2Y2PA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
489
structure length
466
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 157
structure length 466
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2pA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2pA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2pA02
1JWVA 2V1ZA 1CK3A 1YLJA 5GLBA 5CRFA 2H5SA 2PU2A 1YMSA 4UHUA 4K0XA 1I5QA 5CHJA 2Y4AA 3G4PA 3NIAA 3W4QA 4Y7PA 3PAGA 2DRWA 5CEDA 3NBLA 3BECA 4WZ4A 1W5DA 5FASA 2OSUA 3VFHA 1BLSA 4LCMA 3N7WA 3G2YA 2XGNA 1CI9A 4KZ7A 1K55A 2VGKA 3BRMA 3GRJA 4GZBA 4JPMA 1Q2QA 5CHUA 3Q82A 4JF4A 3RXXA 4OQ0A 1FCOA 5EVIC 2BG1A 2IWCA 5GLCA 4E6XA 3HLCA 3NY4A 4X55A 1HTZA 2RCXA 3UY6A 2Y2LA 2OLUA 5FAOA 5M18A 2C5WB 2HDSA 3ITAA 4JF5A 1YLPA 3FYZA 2XEPA 4OOMA 3E2LA 5CTNA 3OZHA 1N4OA 3IHAA 3BFGA 1MBLA 3HLGA 2PU4A 1TVFA 3BYDA 4JKTA 4YINA 1K56A 2X02A 4JBFA 5HAPA 3MFDA 4KZ5A 1IELA 4K0WA 2FFFB 3EQVA 3G35A 1ES2A 1MWSA 4NK3A 5EVIA 4GNUA 3LO7A 4P87A 1IKGA 2EXBA 1E3UD 3A3DA 3HLBA 3OCNA 4X68A 3V50A 2EX6A 3GVBA 4OQGA 3OC2A 5EOOA 1K25A 4LV1A 5CECA 4BENA 4QB8A 4FSFA 1BUEA 3DWKA 1XPBA 3NI9A 1MWTA 1KE0A 2HP6A 3HLWA 5AQ7A 4EV4A 4HBUA 1L0EA 3AGEA 5CHMA 5DTSA 1Y54A 3C4PA 1JWPA 3WS5A 2R9XA 5FA7A 2IWBA 4PM6A 4LV0A 2H10A 3N8SA 1ERQA 2QMIA 5FI7A 3SH8A 3UPNA 2ZC3B 1BLCA 4N9LA 1FSWA 1MWRA 4R1GA 3A3JA 5FQIA 3IH8A 3CG5A 5AQBA 5GHYA 1PWCA 3BFFA 3LCEA 2ZC5B 2I72A 4OQIA 3HBRA 3FZCA 4R3BA 2XFTA 4IBXA 3UN7A 3Q7VA 1MWUA 3QNCA 3SH9A 2PBYA 5CGSA 1KE4A 4R4RA 4WMCD 4EBLA 2IWDA 4ZJ3A 2WUQA 1NRFA 4L0LA 2Y2GA 3SH7A 1NZUA 3FV7A 1HVBA 3ZVWA 5EVLA 5FDHA 2J9PA 4RX3A 3CJMA 4IBRA 4U0XA 5EVIB 1PW1A 4X6TA 4KZAA 3UDIA 5CEBA 1E4DA 4S2NA 4DE1A 4KZ9A 2HDUA 4QU3A 1JWZA 4RX2A 3C4OA 4QD4A 5GL9A 3PBOA 1O07A 4OKPA 1XKZA 5GLDA 5GHZA 3TSGA 1IEMA 3M6HA 3W4OA 3HREA 1GA9A 3O87A 2GDNA 3WS0A 1W7FA 4IVIA 2DNSA 2XFSA 1SHVA 2WADA 2OV5A 3VOYA 1K54C 3BLSA 4DXCA 3HLFA 2QZ6A 3GQZA 4ID4A 3IXHA 1DJBA 5EVID 2XD5A 1PI4A 3NDEA 4X53A 4WELA 3FWLA 1PIOA 1SDNA 1NYMA 4JXVA 5EECA 2Y91A 4HESA 1XA7A 1ZKJA 3MZDA 3BM6A 4E3MA 3HLDA 2HDRA 4WEJA 1MKIA 2WAFA 5EE8A 3W4PA 5GHXA 1Z6FA 2Z2LB 3G2ZA 1RGYA 3V5MA 3G32A 3OPRA 4ZJ2A 5KSCA 4GB7A 1FQGA 1FSYA 4WZ5A 5FSRA 4R23A 1KE3A 2OLVA 4PM9A 4Y0UA 4U3TA 3IXDA 4S2PA 2WGWA 3PBNA 2QPNA 4DRTA 5FQKA 4OPRA 1QMFA 4LV3A 3ZCZA 3B3XA 3VP0A 2A49A 3ZVTA 3ZG9B 2EX9A 5A92A 1ZG4A 3G31A 3OPPA 5E43A 1NXYA 2V2FF 1L0DA 3ISGA 5FI6A 4JXSA 4S2OA 5A93A 4S2JA 5DF8A 4IVKA 3EQUA 5FQQA 4EBNA 3HUMA 4ZTKA 3N4IA 3ZDJA 1ES3A 3VP1A 2WYXA 4B88A 3PBQA 4DDYA 4OOLA 1S6RA 3VSKA 2Y2QA 4GOGA 5KSHA 4N9KA 3VFFA 1K54A 4P6BA 1LI9A 3MZEA 3UPPA 4R3JA 1YM1A 3V39A 4E3IA 5HAIA 1K4EA 5F1GA 2G2UA 3N6IA 4OONA 5TR7A 5FATA 3ITBA 3N8LA 4X69A 4ZDXA 3CMZA 1K6SA 2FFYA 1EWZA 3M2JA 3P98A 5DTKA 4PM8A 1L0GA 1CEGA 2EXAA 5U47A 4EWFA 2WAEA 3GTCA 2WKHA 4GKUA 4UAAA 4C6YA 1PZPA 2ZJ9A 4S2NC 3AGFA 3Q07A 2R9WA 1ES4A 5CGXA 3G34A 3QHYA 1I2WA 1DY6A 4JXGA 5IHVA 3WRTA 4KG5A 1L2SA 4RVAA 3SS4A 5D3OA 4BL2A 3Q81A 5L2FA 2XQZA 3NCKA 1JTDA 2Y2PA 1VM1A 2Q9NA 4M3KA 4NETA 3SOIA 4OPQA 1RCJA 4MBKA 2Y59A 1ERMA 4XXRA 5HW3A 3WRZA 3PAEA 3WS4A 4MBFA 3VMAA 1K6RA 3IWIA 4FCFA 1YQSA 3PTEA 5TGFA 4KENB 1YLYA 4RA7A 1ES5A 1BT5A 4EBPA 1NYYA 2ZQ7A 4IEDA 4R4SA 4KZBA 1XX2A 5E2HA 3V3RA 3ZGAB 2G2WA 4E3NA 4LCLA 4WM9A 4JLFA 3GV9A 4DE3A 3OPLA 3MKEA 2XR0A 3WWXA 3C7VA 2WGIA 3VOZA 4WYYA 1ESUA 1RGZA 1BLHA 2EX8A 2BLSA 1GHIA 3UNWA 1E3UA 5FAPA 1YLTA 2HDQA 1PWGA 1SKFA 4E3LA 5HAQA 1K4FA 2ZQAA 3IXGA 2VGJA 3OCLA 2DCFA 3UO9A 2XLNA 3IF6B 4ZAMA 1H8ZA 1ALQA 4BQMA 1BTLA 3PBTA 4X56A 1XXMA 2EFUA 4PMAA 3UDXA 4FH4A 1FOFA 3S4XA 3ZG8B 4Y0TA 1IYOA 4JF6A 1XA1A 3A3IA 3BEBA 5DF9A 2ZC6B 2ZLYA 4QHCA 3DW0A 1WYCA 4C75A 4S2KA 3ZFZA 2P9VB 5BOHA 3C7UA 3IF6C 2E8IA 4OVDA 3IHBA 3MXRA 4P85A 1SDEA 4QY5A 1I2SA 3WS1A 2HP9A 2WZZA 4KG2A 