9Z A;  5FTJ A;  2DHY A;  3E4R A;  1W1T A;  4AI6 A;  4EIW A;  1Q02 A;  4Q7J A;  4NL4 H;  2EUC A;  4JI4 M;  3KW6 A;  2XEP A;  3A46 A;  2Y2O A;  3OTO M;  1L2B A;  2DI0 A;  3VLF B;  2DWZ B;  2M5Z A;  3B89 A;  1H8P A;  1ORY B;  4MB4 A;  2J7N A;  3TQS A;  4K0K M;  3J2P B;  3SAR A;  1NHG C;  2FOI C;  2Y2N A;  3CF0 A;  4L15 A;  2L4F A;  2HL7 A;  4GC5 A;  4JI8 M;  2WZJ A;  3ZH9 B;  1XXH B;  2WSE F;  2CRU A;  3KDS E;  3HHW A;  3LCU A;  1VDL A;  2LHG A;  2CFO A;  4B7F A;  2XD1 A;  2CHQ A;  2GQF A;  2QNJ A;  4L4U A;  1SXJ D;  2KZS A;  2MJ5 B;  2LNH C;  3NBI A;  4IBE A;  1YLA A;  1GJT A;  2XSZ A;  2GNO A;  5DYI A;  3W0L B;  3GQ4 A;  2UXB M;  1WR1 B;  5ITY A;  2R4E A;  4KT0 F;  2KDL A;  5KQ8 A;  3GQ5 A;  3E21 A;  3IG8 A;  2Y0T A;  2ZAN A;  1D0L A;  3SHG B;  5L8R F;  4DUZ M;  4NZ5 A;  3WD4 A;  3WD2 A;  3A98 B;  1QAQ A;  3U6D A;  1J5E M;  4CGY B;  1MU5 A;  2KA6 B;  3GLF A;  1DO0 A;  2DHR A;  2L4E A;  4NXM M;  3L29 A;  1QZE A;  3J27 B;  3AL0 C;  1GPF A;  1GKI A;  3VDU A;  2MRO B;  1GJS A;  3CF6 E;  1GAB A;  2L6O A;  3ZQJ A;  2JCH A;  1V33 A;  2JNH A;  4M9S A;  3J81 S;  1QAN A;  2QP9 X;  3RE8 A;  2DEN A;  3K92 A;  4MM3 B;  4GIT A;  1OIP A;  2LTU A;  3I01 M;  3SYL A;  4A3V B;  4PDG A;  3TWM A;  2R44 A;  2Y2J A;  1QAM A;  2YQZ A;  4DV3 M;  1PJI A;  1YUE A;  5C18 A;  5F3W A;  2C9C A;  2F5S A;  2V6Z M;  2JY7 A;  1GO5 A;  1OKS A;  1GL7 A;  2KEB A;  2VF7 A;  1TTE A;  4MB5 A;  2G8L A;  3JR5 A;  1Q3C A;  2R18 A;  3IHP A;  3ZCB B;  4DR5 M;  1XC8 A;  1J7K A;  1C7Y A;  4B3R M;  4LGY A;  3HJS A;  2OQ4 A;  2XFS A;  3GLG E;  1YU4 A;  4NZ1 A;  4JI3 M;  1YU0 A;  4QNL A;  4JI7 M;  2ZBK B;  3GPU A;  2XZF A;  1XMO M;  3GLG A;  3LQR A;  1EE8 A;  1VEJ A;  3W68 A;  5KPT A;  4DV2 M;  4L16 A;  3U6L A;  1W1V A;  3WX7 A;  2DNA A;  1PRB A;  3M6A A;  3C9P A;  4GRI A;  4B3T M;  1JB0 F;  1BVS A;  2ERC A;  2R65 A;  4DV4 M;  1X37 A;  2DWM A;  1N34 M;  4HMD A;  1MJG M;  1NO1 A;  4MGH A;  3B7Q A;  3GPP A;  1E8B A;  3MQL A;  2D7E A;  2YFQ A;  1GXD A;  2DZO B;  3WD0 A;  1VQ1 A;  5DYG A;  2FFJ A;  4DV5 M;  3EIE A;  2LVN C;  1JR3 A;  4OW0 A;  4M0W A;  2DVW B;  2DZN B;  2QHO B;  5DFL A;  3D8B A;  1S3S A;  1L2D A;  4D81 A;  3WD1 A;  5ITT A;  2R4J A;  4PT5 A;  4IJE A;  3WHK A;  2VQF M;  2CUZ A;  3R9X B;  3HU1 A;  1DGH B;  2MH8 A;  1W1P A;  2Y0Q A;  1T43 A;  3T1H M;  1R4G A;  3GLH E;  2FE8 A;  3I51 A;  4OJ5 A;  1NNU C;  2G3Q A;  2VII A;  3AV0 A;  3VKH A;  1SG9 A;  3KSJ A;  3TWK A;  1SXJ A;  4X62 M;  2ZM6 M;  4OJP A;  3LW5 F;  4LF9 M;  1XNQ M;  1QQW A;  2R0I A;  4DR2 M;  1L1T A;  2UXD M;  4F1I A;  3U61 B;  3L2A A;  5DNY A;  3UGJ A;  1NVM A;  2RKO A;  4PD2 A;  5EP4 A;  4G4O A;  2HCB A;  3T38 A;  4RNA A;  4DBG B;  3L28 A;  4DUY M;  3VK8 A;  1N36 M;  3U60 A;  3SAS A;  1QUS A;  5ITX A;  2Z4S A;  4NSO B;  3I4Y A;  1CUK A;  3K9O A;  4IBB A;  2W82 A;  4CHT B;  5GKN A;  2R62 A;  3FUU A;  1LTM A;  2N35 A;  3FUT A;  3U6Q A;  3Q8G A;  4LJ9 A;  3WHL A;  1KFV A;  1DGB A;  2CHG A;  2HAK A;  2LXE A;  1XXH A;  1NNJ A;  1WIV A;  3HSH A;  1XHB A;  1YU1 A;  1I4W A;  2D49 A;  2CP8 A;  4DV6 M;  1L6J A;  4HME A;  1Z59 A;  3L27 A;  3TWL A;  2FH0 A;  2Z4R A;  2Z7J A;  2QPA A;  3I4V A;  4FW9 A;  5E6J A;  1OTR A;  5ITU A;  3U60 B;  4LJA A;  3T6P A;  5H37 D;  2C5R A;  3UZU A;  1I94 M;  1IN8 A;  2X49 A;  2QBY B;  4AKH A;  5EQT A;  1E88 A;  1ZQ9 A;  3RFW A;  3QYB A;  1QO6 A;  2O5R A;  3RGP A;  1DGH A;  3SAW A;  1HR0 M;  1Y8G A;  3GRR A;  3W67 A;  2Y2P A;  2JP7 A;  4LF8 M;  4ANR A;  3QAU A;  4P17 A;  3GP1 A;  1VDD A;  1D0K A;  1Z5A A;  3GLH A;  1P3Q Q;  3E9S A;  1G59 A;  4OJL A;  4REZ A;  4XK8 F;  4MB3 A;  3B9P A;  1UR9 A;  4G4R A;  2MR9 A;  1TF0 B;  5LMU M;  2K9D A;  4G6Z A;  1G3I A;  2Y2L A;  2Y21 A;  3SHF A;  3J7A S;  2KNZ A;  5LMN M;  1IN7 A;  1CK7 A;  2JY5 A;  2KNA A;  4HEO A;  4NY2 A;  3B74 A;  1G41 A;  4BBA A;  4AKG A;  2XH9 A;  1ZMU A;  3VDP A;  4DV1 M;  1HQY E;  5IRE B;  4LF4 M;  2F5N A;  3FTF A;  3VKG A;  4OVZ B;  2UWX A;  1Q39 A;  3TL4 X;  4IBD A;  4QOS A;  3QWL A;  1YE9 A;  5EJC A;  3MK6 A;  1QZM A;  4LJ5 A;  1L8Q