4CJNA 4KZ4A 4K91A 5A90A 2H0TA 2WGVA 4KQRA 4GD8A 4PM7A 3D4FA 2Y55A 4OP8A 4DF6A 1KDWA 1SCWA 1TDLA 1G6AA 3GMWA 1YLZA 3S1YA 2WKEA 4MBHA 1BSGA 1BZAA 3IF5A 2UWXA 3QNBA 2Y2JA 4EQIA 2P9VA 2ZQDA 1K56D 2Y2KA 4OLGA 5A91A 2Y2IA 4B4XA 3ZNTA 4BLMA 4DXBA 2Z2MB 3VP2A 1FR1A 1TEMA 4OLDA 5KMWA 1DJAA 1LLBA 3DWZA 5CERA 3WS2A 3UE0A 1BULA 1MXOA 1K55C 1LHYA 1IYQA 3M6BA 2JCHA 1JVJA 5E2EA 1Q2PA 2ZMAA 3Q7ZA 5EOEA 4E3OA 1KGEA 5HFOA 1MPLA 1XGJA 2EFXA 4E3JA 4E3KA 4FH2A 3AGDA 3UE1A 5CGWA 3ZNYA 4QY6A 1NZOA 4DE0A 1YT4A 1CEFA 2Q9MA 3NC8A 1KDSA 1E25A 1ESIA 4A5RA 1IKIA 4CPKA 4OPZA 3ZG0A 2X71A 4KG6A 4N92A 3P09A 4HBTA 3N8RA 2H0YA 1NY0A 1KGFA 3MKFA 5DTTA 2Y2MA 1AXBA 1U60A 1RP5A 5E2FA 5FQMA 3SS5A 1C3BA 3PBSA 2ZQ8A 4OH0A 1O7EA 4BD0A 1PI5A 2XH9A 1GCEA 3SS3A 1K57C 3UE3A 3BFEA 4FD8A 3HL9A 2X01A 3VP3A 4LV2A 2WZXA 5F82A 4QJGA 4MEZA 4KQOA 4GDBA 1GHPA 2ZM2A 1ZG6A 3IF6A 3CZDA 1IYSA 1KGGA 1WYBA 1W8YA 1H8YA 4YFMA 1K38A 4ZBEA 1HD8A 3RXWA 2P74A 2ZM0A 4C3QA 2JC7A 3JYIA 1PWDA 4KZ6A 4KQQA 3UDFA 4BJPA 4LENA 2J9OA 4XUZA 3FKVA 2J8YA 1KVLA 1PZOA 3W8KA 3A3FA 2WKIA 3GR2A 3VSLA 4BL3A 3GSGA 5E2GA 4EUZA 5G18A 5F1FA 3ZG7B 3ZG5A 2ZC7A 3HVFA 4B4ZA 1LI0A 2Y2NA 1ZC2A 3FKWA 3VP4A 2RL3A 3Q7VB 4OQHA 5CTMA 3MZFA 4XUXA 3C5AA 2ZQ9A 3NDGA 5TFQA 3LY4A 5FAQA 5JYPA 3UPOA 4MLLA 2JE5A 5AQAA 1EROA 1LL9A 3S22A 4P0MA 4HEFA 4RYEA 4U0TA 3HUNA 2XD1A 5HL1A 2A3UA 5EUAA 1GA0A 5FI2A 2J7VA 5CXWA 4KZ3A 5FQJA 3HLEA 4S2IA 2HPBA 3O86A 5FQ9A 5HARA 5GLAA 1DJCA 4DKIA 4KZ8A 1VQQA 4GD6A 2XDMA 1LL5A 5EPHA 4OOYA 2WK0A 3IH9A 1FCNA 3OPHA 1CI8A 3M2KA 1NJ4A 2ZQCA 5HX9A 4ZJ1A 2EX2A 3IWQA 5JYOA 4UA7A 5KZHA 3ZHHA 4D2OA 5M19A 5I94A 3BLMA 4Y0OA 5M1AA 4O7DA 1S0WA 5F83A 3V3SA 3IWOA 1QMEA 1JTGA 4WEKA 2XF3A 3RJUA 1MY8A 3O3VA 2ZC4B 4MNRA 4UA6A 5AQ9A 2WGWB 3LY3A 1XGIA 2CC1A 4E6WA 3IT9A 4F94A 2XK1A 1KVMA 1L0FA 4DE2A 4PPRA 3Q1FA 1G68A 4WBGA 1W8QA 4PM5A 1TDGA 4WZ5C 4UA9A 3G30A 1PW8A 1N9BA 2JBFA 3IQAA 1YMXA 2ZD8A 4H8RA 1M6KA 3IXBA 2Y2HA 3PBRA 1K57A 1M40A 1WE4A 4BD1A 1H5XA 1BLPA 4OP5A 1IYPA 3TG9A 1GHMA 3DTMA 4N1XA 4Q8IA 1J9MA 3BFCA 3BFDA 3TOIA 2ZM8A 1W79A 4S2MA 5DVAA 3LEZA 1EI5A 3A3EA 4GN2A 1ONHA 3MBZA 1FCMA 2HP5A 1HZOA 2V20A 1XP4A 4N1HA 1PYYA 4S2LA 5DF7A 3MXSA 4WMCA 1ONGA 2Y2OA 1FR6A 1YLWA 3I7JA 3O88A 4GDNA 4DDSA 3E2KA 4OPYA 4R0QA 4Z9QA 3HUOA 2C6WB 4JXWA 1OMEA 2B5RA 5J8XA
chains in the Genus database with same CATH superfamily
3C1BC 1O6IA 1P3PA 2V1ZA 3VV4A 5F99B 1WWIA 4JJNB 2GZAA 4CQHA 2PU2A 1YMSA 4ZBJB 4ETZA 5J3WA 4WZ4A 5FASA 2OSUA 3VFHA 1YAXA 2HJEA 1BLSA 4LPZA 5HD3A 2XGNA 3X1TC 1K55A 3RXXA 3C1CB 4OQ0A 5BO0A 3X1VA 2IWCA 5GLCA 3L2AA 3NY4A 4OJLA 3MQOA 3W98D 5CPID 3LYXA 2OOLA 4JGPA 3AZID 1DP6A 4I5SA 5M18A 1M19C 2QKPA 4JF5A 1R4VA 2LB5A 3FYZA 2XEPA 4LRXC 4OOMA 3E2LA 3IHAA 4Z66B 3HLGA 5EM1A 2V0UA 5B2ID 3WA9D 2X02A 4JBFA 2PD7A 4NY2A 3MFDA 1KX5A 4IUHA 5GSUB 3EQVA 1ES2A 3B0BA 3UB6A 1P97A 4HJ3A 1F66D 3P5JB 4FSFA 1L0EA 4IBJA 3REJD 1G28A 3O62A 5FI7A 1TAFA 4H9PA 5AV8A 1P9WA 3DAVA 3LJAB 5BO0B 3LR0A 1YKDA 3BY9A 3BFFA 3AYWB 4OQIA 4R3BA 5IS1A 4H6JA 4P6ZM 3SH9A 4R4RA 5I5LA 2IWDA 1UR9A 4L0LA 3AZIB 3SH7A 1HVBA 1MZUA 5EVLA 3QP2A 4H9SA 1H8MA 3CJMA 3UDIA 4IBFA 1PW1A 5CEBA 5B2IB 1YPRA 4QU3A 3MQ0A 1P3KC 5GL9A 4IBEA 1U35B 3KSGA 1PFLA 4YM6A 3M6HA 5KDMA 1GA9A 4DMZA 4K08A 4WU8C 4LD9B 2P08A 5B40B 1SHVA 2WADA 4BBVA 3GQZA 3LIBA 2CV5D 1S1YA 3IXHA 3KSFA 3FWLA 2NZDC 2W1TA 4NXGA 5JA4A 1NYMA 3MGSC 3BM6A 4IBBA 5KIZA 1F66C 4H9OB 1RGYA 4ZJ2A 3UE6A 5KSCA 3L27A 3W97B 4EERA 5K5BA 1Y28A 2OLVA 2H28A 5C3IC 2B95A 4DRTA 1SKOA 5CHLB 1QMFA 1P3OD 4LV3A 4OPRA 3ZCZA 4DQYB 4MN5A 2EX9A 1T18A 3G31A 3AN2D 5E43A 1NXYA 1P3OA 1N9OA 5B32G 1P3FA 3LR5A 3LR4A 5FI6A 2O0YA 1F66A 3O62D 3AZHD 4F3LB 1KX3A 5GT0C 5DNMA 1P34C 4IVKA 5FQQA 3AZLC 4OUIA 3PBQA 3MGQA 1S6RA 5GT0A 1TZYD 4GOGA 5KSHA 2VX8A 3MGRD 3VFFA 3AZJB 2OWHA 4WU8A 