A;  1ZAE A;  4AQY M;  1HQC A;  1OFI A;  2WSF F;  4DV0 M;  3IEC A;  1TH3 A;  4QNR A;  1QVR A;  2LHC A;  3PVS A;  4OX9 M;  1F4I A;  4Z8X A;  2CV1 A;  1TH4 A;  1V92 A;  1R6B X;  1OIZ A;  5IWA M;  4DR1 M;  2JXN A;  5BPV A;  3B7N A;  4JV5 M;  1IXS B;  2QCU A;  3HKP A;  4XBO A;  3GPY A;  1ZV1 A;  4FCT A;  1OJL A;  2ZAM A;  3KS4 A;  3U6M A;  1IBM M;  1IN6 A;  4LFB M;  4B7H A;  3AOG A;  1E9S A;  3K9P A;  5JI2 E;  2Y2Q A;  4OJ6 A;  5ITX E;  3UK6 A;  1Z5B A;  2ZTC A;  4JI1 M;  1IQP A;  3FKE A;  1OQY A;  2JUJ A;  1XNR M; 
#chains in the Genus database with same CATH homology
 4FWG A;  5FTM A;  3MJ5 A;  4MH0 E;  3TPZ A;  4NZ3 A;  4LCB A;  2L7H A;  3U6O A;  4M0D A;  1TDZ A;  5FTL A;  5FLX S;  1NSF A;  1R2Y A;  3KFU G;  1K3W A;  3LQQ A;  1PJJ A;  3HHX A;  1WXQ A;  2LWX A;  3SAV A;  4HLQ A;  4GHA A;  4LF5 M;  4LJ4 A;  3SMS A;  3HJQ A;  3KP0 E;  4D80 A;  1Z5C A;  4I5S A;  3KP1 E;  2UXC M;  1H6U A;  4W5W A;  4ITQ A;  2UU9 M;  1IY2 A;  3L26 A;  3AFH A;  4LRT A;  3U5Z B;  2V1C A;  3FD9 A;  3VFD A;  2DWN A;  1D2N A;  1NJG A;  4NSR A;  4Z6Y A;  3FYD A;  2XF3 A;  3KOY E;  4FWD A;  2XFT A;  1GL6 A;  4GIP A;  1R2Z A;  1Z6T A;  2OPF A;  4NXN M;  4X66 M;  4LJ6 A;  3UJN A;  1R7R A;  3HJ8 A;  4X64 M;  1OFH A;  1DO2 A;  2K47 A;  2D7H A;  4MB7 A;  1IN5 A;  1IY1 A;  5KPR A;  2KW0 A;  4JYA M;  1IY0 A;  3GRU A;  1G8P A;  4WW0 A;  4ZPX A;  3SYK A;  1PM5 A;  5ITQ A;  4B7G A;  1XMQ M;  2G5G X;  4JN6 A;  2QEN A;  2EA0 A;  2M60 A;  4LRS A;  2KRK A;  4I81 A;  3J7A S;  4DR4 M;  5IT9 S;  3K8Z A;  2E5L M;  4R7G A;  4IJF A;  1G4A E;  2D7G A;  3JR4 A;  4G4N A;  1IXZ A;  2L09 A;  4LGM A;  4RF0 A;  1K3X A;  3HGI A;  5ITR A;  3M0E A;  5BR8 M;  3GLI A;  1XWI A;  1FNN A;  4DR6 M;  2JA2 A;  3HU3 A;  4JXJ A;  1LV7 A;  2YR0 A;  1SXJ C;  4NOO B;  4B3M M;  1YUB A;  4FCW A;  4KOD A;  2FFF B;  2BJW A;  3CTW B;  4LF6 M;  2Y2M A;  2UUC M;  1YU2 A;  2EO2 A;  4FD2 A;  3KOX E;  8CAT A;  4QHS A;  3N3F A;  2F5P A;  1HT2 E;  2H1R A;  4LF7 M;  3DOA A;  2KZU A;  2DXI A;  1YSY A;  4M9X