5HAIA 1K4EA 1YU1A 3P01A 2G2UA 4OONA 5TR7A 3CMZA 3LFVA 1K6SA 4YM6C 1D1JA 2FFYA 4CLCD 3RELD 3P98A 2W3FA 2D02A 4GKUA 4UAAA 2HIOD 2ZJ9A 1XJ2A 3UB9A 5AVCA 2G5IC 3G34A 3QHYA 3AZMD 3X1VC 1I2WA 2F2AC 2PYOB 3NCKA 2O99A 4LD9A 4P6ZS 3WTPB 1VM1A 4DJ2A 1ERMA 3WS4A 3REHA 4HMDA 3R4KA 3IWIA 3PTEA 3WA9B 4BMWA 4WF0A 4KENB 4RA7A 3X1SB 2PD8A 3ZGAB 5GXQA 4JLFA 4DE3A 2Z6DA 5CPKB 1BYWA 5CPJD 1BLHA 4GHIA 4H9QA 1PWGA 4E3LA 1K4FA 3IXGA 3W96B 5B24A 2DCFA 3MR0A 4PHTA 3UO9A 5CPKC 4BQMA 2O9BA 3AV2B 4G91B 3MNND 4JF6A 1L6JA 1GXDA 3A3IA 5DF9A 4HMCA 1XJ4A 1EAKA 3KS4A 1WYCA 4C75A 4S2KA 3MMHA 5B1LC 2P9VB 4Y15A 3LELA 2E8IA 5B0ZC 3WKJC 3IHBA 3AN2B 3O62C 4GJ4A 4MDZA 3R7WB 4NZ4A 1P3KD 3MS6A 5A90A 1XFNA 2H0TA 4J8UA 1AOIC 4HH3A 3CI6A 3LZ0B 1SCWA 5J8XA 3GMWA 5GXQB 1W1TA 1TS6A 2KOIA 1BZAA 3S7QA 2Y2JA 1T3UA 3REKB 4G3VA 1TZYB 4OLGA 1GOIA 2Z2MB 3L7HA 5LBRA 5KMWA 1DJAA 3UE0A 3T4JA 1BULA 4QLCC 5CPJB 1KX5B 3RELB 3FKEA 1EQZA 2PYOA 1KGEA 3B0DC 5HFOA 1QO6A 3W96D 5B40D 3LIDA 4E3JA 1ZLAC 4IJGA 1L3LA 2XSSA 4QY6A 1NZOA 3E4PA 3L9KA 4KGCC 3L25A 1KDSA 1E25A 3DBAA 4A5RA 3MGSB 3W99C 3ZG0A 4J8VC 3REIA 4KG6A 5BS7C 3P09A 4HBTA 4UQIM 3WTPD 1KGFA 3W99D 2Y2MA 1AXBA 2YFVB 3H82A 4J8WD 3WAAB 3B6GC 1GCEA 3SS3A 3BFEA 1P3AC 4ZUXA 4J8WA 4HOIA 1BH9B 2WZXA 5F82A 3B6GD 4MEZA 3AZKA 4KQOA 2AROB 1E8BA 1PNEA 3W2ZA 2ZM2A 3REKD 2W1RA 3IF6A 3CZDA 1KGGA 1WYBA 4MB5A 2YFWA 3JVVA 3IS2A 4WUJA 3R45A 3S7PA 1P3BB 3IX3A 3B6GB 1P3GA 5BNXA 4XUJD 2P74A 4WJ3C 1LL8A 5B1MC 4G92B 4FUWA 4XUZA 4DRBA 3F1NB 3C2WA 2WKIA 3VSLA 5E2GA 5HWWA 5G18A 3ZG5A 2HIOC 4CLCA 1TD5A 4H9RB 3CHWP 1LI0A 2RL3A 3AZFA 3C5AA 5B0ZD 3WKJD 3PHYA 1W2EA 5AY8B 2GX5A 3UPOA 4IBCA 3AZFC 4FTXA 2A3UA 1TS7A 1UR8A 1KS0A 2J7VA 3UTBC 4KZ3A 2FJ7C 5L8MA 5FQ9A 3PXPA 5B2JC 1VQQA 5B2IC 2PR6A 3QP6A 3AFAC 3IBJA 3LIEA 3OPHA 5HX9A 2ZQCA 5KDMB 2W3HA 4J8XC 3E4QA 2DF4C 3V67A 4D2OA 1ZTUA 2ZOIA 5I94A 3BLMA 4Y0OA 4O7DA 3B6FC 4J8XD 4OJPA 3IWOA 1ODVA 3VH6A 2VGLM 4KUDA 3REIB 2CC1A 1KOUA 3IT9A 1B67A 4J8XB 4H9RA 3M7PA 4XZQA 2NZDB 1STZA 3ZQ5A 3REID 4WBGA 1TDGA 3B6FB 4UA9A 3KSHA 2W1TB 1A0KA 5F68A 2JBFA 3IQAA 4H8RA 2Y2HA 1N9LA 5B1MD 3AYWC 3ICYA 1IYPA 1M18C 4GHAA 1GHMA 4N1XA 2M7UA 2AROA 1YU3A 4S2MA 3AZEB 4Z2MG 3A3EA 5J4EA 3IS2B 1FCMA 3MQLA 3AV2D 3REJA 5G49A 2V20A 3LICA 2HJ9C 2L1MA 1WA9A 4S2LA 3AZIC 5EFWA 3I7JA 4GDNA 4NYUA 3K3CA 4DDSA 4L9FA 2JKRI 4R0QA 1AWIA 3UTAB 4LRYC 1OMEA 1DJBA 2B5RA 3F1NA 4Z2KA 4HI4A 3VH5W 5GLBA 1GPFA 4MMNA 3EOIA 4K0XA 5CHJA 3NIAA 1P3KA 3W4QA 4Z5TC 2EWWA 2DRWA 3MGRC 3AZLB 3LZ0C 3EG5B 3B33A 1W5DA 2CV5C 4LCMA 3N7WA 4II7A 1S4RA 4WU8B 4Z66A 2VGKA 3GRJA 4CLCE 1AOIA 1Q2QA 5CPIC 5CHUA 3Q82A 2RVQD 1FCOA 4KQDA 5BPVA 2V0WA 5EVIC 3CPTA 4X55A 3UY6A 2Y2LA 2RVQC 1OGBA 1LSXA 3KO6A 3X1VD 1LSWA 5CTNA 2J8PA 1ULYA 3FPWA 2B02A 3BYDA 4JKTA 3UB7A 4BWIA 2YKHA 4KZ5A 3X1VB 4IUKA 5CPKA 4NK3A 4EUVA 4P87A 1IKGA 4J8XA 2EXBA 3AL0C 3W99B 4X68A 2EX6A 3GVBA 5AVBD 2VA0A 4OQGA 5FEFA 3OC2A 4X25A 5EOOA 2B18A 1E88A 4ME4A 4LV1A 2PRFA 4EXOA 1BUEA 3H7WA 1MWTA 2HP6A 3WS5A 4HY8A 4PM6A 2H10A 3N8SA 1ERQA 2QMIA 3SH8A 4ETXA 4N9LA 2G5HC 1H0MA 3A3JA 1YU0A 4I3IA 3IH8A 3H0MC 3CG5A 4PKYA 4LRZE 3NOPC 3HBRA 3AZEA 3UN7A 3EPKA 3IBRA 1GSXA 2PBYA 4M6BA 3LJAC 4GHIB 3AYWD 1KE4A 5B1MB 2Y2GA 4G92C 3TRCA 4WU9D 2PYPA 2J9PA 1OTAA 4IBRA 4X6TA 4I38A 4DE1A 4HGAC 2HIOB 3EPJA 3HONA 3MGRA 4RX2A 3QP8A 3C4OA 4R8PC 2RIQA 5B31G 4QNLA 5AV6C 5AY8C 2INWA 5GHZA 1IEMA 4X23B 1P3PC 3W4OA 5A8BA 3HREA 3RELA 3O87A 1EQZB 4IBKA 3VOYA 5JRGC 5GSUC 4DXCA 2QZ6A 1KX4B 1E6PA 1OT9A 5B0YB 2FJ7B 3C8CA 2XD5A 1K0KA 3NDEA 3T12B 3AFAA 3B47A 5L07A 3H82B 3KYEA 2K7SA 1ZKJA 2HDRA 3F6TA 2JKTI 3W99A 1Z6FA 3G2ZA 3G32A 3OPRA 5CPJC 4Z2GA 4WZ5A 5CP6B 1KE3A 2WKQA 4NXEA 3B0DB 4Y0UA 2LY8A 4KGCD 1B6WA 3IXDA 1HTAA 4EEUA 1J3WA 3MGQB 3B3XA 4MB3A 1FILA 1KU5A 5CP6C 3AV2C 3FC7A 3ISGA 3EGDC 5B32D 3MQQA 5A93A 3EQUA 1P3LB 4KUDD 4DDYA 4OOLA 3VSKA 4XUJA 1DP8A 1F2KA 4J8UC 1P34B 4N9KA 1LI9A 2KDKA 4R3JA 4E3IA 4LLOB 4EW7A 5F1GA 5B0ZA 3WKJA 1X0OA 4CSRA 3MVDD 3T1RA 4KHAA 4CAYA 3JVUA 5U47A 4YS3B 3KXBB 2WKHA 2F8ND 3Q07A 1ES4A 5IU1A 5GT3B 1DY6A 3T4SA 3WRTA 1HQ3A 3EGXC 3MGSD 3KSYA 3V9RB 3Q81A 4BL2A 4NE5A 5CPIB 2Y2PA 4R8PD 3MJQA 4NETA 1HQ3D 4JGOA 4OPQA 2PT7A 5HW3A 4XXRA 3WRZA 3PAEA 2V8CA 3VMAA 1M18A 2Z6CA 3C1CA 5AVEA 3S7OA 1ES5A 3WTPC 3W98B 1EQZD 4IEDA 4UPKA 1XX2A 3UTBB 3B6FA 2E8JA 4WM9A 4WN5A 2XR0A 4TX8A 2JKFA 2JN7A 2WGIA 4H6JB 3VOZA 1RGZA 2BLSA 3UNWA 3B0CT 4LFUA 2O9AA 4MCWA 3PYPA 3REJB 2NQBC 3MNNC 1ALQA 1BTLA 4X56A 1XXMA 4XUJC 3UDXA 2NQBD 4Y0TA 1XA1A 3X1TD 4NG2A 1ID3A 2ZLYA 4YM6B 4QHCA 3DW0A 5HPIA 5B24B 5DKKA 1H0IA 3C7UA 3MNNB 3D3OA 4OVDA 1SDEA 3IP4C 3WD4A 1I2SA 3WS1A 2WZZA 4KG2A 4KZ4A 3W98A 1P3GD 3E4OA 2JSSA 1E6NA 4PM7A 3D4FA 4OP8A 4DF6A 4ESPA 5B0ZB 3WKJB 5BT1D 1BSGA 4CSRB 4J8UD 2P9VA 1OJ5A 4HGAB 4EO5B 4BLMA 2HUEC 3AFAD 5L09A 1TEMA 3V9RA 5G49B 2PAVP 1LLBA 3DWZA 3M6BA 3MXQA 3UMDA 5B40C 5AVBA 5FUGA 2ZMAA 2BTFP 1S32A 3LZ1A 4R8PA 5GXQD 3KWQD 1A7WA 3AV1D 3TE8A 3AGDA 1KX4D 3LZ1C 4OJ6A 1S32C 5CGWA 3REHD 3ZNYA 4YNRA 4X1MA 4ARZA 1CEFA 3NC8A 1F66B 1IKIA 1W63M 3REIC 4CPKA 3LGOA 4WLAA 4HJ4A 4H9OA 2H0YA 1TS0A 3MKFA 4KGCB 3EPHA 1RP5A 5E2FA 5FQMA 3SS5A 3PBSA 4J8VB 3RH8B 3AZJA 1DP9A 3NQJB 2HV1A 1K57C 1VHMA 3UE3A 1P3ID 4FD8A 3VH6T 1F9IA 5F69A 3VP3A 4QJGA 3CUEA 4HH2A 4O8GA 5HDSA 3AZNB 3WAAC 3F1PB 1GSVA 1ZG6A 3KS8A 1ID3B 1P3OB 4YFMA 3H7WB 1HD8A 2ZM0A 3C1BB 4Q0IA 1W1YA 4JJNC 1PWDA 4ZUXB 3UDFA 4BJPA 4LENA 4QLCA 1CF0A 1UWNX 4Y3IA 3AZHB 2J8YA 4ZBJC 1KVLA 1PZOA 1XFQA 3A3FA 1P3OC 5G4YA 3A6NA 4EUZA 3AV1B 4QWOA 4B4ZA 3X1TB 3REHB 3T1QB 4UUZB 1ZC2A 2QWSA 3EEAA 5B1LA 4OQHA 4JGQA 4YS3D 2ZQ9A 1P3BD 5AV5D 5B0YA 2YKFA 4P0MA 3AZMA 4RYEA 4U0TA 5HL1A 2XD1A 3L26A 5C5KA 2J3TD 3KWQC 2UV0E 2ZL1B 1ZLAD 2XROA 1GA0A 5FI2A 5FQJA 3HLEA 3D72A 3O86A 5HARA 1DJCA 4KZ8A 2XDMA 1LL5A 5AVCB 3UT9B 4OOYA 3JPUA 1UGUA 1M18D 5DNNC 4R8PB 4ZJ1A 4Z5TA 1Y4OA 2JKRM 5JRGD 4UA7A 1CJFA 4OJ5A 5M19A 5M1AA 3W96A 1S0WA 2JHEA 1QMEA 3KWQA 3WD1A 1NLZA 4WNNB 3O3VA 4UA6A 5DNNB 5AQ9A 5B33B 2ZOHA 4EQ1A 4DJ3A 1KVMA 1L0FA 3AN2A 2HF6A 3NULA 2ZM5A 3EEHA 3HJIA 4IBGA 1XJ3A 1M6KA 3IXBA 4JJND 1WE4A 4OP5A 4G3WA 2NQBB 3KX0X 3LIFA 3LR3A 1CQAA 5DKLA 4N1HA 3MGPB 5DF7A 1P9RA 3O88A 4WU9C 4XT2B 1TZYA 3E2KA 5AJGA 2BYKB 5BT1C 4JXWA 5E5AA 4NXFA 2ZY2A 1YLJA 4CAYB 5CRFA 3A6NB 1I5QA 2Y4AA 1P3LC 4Y7PA 3PAGA 3MGPC 5AV6B 4UUZA 3X1UB 5DNNA 2V5OA 1H8PA 4H9SC 3G2YA 5GSUD 4GH9A 4J8UB 3BRMA 1XJ6A 2VQRA 5DNND 4GZBA 4JF4A 2HUEB 1KX4C 5B1LD 2F8NH 2BG1A 4E6XA 3NJAA 3HLCA 3MFXA 1S32D 1HTZA 2RCXA 5DJTA 2ZY5A 2OLUA 2C5WB 2HDSA 3OZHA 3W97C 3HJKA 3LEQA 3BFGA 1M19A 5CPKD 1MBLA 1TVFA 4YINA 3CITA 3WAAA 3LI9A 1IELA 4K0WA 2FFFB 1F1EA 3C38A 1YSPA 3G35A 5EVIA 1MWSA 4GNUA 3LO7A 3LJAD 3OCNA 4WNNA 4JJNA 1M18B 2WKRA 2A24A 1K25A 1JFIA 5CECA 4BENA 2D49A 1XPBA 3HSHA 3AZGC 4EV4A 3RTYA 5BNXB 4HBUA 2Q0OA 3AGEA 1JWPA 2NQBA 2R9XA 1P34D 4J8WB 2ZC3B 5DNMD 1BLCA 2XA7S 4FOFA 5GHYA 2NUTC 4L9EA 1PWCA 5AQBA 3AZJC 4WU8D 2ZC5B 1ID3C 3BQAA 3FZCA 1YSQA 3Q7VA 3BWLA 4QLCD 3MGRB 1MWUA 3OLOA 4GS9A 5FDSA 3KUYC 4J8WC 3MVDC 4I3JA 1LT0A 1ED7A 1D06A 1NRFA 3P7NA 4YWZA 2W3EA 1NZUA 5FDHA 4RX3A 3KXBC 4U0XA 5EVIB 1S67L 3UB5P 1OTDA 4KZ9A 2HDUA 3PBOA 3AZFB 1XKZA 2V8FA 5AV5A 5AVBB 2GDNA 3WS0A 4IVIA 2FN2A 1K54C 3VE4A 4EEPA 5TJJA 3TJZC 1PI4A 4X53A 4NKPA 3RFBA 3EPLA 1FIKA 3GDIA 5JRGB 1SDNA 4MN6A 3UT9C 4HESA 4DN0A 5B0YD 1XA7A 3HLDA 2DQNC 4J8VA 2WAFA 4WEJA 5EE8A 3W4PA 5GHXA 4Y13A 2Z2LB 5FEGA 4LG2A 3VH5A 1FQGA 1FSYA 3IX8A 4HHDA 5FSRA 5HWTA 1P3MD 2I9VA 3L29A 1H3OA 2WGWA 2V9AA 5FQKA 2K2NA 2A49A 3KYZA 3AZJD 3ZG9B 3TU4D 2L0WA 5A92A 1ZG4A 4UEYA 3AZNA 3FDDA 4G3KA 3OPPA 2V2FF 3LI8A 3WTPA 1V9ZA 4JXSA 4XZQB 4S2JA 