A;  4MGY E;  2P5T A;  1HT1 E;  2BG1 A;  1T3T A;  3U6C A;  4OVZ A;  4JI2 M;  4L8R C;  4KLN A;  3THG A;  2C96 A;  1N75 A;  2FNA A;  3NWL A;  4R3D A;  5JI3 E;  4IBG A;  4TUW A;  1KSF X;  3T15 A;  7CAT A;  1E32 A;  4I4L A;  4YY3 M;  4LJ7 A;  2UUB M;  1W5T A;  1DGF A;  2XGN A;  4IIW A;  1HNW M;  3AOE C;  5EP2 A;  4BLC A;  1N32 M;  3PNY A;  4HL4 A;  1QAO A;  3K1J A;  4NYU A;  2R46 A;  5KQD A;  4IBJ A;  1TH2 A;  2A5Y B;  1IXR C;  2AHM A;  3D8L A;  1HNZ M;  2UUA M;  3CF2 A;  2C98 A;  3GRY A;  1GLN A;  4IBI A;  3J80 S;  5EP1 A;  2J7O A;  2YNM D;  3FYC A;  3SFZ A;  1IBL M;  2IOU A;  1NHW C;  4GKJ M;  3KVW A;  3W0F A;  3U61 A;  3GLI B;  3IG5 A;  3DFZ A;  1NY5 A;  2HHH M;  3PNV A;  3GLF B;  3KS8 A;  3FTE A;  2CE7 A;  2RGH A;  1NJF A;  3U6P A;  3M7G A;  4DR3 M;  1K82 A;  2BNK A;  4FWH A;  3HHY A;  2QZ4 A;  4P16 A;  4GKK M;  3LMM A;  1GVN A;  2KRU A;  4LFC M;  4NRV A;  5C1B A;  2VQE M;  4FVM A;  4D82 A;  2ZAO A;  4OUI A;  3KOZ E;  4JI6 M;  1YU3 A;  1JR3 D;  2C9O A;  2Y20 A;  5A2Q S;  5FTK A;  3GQ3 A;  1IN4 A;  4NZ4 A;  1N77 A;  3Q8X A;  3L25 A;  4LG2 A;  5KO3 A;  2HKJ A;  1QYR A;  4IBC A;  5EXS A;  4PCZ A;  3HWS A;  4YHH M;  3FUX A;  3J7B A;  4I8O A;  5E26 A;  3PXG A;  3C58 A;  3ILK A;  2Q2E B;  4XGI A;  4QOZ C;  4GHL A;  3GRV A;  4AG6 A;  3LVW A;  3T1Y M;  2QBY A;  1IBK M;  2Y2K A;  4GH9 A;  5FTN A;  1N33 M;  3FUW A;  3BOS A;  3JAM S;  4CIS A;  4KHP M;  3H4M A;  3KXE C;  3FTC A;  3HU2 A;  4FCV A;  3GLH B;  3MHV C;  3R8F A;  2I7P A;  3A42 A;  5EXX A;  2Z3X A;  2V1U A;  2F5Q A;  2BJV A;  2KXE A;  5KPZ A;  2JE5 A;  2CHV A;  4GMQ A;  4AZF A;  5FSW A;  1L1Z A;  4MGK E;  2F4V M;  3PFI A;  1TDH A;  4KO8 A;  4IBK A;  4AKI A;  3TE6 A;  2RGO A;  4IBF A;  1FJG M;  3SAT A;  3FUV A;  3U6S A;  3HHZ A;  2NQ8 C;  3U6E A;  3EIH A;  2Y2I A;  4LZZ A;  4NRW A;  1IM2 A;  1E94 E;  4MGZ E;  4WUR A;  4JI5 M;  2X8A A;  2DWL A;  3K2L A;  3KOW E;  5EP3 A;  3VK7 A;  4II7 A;  3ZC7 B;  4QNM A;  1N78 A;  4OJO A;  4RF1 A;  4AG5 A;  3U5Z A;  2CV0 A;  3DA1 A;  2XZU