3AZFD 4R38A 5DF8A 3BW6A 4EBNA 3HUMA 3ZDJA 5B24D 2WYXA 4B88A 3LELD 5AVFA 1AOIB 3KXBA 4XZQD 2MJ6A 1VEUB 4IBDA 4R6LA 3KFUG 1M1AD 3UPPA 1YM1A 3X1TA 3LZ0D 3AZNC 3N6IA 2CWEA 5TBMA 3N8LA 2AVXA 3A6ND 1F5MA 3W97A 1EWZA 3M2JA 5DTKA 4E04A 2EXAA 4EWFA 2WAEA 4Y2FA 3GTCA 4QLCB 2RTSA 3UTAA 1PZPA 1CXWA 4S2NC 3AGFA 4Y5FA 3C1BA 5B40A 4JXGA 4ZRRA 5IHVA 3A1IA 5D3OA 1HQ3C 3AV1C 2XQZA 3UT9A 3REHC 1P3FB 4M3KA 3CPTB 4MBKA 2Y59A 4QPRA 4F3LA 4MBFA 4LD9C 5B31D 5BS7A 1YQSA 4FCFA 3A1KA 5B32B 1HQ3B 2WKPA 3BQ8A 4EBPA 4R4SA 3AZMB 5HPFA 5E2HA 3V3RA 4DRAA 3AZGD 4AWLC 4HJ6A 3GV9A 5HZHA 1H3OB 3MKEA 3C7VA 3G6OA 1P3AB 1S66L 4WYYA 1ESUA 2IOUA 2EX8A 1E3UA 3WD2A 1M1AB 1YLTA 2ZQAA 4NZ1A 5DNMC 1DRMA 1S4SA 5CPJA 1TF1A 3OCLA 4AWLB 1YU2A 4KUKA 3MNNA 1T1CA 2XLNA 1KX3B 3IF6B 4ZAMA 2BYKA 1FOFA 1BH9A 3B0CW 3VE3A 4OJOA 2GNXA 3BEBA 3BY8A 5DNMB 1NLYA 4E45A 3IF6C 2XRNA 5F99D 3X1UA 2W3DA 4P85A 1EW0A 4B9OA 4K91A 4KQRA 5F99C 5AV6A 1TDLA 1YLZA 5TBMB 2WKEA 2OWJA 2UWXA 3QNBA 4EQIA 3CAXA 4CLCB 4XT2A 2K31A 4HP4A 2Y2IA 3UTBD 4Q0JA 5A91A 3ZNTA 3T1SA 4DXBA 5HDDA 1FR1A 4X23C 1P3PB 5CERA 3WS2A 4ARZB 1LHYA 1IYQA 2JCHA 1JVJA 5E2EA 1P3BA 5AVCC 3Q7ZA 1P3GB 4LGWA 4WU9A 5B0YC 1U35D 4NZ3A 1MPLA 1OJGA 1Z2CB 1GSWA 3UE1A 2PYOC 4B93A 4Z66D 3DTEA 2A24B 4DE0A 2Q9MA 2VKSA 1ESIA 1BH8B 3X1SD 4OPZA 4N92A 1E6ZA 2J3WA 1P3FD 5DTTA 3X1SC 5B31C 2PHYA 2L5AA 1U60A 5HL6A 2NZDA 4XUJB 3A0VA 4GCZA 1P3LA 1P34A 4OH0A 3AYWA 1MKMA 1PZRA 2X01A 4EU0A 3CUEC 3AV2A 4IHQA 3LJAA 1GHPA 1IYSA 1H8YA 3SZTA 2HZ5A 2M1CA 1K38A 4ZBEA 2KLIA 4WU9B 1SZVA 1BFMA 4KHAB 3JYIA 2J9OA 4G91C 1OT6A 2VEAA 3W8KA 4KUDB 2O9CA 3GSGA 3FPVA 4O01A 5F1FA 1D7EA 3ZG7B 3MGSA 3HVFA 3X1UC 2V1BA 3AZLA 2Y2NA 3VP4A 5HDCA 3Q7VB 4GS9B 3LZ0A 5CTMA 3KUYD 3MZFA 5TFQA 4MN7A 2Y79A 2JE5A 3WD0A 2F8NB 3C1BD 4GHLA 3HUNA 3UTBA 3KXBD 5GXQC 3KUYB 5GT3C 3T4KA 1NWZA 1N1JA 1TZYC 1OGGA 4S2IA 2ZBBA 2ZMFA 2R78A 4GD6A 2OAQ1 1P3IB 4D60A 5EPHA 5B33A 5B2IA 3M2KA 1NJ4A 5J7EA 5AV5B 2V1AA 3IWQA 5JYOA 3H0RC 4HIAA 3W98C 1W1VA 5HD5A 5AVCD 3VH6W 1U35A 1MC0A 1ZLAB 4WEKA 1Z09A 1P3IC 1MY8A 2PDRA 4WZSB 1H0GA 4JGRA 3RJUA 4MNRA 2WGWB 5CX7A 2VV6A 1OTIA 2ACGA 1Q9CA 4E6WA 4F94A 1P3LD 5B31A 1PW8A 1T19A 4ZUXC 2YFWB 1KX3D 2ZD8A 3PBRA 5AV8D 1K57A 1M40A 4BD1A 3OOVA 1H5XA 1BLPA 3B6GA 3AZKB 1J9MA 3BFDA 3TOIA 2ZM8A 1W79A 5DVAA 3LEZA 4HNBA 4GN2A 4M4XA 1ONHA 3MBZA 1P0ZA 3R45B 2AROC 2ZMVA 2KX6A 2HP5A 4NEED 1HZOA 1XP4A 4WMCA 3WD3A 5MC7A 1T1BA 1P3BC 3HUOA 1JWVA 2EWVA 1CK3A 2H5SA 1ZLAA 4HMEA 5GT3D 2VK3A 3H9WA 3OBFA 4UHUA 2PYRA 3G4PA 1E15A 5CEDA 3NBLA 3BECA 1EQZC 3C1CD 4I39A 5AVBC 3NECA 2QHKA 3QP1A 1CI9A 4KZ7A 3F1OB 4GW9A 4JPMA 5F99A 3X1UD 5DFYA 3S7NA 1CK7A 4Z66C 2PYOD 1N1JB 5FAOA 5FUGB 1OPXA 3ITAA 1YLPA 3LZ1B 1N4OA 2PU4A 1JFIB 4O0PA 1K56A 5HAPA 5B2JB 5EV0A 4H9QB 3NQJA 2W8SA 1P3AA 5AV9A 1E3UD 3A3DA 3HLBA 3V50A 3AZGA 4R3AA 4Z2MH 1H3QA 5B32A 4QB8A 3DWKA 3NI9A 3TU4A 1KE0A 1UWPX 3HLWA 5AQ7A 2NUPC 5CHMA 4BBUA 5DTSA 1Y54A 3C4PA 5FA7A 2IWBA 2JKGA 4LV0A 3UB8A 5AV6D 3UPNA 1ID3D 4NZ5A 1FSWA 5C3IB 1MWRA 4YOFA 3VH5T 4L9GA 4R1GA 5FQIA 1PDCA 1M1AA 3LCEA 2I72A 2XFTA 4IBXA 4Z2JA 3KSIA 5B1LB 2ZL1A 3H0LC 3QNCA 3A0RA 5CGSA 3AZHC 4I3AA 4WMCD 2G7UA 4EBLA 4ZJ3A 2F8NG 2WUQA 1N9NA 4YS3C 1VB6A 4HP9A 3FV7A 1P3KB 3ZVWA 3LZ1D 3REKA 3MF0A 2PR5A 4KZAA 1E4DA 4S2NA 3UTAC 1ZHHB 2IO5B 3REKC 2EA9A 4NE3A 1JWZA 4GLQA 4QD4A 4OKPA 1O07A 5GLDA 5JRGA 1HLUP 3TSGA 3KWQB 2GJ3A 3NQUB 5BNVA 4Z5TB 3MVDA 5DFXA 3W97D 1W7FA 3A0SA 2DNSA 2XFSA 1KX5C 3PR6A 4KUOA 4PKYG 2FH5A 3BLSA 2OV5A 2IA2A 3HLFA 2IO5C 1W1PA 1G5UA 3C1CC 1LSVA 4ID4A 4Z1WA 2P7JA 5EVID 2QYBA 1P3AD 2QJ7A 3LIAA 4IJFA 4EETB 2P04A 5B32C 3HCYA 4WELA 1PIOA 3LUQA 3C30A 2VV8A 3K2NA 4JXVA 2YFVA 5EECA 3T4QA 2Y91A 1M19D 3MZDA 4E3MA 5F6AA 5AV9B 1MKIA 2F8NK 3AZGB 3V5MA 5HSQA 4GB7A 5B1MA 4R23A 5AV9D 5B33C 4PM9A 3ZYTA 1YUEA 4U3TA 