A;  3AJI B;  2XLJ A;  3GPX A;  1W5S A;  2CV2 A;  3SAU A;  3A45 A;  1J09 A;  4X65 M;  2X4A A;  2XSZ D;  4LZJ A;  3SBJ A;  3LVV A;  2Y2G A;  2LH0 A;  1Q3B A;  1NY6 A;  1JQJ C;  3GLG B;  1KYI A;  1MX0 A;  1SXJ E;  2I7N A;  4JI0 M;  3KSX A;  4B08 A;  1SXJ B;  4QHT A;  3SMP A;  4LJ8 A;  1HNX M;  4S12 A;  2F5O A;  4B3S M;  2C99 A;  2Y2H A;  4LY6 A;  1C1K A;  3RGS A;  1DGG A;  1UM8 A;  2L7I A;  4G4Q A;  5IZ7 D;  3FTD A;  4BB9 A;  1E9R A;  3UMM A;  4LFA M;  3GO8 A;  3DZD A;  2XD5 A;  4GC9 A;  5EXP A;  4NYY A;  4OU7 A;  2R45 A;  1L2C A;  1TGU A;  4DV7 M;  3AKZ A;  2CEA A;  4PDI A;  4L78 A;  4AW4 A;  4MGI E;  5EXT A;  3AOE A;  4M9Z A;  5FTJ A;  3E4R A;  4AI6 A;  4EIW A;  4JI4 M;  4NL4 H;  2EUC A;  3KW6 A;  2XEP A;  3A46 A;  2Y2O A;  3OTO M;  1L2B A;  3VLF B;  2DWZ B;  2M5Z A;  1ORY B;  2J7N A;  3TQS A;  4K0K M;  3J2P B;  3SAR A;  1NHG C;  2FOI C;  2Y2N A;  3CF0 A;  4L15 A;  4GC5 A;  2HL7 A;  4JI8 M;  3ZH9 B;  1XXH B;  3KDS E;  3HHW A;  2CFO A;  4B7F A;  2XD1 A;  3HON A;  2CHQ A;  5IWA M;  4L4U A;  4DR7 M;  1SXJ D;  2KZS A;  4IBE A;  2LNH C;  3NBI A;  5DYI A;  3W0L B;  2XSZ A;  3GQ4 A;  4LF8 M;  2UXB M;  5ITY A;  2R4E A;  5KQ8 A;  3GQ5 A;  3IG8 A;  2Y0T A;  2ZAN A;  3SHG B;  4DUZ M;  4NZ5 A;  3A98 B;  1QAQ A;  3U6D A;  1J5E M;  4CGY B;  1MU5 A;  2KA6 B;  3GLF A;  1DO0 A;  2DHR A;  4NXM M;  3AL0 C;  3L29 A;  3J27 B;  1GKI A;  3VDU A;  3CF6 E;  2L6O A;  2JCH A;  4M9S A;  3J81 S;  1QAN A;  2QP9 X;  3RE8 A;  3K92 A;  4MM3 B;  4GIT A;  3SYL A;  4A3V B;  4PDG A;  3TWM A;  2Y2J A;  1QAM A;  2YQZ A;  4DV3 M;  1PJI A;  1YUE A;  5C18 A;  5F3W A;  2C9C A;  2F5S A;  2V6Z M;  1GL7 A;  2KEB A;  2G8L A;  3JR5 A;  1Q3C A;  2R18 A;  3ZCB B;  4DR5 M;  1XC8 A;  4B3R M;  1J7K A;  4LGY A;  3HJS A;  2OQ4 A;  2XFS A;  1YU4 A;  4NZ1 A;  4JI3 M;  1YU0 A;  4QNL A;  4JI7 M;  2ZBK B;  3GPU A;  2XZF A;  1XMO M;  3GLG A;  3LQR A;  1EE8 A;  5KPT A;  3WX7 A;  4DV2 M;  3U6L A;  4L16 A;  3M6A A;  4GRI A;  4B3T M;  4DV4 M;  2R65 A;  2ERC A;  1X37 A;  2DWM A;  1N34 M;  4MGH A;  3GPP A;  2D7E A;  2YFQ A;  2DZO B;  5DYG A;  2FFJ A;  4DV5 M;  3EIE A;  1JR3 A;  4OW0 A;  4M0W A;  2DVW B;  2DZN B;  3D8B A;  1S3S A;  1L2D A;  4D81 A;  5ITT A;  2R4J A;  4PT5 A;  4IJE A;  3WHK A;  2VQF M;  2CUZ A;  3R9X B;  3HU1 A;  1DGH B;  2Y0Q A;  3T1H M;  2FE8 A;  3I51 A;  4OJ5 A;  1NNU C;  2VII A;  3AV0 A;  3VKH A;  3TWK A;  3KSJ A;  1SXJ A;  4X62 M;  2ZM6 M;  4OJP A;  4LF9 M;  1XNQ M;  1QQW A;  1L1T A;  4DR2 M;  2UXD M;  3U61 B;  3L2A A;  5DNY A;  3UGJ A;  1NVM A;  2RKO A;  4PD2 A;  5EP4 A;  4G4O A;  2HCB A;  3T38 A;  4RNA A;  3VK8 A;  3L28 A;  4DUY M;  1N36 M;  3SAS A;  3U60 A;  5ITX A;  2Z4S A;  4NSO B;  3I4Y A;  4IBB A;  2W82 A;  4CHT B;  5GKN A;  2R62 A;  3FUU A;  3FUT A;  3U6Q A;  3WHL A;  4LJ9 A;  1KFV A;  1DGB A;  2CHG A;  2LXE A;  1XXH A;  1NNJ A;  3HSH A;  1XHB A;  1YU1 A;  1I4W A;  4DV6 M;  3L27 A;  1Z59 A;  3TWL A;  2Z7J A;  2Z4R A;  3I4V A;  2QPA A;  4FW9 A;  5E6J A;  3U60 B;  2C5R A;  5ITU A;  1I94 M;  4LJA A;  5H37 D;  3UZU A;  4AKH A;  1IN8 A;  2X49 A;  2QBY B;  5EQT A;  1ZQ9 A;  3RFW A;  2O5R A;  3RGP A;  1DGH A;  3SAW A;  1HR0 M;  3GRR A;  2Y2P A;  3QAU A;  3GP1 A;  1VDD A;  1Z5A A;  4OJL A;  3GLH A;  3E9S A;  1G59 A;  4REZ A;  3B9P A;  4G4R A;  5LMU M;  4G6Z A;  1G3I A;  2Y2L A;  2Y21 A;  3SHF A;  5LMN M;  1IN7 A;  4NY2 A;  1G41 A;  4BBA A;  4AKG A;  2XH9 A;  4LF4 M;  3VDP A;  4DV1 M;  1HQY E;  5IRE B;  3FTF A;  2F5N A;  3VKG A;  2UWX A;  4OVZ B;  1Q39 A;  3TL4 X;  4IBD A;  4QOS A;  3QWL A;  1YE9 A;  5EJC A;  3MK6 A;  1QZM A;  4LJ5 A;  1L8Q A;  1ZAE A;  4AQY M;  1HQC A;  1OFI A;  4DV0 M;  4QNR A;  1TH3 A;  1QVR A;  3PVS A;  4OX9 M;  4Z8X A;  2CV1 A;  1TH4 A;  1R6B X;  4DR1 M;  5BPV A;  4JV5 M;  1IXS B;  2QCU A;  3HKP A;  4XBO A;  3GPY A;  4FCT A;  1OJL A;  2ZAM A;  3KS4 A;  3U6M A;  1IBM M;  1IN6 A;  4LFB M;  4B7H A;  3AOG A;  1E9S A;  5JI2 E;  2Y2Q A;  4OJ6 A;  5ITX E;  3UK6 A;  1Z5B A;  4JI1 M;  1IQP A;  3FKE A;  3SC3 A;  1XNR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...