3AZND 4S2PA 3PBNA 2QPNA 5B33D 5AV9C 4BBTA 1TS8A 5B2JD 1BH8A 3ZVTA 3VP0A 2D01A 5L10A 5GT0B 2LB9A 4UQIS 1VEUA 3B42A 4X23A 1L0DA 2AROD 3MVDB 4S2OA 5B24C 4ZTKA 3N4IA 2ZY3A 1P3MB 1ES3A 3O5YA 1V9YA 3VP1A 2Y8HA 1NRJA 3VOLA 2Y2QA 1OTEA 2VJWA 3FG8A 1K54A 4P6BA 3MZEA 3WX7A 3MGPD 3V39A 5E5AC 3N3FA 5FATA 2BYMA 3ITBA 4X69A 4ZDXA 5AY8A 1G6OA 1L0GA 5E5AD 3MGPA 4PM8A 1M19B 1CEGA 2VV7A 3L28A 4C6YA 5GSUA 2R9WA 3KYQA 5CGXA 1AOID 1W63Q 3WA9A 3TW8A 1KX4A 1U35C 1L2SA 4KG5A 4RVAA 3SS4A 3NQUA 5BNVB 1S32B 5L2FA 3WA9C 4E44A 1JTDA 2Q9NA 3SOIA 1RCJA 2FJ7D 1K6RA 5TGFA 4Z5TD 1YLYA 2DMWA 1P3FC 1BT5A 4EESA 1NYYA 4Z2IA 2ZQ7A 4KZBA 3RELC 3ULFA 5B31B 2G2WA 4E3NA 4LCLA 3OPLA 2NZDD 3WWXA 3GECA 5G4ZA 2W27A 3B6FD 4HQAA 3U2AA 1GHIA 5FAPA 2HDQA 3X1SA 1P3IA 1SKFA 5HAQA 4PAUA 2VGJA 3MGQD 1E6RA 1H8ZA 1PRQA 3PBTA 5GT3A 2EFUA 4PMAA 4FH4A 3S4XA 3ZG8B 3MGQC 1IYOA 4WV4B 1OTBA 3AN2C 3AZEC 2ZC6B 2BASA 4ZUXD 1KX3C 3CLOA 4WL9A 3ZFZA 5BOHA 4KUDC 3MXRA 4H9PB 2QJ5A 4QY5A 2HP9A 3UTAD 4CJNA 5FL3A 1ACFA 2WGVA 4Y17A 3F1OA 4GD8A 3T4TA 3AZLD 4H9NA 3AZIA 2Y55A 1KDWA 1WWSA 3IX4A 1G6AA 3S1YA 4MBHA 5JA4B 3IF5A 4NXBA 1IFQA 1F98A 2ZQDA 1K56D 2Y2KA 4B4XA 4YM6D 1KX5D 3VP2A 4OLDA 5CPIA 1MXOA 4Z2LA 2W0NA 1K55C 1VETA 1Q2PA 2CV5A 3AZMC 5EOEA 4E3OA 2EFXA 1XGJA 3WAAD 4E3KA 4FH2A 3T50A 5IT5A 3U4LP 3BJNA 3T4LA 1YT4A 4IJEA 3AV1A 4IBIA 2X71A 3N8RA 1NY0A 3MSHA 4Z2HA 2L4RA 2W3GA 4X1LA 1C3BA 5B2JA 2ZQ8A 1O7EA 4BD0A 1PI5A 2XH9A 5GT0D 3HL9A 3AZKC 3E98A 4LV2A 3W96C 4GDBA 1J7MA 2J3TC 1W8YA 1T1AA 4XZQC 2A2LA 1SKOB 3NOUC 2OAP1 3REJC 3CWFA 5AY8D 3TU4B 1P3PD 3RXWA 4C3QA 2JC7A 4KQQA 2VGLS 1P3MC 4KZ6A 4RQ9A 2HIOA 4CLCC 3A6NC 2F8NA 3FKVA 5DJUA 2VLGA 3K3DA 2CMNA 3GR2A 3KUYA 3DTIA 4BL3A 3QP5A 3TU4C 3EWKA 2ZC7A 4X23D 5E5AB 3UT9D 3FKWA 4H9NB 5JYPA 4XUXA 1P3GC 3NDGA 4R70A 3LY4A 4Q0HA 1AIWA 5FAQA 4MLLA 5AQAA 3NOTC 1EROA 2FJ7A 1LL9A 3S22A 4HEFA 5EUAA 5F5YA 3SW1A 3AFAB 5CXWA 4LD9D 4EO5C 1VETB 2HPBA 4NFTA 5GLAA 2JKTM 4DKIA 3F1PA 4MB4A 2CV5B 2J80A 2WK0A 3IH9A 1FCNA 5CP6D 1CI8A 2EX2A 5EVEA 1YU4A 5KZHA 3UMEA 3ZHHA 4NE6A 5CP6A 1JNUA 5F83A 3V3SA 2PBDP 4KGCA 3AZHA 1JTGA 2XF3A 5AV5C 3LELC 2ZC4B 3T1XA 2HGVA 2FZ0A 3LY3A 4NYYA 1XGIA 2XK1A 5HWVA 1M1AC 5EM0A 4DE2A 4PPRA 3Q1FA 1G68A 1W8QA 4PM5A 5AV8C 4J8VD 4WZ5C 2XA7M 3G30A 1N9BA 3O62B 1TAFB 3AZED 3LELB 4AFIA 1YMXA 3E0YA 3T4OA 3WTPE 2ZY4A 3R7WA 3TG9A 3DTMA 4Q8IA 1P3MA 3BFCA 1S1ZA 3DTKA 3NHQA 1EI5A 2VZWA 5AV8B 3D9YA 1IOUA 3AZKD 1PYYA 3MXSA 1ONGA 2Y2OA 1FR6A 1YLWA 4YS3A 3QP4A 4OPYA 4Z9QA 2C6WB 2BYMB 2M7VA
chains in the Genus database with same CATH topology
3C1BC 1P3PA 2V1ZA 5F99B 1WWIA 4JJNB 2PU2A 1YMSA 4ZBJB 4WZ4A 5FASA 2OSUA 3VFHA 1BLSA 2XGNA 3X1TC 1K55A 3RXXA 3C1CB 4OQ0A 5BO0A 3X1VA 2IWCA 5GLCA 3L2AA 3NY4A 4OJLA 3W98D 5CPID 3AZID 5M18A 1M19C 4JF5A 1R4VA 3FYZA 2XEPA 4OOMA 3E2LA 3IHAA 3HLGA 4Z66B 5B2ID 3WA9D 2X02A 4JBFA 4NY2A 3MFDA 1KX5A 5GSUB 3EQVA 1ES2A 3B0BA 1F66D 3P5JB 4FSFA 1L0EA 4IBJA 3REJD 3O62A 5FI7A 1TAFA 4H9PA 5AV8A 3LJAB 5BO0B 3BFFA 3AYWB 4OQIA 4R3BA 3SH9A 4R4RA 2IWDA 4L0LA 3AZIB 3SH7A 1HVBA 5EVLA 4H9SA 3CJMA 3UDIA 4IBFA 1PW1A 5CEBA 5B2IB 4QU3A 1P3KC 5GL9A 4IBEA 1U35B 4YM6A 3M6HA 5KDMA 1GA9A 4WU8C 4LD9B 5B40B 1SHVA 2WADA 3GQZA 2CV5D 3IXHA 3FWLA 2NZDC 5JA4A 1NYMA 3MGSC 3BM6A 4IBBA 1F66C 4H9OB 1RGYA 4ZJ2A 5KSCA 3L27A 3W97B 2OLVA 5C3IC 4DRTA 5CHLB 1QMFA 1P3OD 4LV3A 4OPRA 3ZCZA 4DQYB 2EX9A 3G31A 3AN2D 5E43A 1NXYA 1P3OA 5B32G 1P3FA 5FI6A 1F66A 3O62D 3AZHD 1KX3A 5GT0C 5DNMA 1P34C 4IVKA 5FQQA 3AZLC 4OUIA 3PBQA 3MGQA 1S6RA 5GT0A 1TZYD 4GOGA 5KSHA 3MGRD 3VFFA 3AZJB 4WU8A 5HAIA 1K4EA 1YU1A 2G2UA 4OONA 5TR7A 3CMZA 1K6SA 4YM6C 2FFYA 3RELD 3P98A 4GKUA 4UAAA 2HIOD 2ZJ9A 5AVCA 2G5IC 3G34A 3QHYA 3AZMD 3X1VC 1I2WA 2F2AC 2PYOB 3NCKA 4LD9A 3WTPB 1VM1A 1ERMA 3WS4A 3REHA 3IWIA 3PTEA 3WA9B 4KENB 4RA7A 3X1SB 3ZGAB 5GXQA 4JLFA 4DE3A 5CPKB 5CPJD 1BLHA 4H9QA 1PWGA 4E3LA 1K4FA 3IXGA 3W96B 5B24A 2DCFA 3UO9A 5CPKC 4BQMA 3AV2B 4G91B 3MNND 4JF6A 3A3IA 5DF9A 3KS4A 1WYCA 4C75A 4S2KA 5B1LC 2P9VB 3LELA 2E8IA 5B0ZC 3WKJC 3IHBA 3AN2B 3O62C 4NZ4A 1P3KD 5A90A 2H0TA 4J8UA 1AOIC 3LZ0B 1SCWA 3GMWA 5GXQB 1BZAA 2Y2JA 1T3UA 3REKB 1TZYB 4OLGA 2Z2MB 5KMWA 1DJAA 3UE0A 1BULA 4QLCC 5CPJB 1KX5B 3RELB 3FKEA 1EQZA 2PYOA 1KGEA 3B0DC 5HFOA 3W96D 5B40D 4E3JA 1ZLAC 4QY6A 1NZOA 4KGCC 3L25A 1KDSA 1E25A 4A5RA 3MGSB 3W99C 3ZG0A 4J8VC 3REIA 4KG6A 5BS7C 3P09A 4HBTA 3WTPD 1KGFA 3W99D 2Y2MA 1AXBA 2YFVB 4J8WD 3WAAB 3B6GC 1GCEA 3SS3A 3BFEA 1P3AC 4ZUXA 4J8WA 1BH9B 2WZXA 5F82A 3B6GD 4MEZA 3AZKA 4KQOA 2AROB 2ZM2A 3REKD 3IF6A 3CZDA 1KGGA 1WYBA 2YFWA 3R45A 1P3BB 3B6GB 1P3GA 5BNXA 4XUJD 2P74A 4WJ3C 5B1MC 4G92B 4XUZA 4DRBA 2WKIA 3VSLA 5E2GA 5G18A 3ZG5A 2HIOC 4H9RB 1LI0A 2RL3A 3AZFA 3C5AA 5B0ZD 3WKJD 1W2EA 5AY8B 3UPOA 4IBCA 3AZFC 2A3UA 2J7VA 3UTBC 4KZ3A 2FJ7C 5FQ9A 5B2JC 1VQQA 5B2IC 3AFAC 3OPHA 5HX9A 2ZQCA 5KDMB 4J8XC 2DF4C 4D2OA 5I94A 3BLMA 4Y0OA 4O7DA 3B6FC 4J8XD 4OJPA 3IWOA 3VH6A 4KUDA 3REIB 2CC1A 3IT9A 1B67A 4J8XB 4H9RA 4XZQA 2NZDB 3REID 4WBGA 1TDGA 3B6FB 4UA9A 2JBFA 4H8RA 3IQAA 2Y2HA 5B1MD 3AYWC 1IYPA 1M18C 4GHAA 1GHMA 4N1XA 2AROA 1YU3A 4S2MA 3AZEB 4Z2MG 3A3EA 1FCMA 3AV2D 3REJA 5G49A 2V20A 4S2LA 3AZIC 3I7JA 4GDNA 4NYUA 4DDSA 4R0QA 3UTAB 1OMEA 1DJBA 2B5RA 3VH5W 5GLBA 4K0XA 5CHJA 3NIAA 1P3KA 3W4QA 4Z5TC 2DRWA 3MGRC 3AZLB 3LZ0C 3EG5B 1W5DA 2CV5C 4LCMA 3N7WA 4WU8B 4Z66A 2VGKA 3GRJA 1AOIA 1Q2QA 5CPIC 5CHUA 3Q82A 2RVQD 1FCOA 5EVIC 5BPVA 4X55A 3UY6A 2Y2LA 2RVQC 3X1VD 5CTNA 2J8PA 1ULYA 3BYDA 4JKTA 4KZ5A 3X1VB 5CPKA 4NK3A 4P87A 1IKGA 4J8XA 2EXBA 3AL0C 3W99B 4X68A 2EX6A 3GVBA 5AVBD 4OQGA 3OC2A 5EOOA 4LV1A 1BUEA 1MWTA 2HP6A 3WS5A 4PM6A 2H10A 3N8SA 1ERQA 2QMIA 3SH8A 4N9LA 2G5HC 3A3JA 1YU0A 3IH8A 3H0MC 3CG5A 3HBRA 3AZEA 3UN7A 3EPKA 2PBYA 4M6BA 3LJAC 3AYWD 1KE4A 5B1MB 2Y2GA 4G92C 4WU9D 2J9PA 4IBRA 4X6TA 4DE1A 4HGAC 2HIOB 3EPJA 3HONA 3MGRA 4RX2A 3C4OA 4R8PC 2RIQA 5B31G 4QNLA 5AV6C 5AY8C 5GHZA 1IEMA 4X23B 1P3PC 3W4OA 3HREA 3RELA 3O87A 1EQZB 4IBKA 3VOYA 5JRGC 5GSUC 4DXCA 2QZ6A 1KX4B 5B0YB 2FJ7B 2XD5A 3NDEA 3AFAA 1ZKJA 2HDRA 3F6TA 3W99A 1Z6FA 3G2ZA 3G32A 3OPRA 5CPJC 4WZ5A 5CP6B 1KE3A 3B0DB 4Y0UA 2LY8A 4KGCD 1B6WA 3IXDA 1HTAA 3B3XA 3MGQB 1KU5A 5CP6C 3AV2C 3ISGA 5B32D 5A93A 3EQUA 1P3LB 4KUDD 4DDYA 4OOLA 3VSKA 4XUJA 4J8UC 1P34B 4N9KA 1LI9A 4R3JA 4E3IA 5F1GA 5B0ZA 3WKJA 4CSRA 3MVDD 4KHAA 4CAYA 5U47A 4YS3B 3KXBB 2WKHA 2F8ND 3Q07A 1ES4A 5GT3B 1DY6A 3WRTA 1HQ3A 3MGSD 3KSYA 3V9RB 3Q81A 4BL2A 4NE5A 5CPIB 2Y2PA 4R8PD 4NETA 1HQ3D 4OPQA 5HW3A 4XXRA 3WRZA 3PAEA 3VMAA 1M18A 3C1CA 1ES5A 3WTPC 3W98B 1EQZD 4IEDA 4UPKA 1XX2A 3UTBB 3B6FA 4WM9A 2XR0A 2WGIA 3VOZA 1RGZA 2BLSA 3UNWA 3B0CT 3REJB 2NQBC 3MNNC 1ALQA 1BTLA 4X56A 1XXMA 4XUJC 3UDXA 2NQBD 4Y0TA 1XA1A 3X1TD 1ID3A 2ZLYA 4YM6B 4QHCA 3DW0A 5B24B 3C7UA 3MNNB 4OVDA 1SDEA 3IP4C 1I2SA 3WS1A 2WZZA 4KG2A 4KZ4A 3W98A 1P3GD 2JSSA 4PM7A 3D4FA 4OP8A 4DF6A 5B0ZB 3WKJB 5BT1D 1BSGA 4CSRB 4J8UD 2P9VA 4HGAB 4EO5B 4BLMA 2HUEC 3AFAD 1TEMA 3V9RA 5G49B 1LLBA 3DWZA 3M6BA 5B40C 5AVBA 5FUGA 2ZMAA 1S32A 3LZ1A 4R8PA 5GXQD 3KWQD 1A7WA 3AV1D 3AGDA 1KX4D 3LZ1C 4OJ6A 1S32C 5CGWA 3REHD 3ZNYA 1CEFA 3NC8A 1F66B 1IKIA 3REIC 4CPKA 4H9OA 2H0YA 3MKFA 4KGCB 3EPHA 1RP5A 5E2FA 5FQMA 3SS5A 3PBSA 4J8VB 3AZJA 3NQJB 1K57C 3UE3A 1P3ID 4FD8A 3VH6T 3VP3A 4QJGA 3AZNB 3WAAC 1ZG6A 3KS8A 1ID3B 1P3OB 4YFMA 1HD8A 2ZM0A 3C1BB 4JJNC 1PWDA 4ZUXB 3UDFA 4BJPA 4LENA 4QLCA 3AZHB 2J8YA 4ZBJC 1KVLA 1PZOA 3A3FA 1P3OC 3A6NA 4EUZA 3AV1B 4B4ZA 3X1TB 3REHB 4UUZB 1ZC2A 5B1LA 4OQHA 4YS3D 2ZQ9A 1P3BD 5AV5D 5B0YA 4P0MA 3AZMA 4RYEA 4U0TA 5HL1A 2XD1A 3L26A 3KWQC 1ZLAD 1GA0A 5FI2A 5FQJA 3HLEA 3O86A 5HARA 1DJCA 4KZ8A 2XDMA 1LL5A 5AVCB 3UT9B 4OOYA 1M18D 5DNNC 4R8PB 4ZJ1A 4Z5TA 5JRGD 4UA7A 4OJ5A 5M19A 5M1AA 3W96A 1S0WA 1QMEA 3KWQA 4WNNB 3O3VA 4UA6A 5DNNB 5AQ9A 5B33B 1KVMA 1L0FA 3AN2A 2ZM5A 4IBGA 3IXBA 1M6KA 4JJND 1WE4A 4OP5A 2NQBB 4N1HA 3MGPB 5DF7A 3O88A 4WU9C 1TZYA 3E2KA 2BYKB 5BT1C 4JXWA 5E5AA 2ZY2A 1YLJA 4CAYB 5CRFA 3A6NB 1I5QA 2Y4AA 1P3LC 4Y7PA 3PAGA 3MGPC 5AV6B 4UUZA 3X1UB 5DNNA 4H9SC 3G2YA 5GSUD 4GH9A 4J8UB 3BRMA 2VQRA 5DNND 4GZBA 4JF4A 2HUEB 1KX4C 5B1LD 2F8NH 2BG1A 4E6XA 3HLCA 1S32D 1HTZA 2RCXA 2ZY5A 2OLUA 2C5WB 2HDSA 3OZHA 3W97C 3BFGA 1M19A 5CPKD 1MBLA 1TVFA 4YINA 3WAAA 1IELA 4K0WA 2FFFB 1F1EA 3G35A 5EVIA 1MWSA 4GNUA 3LO7A 3LJAD 3OCNA 4WNNA 4JJNA 1M18B 1K25A 1JFIA 5CECA 4BENA 1XPBA 3HSHA 3AZGC 4EV4A 5BNXB 4HBUA 3AGEA 1JWPA 2NQBA 2R9XA 1P34D 4J8WB 2ZC3B 5DNMD 1BLCA 5GHYA 5AQBA 1PWCA 3AZJC 4WU8D 2ZC5B 1ID3C 3FZCA 3Q7VA 4QLCD 3MGRB 1MWUA 3KUYC 4J8WC 3MVDC 1NRFA 1NZUA 5FDHA 4RX3A 3KXBC 4U0XA 5EVIB 4KZ9A 2HDUA 3PBOA 3AZFB 1XKZA 5AV5A 5AVBB 2GDNA 3WS0A 4IVIA 1K54C 1PI4A 4X53A 3EPLA 5JRGB 1SDNA 3UT9C 4HESA 5B0YD 1XA7A 3HLDA 2DQNC 4J8VA 2WAFA 4WEJA 5EE8A 3W4PA 5GHXA 2Z2LB 4LG2A 3VH5A 1FQGA 1FSYA 5FSRA 1P3MD 3L29A 1H3OA 2WGWA 5FQKA 2A49A 3AZJD 3ZG9B 3TU4D 5A92A 1ZG4A 3AZNA 3FDDA 3OPPA 2V2FF 3WTPA 4JXSA 4XZQB 4S2JA 3AZFD 5DF8A 4EBNA 3HUMA 3ZDJA 5B24D 2WYXA 4B88A 3LELD 1AOIB 3KXBA 4XZQD 4IBDA 3KFUG 1M1AD 3UPPA 1YM1A 3X1TA 3LZ0D 3AZNC 3N6IA 2CWEA 3N8LA 3A6ND 3W97A 1EWZA 3M2JA 5DTKA 2EXAA 4EWFA 2WAEA 3GTCA 4QLCB 3UTAA 1PZPA 4S2NC 3AGFA 3C1BA 5B40A 4JXGA 5IHVA 3A1IA 5D3OA 1HQ3C 3AV1C 2XQZA 3UT9A 3REHC 1P3FB 4M3KA 4MBKA 2Y59A 4MBFA 4LD9C 5B31D 5BS7A 1YQSA 4FCFA 3A1KA 5B32B 1HQ3B 4EBPA 4R4SA 3AZMB 5E2HA 3V3RA 4DRAA 3AZGD 4AWLC 3GV9A 1H3OB 3MKEA 3C7VA 1P3AB 4WYYA 1ESUA 2IOUA 2EX8A 1E3UA 1M1AB 1YLTA 2ZQAA 4NZ1A 5DNMC 5CPJA 3OCLA 4AWLB 1YU2A 3MNNA 2XLNA 1KX3B 3IF6B 4ZAMA 2BYKA 1FOFA 1BH9A 3B0CW 4OJOA 3BEBA 5DNMB 4E45A 3IF6C 5F99D 3X1UA 4P85A 4K91A 4KQRA 5F99C 5AV6A 1TDLA 1YLZA 2WKEA 2UWXA 3QNBA 4EQIA 5A91A 2Y2IA 3UTBD 3ZNTA 4DXBA 1FR1A 4X23C 1P3PB 5CERA 3WS2A 1LHYA 1IYQA 2JCHA 1JVJA 5E2EA 1P3BA 5AVCC 3Q7ZA 1P3GB 4WU9A 5B0YC 1U35D 4NZ3A 1MPLA 1Z2CB 3UE1A 2PYOC 4Z66D 4DE0A 2Q9MA 1ESIA 1BH8B 3X1SD 4OPZA 4N92A 1P3FD 5DTTA 3X1SC 5B31C 2L5AA 1U60A 2NZDA 4XUJB 1P3LA 1P34A 4OH0A 3AYWA 1PZRA 2X01A 3AV2A 3LJAA 1GHPA 1IYSA 1H8YA 1K38A 4ZBEA 4WU9B 1BFMA 4KHAB 3JYIA 2J9OA 4G91C 3W8KA 4KUDB 3GSGA 5F1FA 3ZG7B 3MGSA 3HVFA 3X1UC 3AZLA 2Y2NA 3VP4A 3Q7VB 5CTMA 3LZ0A 3KUYD 3MZFA 5TFQA 2JE5A 2F8NB 3C1BD 4GHLA 3HUNA 3UTBA 3KXBD 5GXQC 3KUYB 5GT3C 1N1JA 1TZYC 4S2IA 4GD6A 1P3IB 5EPHA 5B33A 5B2IA 3M2KA 1NJ4A 5AV5B 3IWQA 5JYOA 3H0RC 3W98C 5AVCD 3VH6W 1U35A 1ZLAB 4WEKA 1P3IC 1MY8A 3RJUA 4WZSB 4MNRA 2WGWB 1Q9CA 4E6WA 4F94A 1P3LD 5B31A 1PW8A 4ZUXC 2YFWB 1KX3D 2ZD8A 3PBRA 5AV8D 1K57A 1M40A 4BD1A 1H5XA 1BLPA 3B6GA 3AZKB 1J9MA 3BFDA 3TOIA 2ZM8A 1W79A 5DVAA 3LEZA 4GN2A 1ONHA 3MBZA 3R45B 2AROC 2HP5A 1HZOA 1XP4A 4WMCA 1P3BC 3HUOA 1JWVA 1CK3A 2H5SA 1ZLAA 4UHUA 5GT3D 3G4PA 5CEDA 3NBLA 3BECA 1EQZC 3C1CD 5AVBC 1CI9A 4KZ7A 4JPMA 5F99A 3X1UD 4Z66C 2PYOD 1N1JB 5FAOA 5FUGB 3ITAA 1YLPA 3LZ1B 1N4OA 2PU4A 1JFIB 1K56A 5HAPA 5B2JB 4H9QB 3NQJA 2W8SA 1P3AA 5AV9A 1E3UD 3A3DA 3HLBA 3V50A 3AZGA 4Z2MH 5B32A 4QB8A 3DWKA 3NI9A 3TU4A 1KE0A 3HLWA 5AQ7A 5CHMA 5DTSA 1Y54A 3C4PA 5FA7A 2IWBA 4LV0A 5AV6D 3UPNA 1ID3D 4NZ5A 1FSWA 5C3IB 1MWRA 3VH5T 4R1GA 5FQIA 1M1AA 3LCEA 2I72A 2XFTA 4IBXA 5B1LB 3H0LC 3QNCA 5CGSA 3AZHC 4WMCD 4EBLA 4ZJ3A 2F8NG 2WUQA 4YS3C 3FV7A 1P3KB 3ZVWA 3LZ1D 3REKA 4KZAA 1E4DA 4S2NA 3UTAC 2IO5B 3REKC 4NE3A 1JWZA 4QD4A 4OKPA 1O07A 5GLDA 5JRGA 3TSGA 3KWQB 3NQUB 5BNVA 4Z5TB 3MVDA 3W97D 1W7FA 2DNSA 2XFSA 1KX5C 2OV5A 3BLSA 3HLFA 2IO5C 3C1CC 4ID4A 5EVID 1P3AD 4IJFA 4WELA 5B32C 1PIOA 4JXVA 2YFVA 5EECA 2Y91A 1M19D 3MZDA 4E3MA 5AV9B 1MKIA 2F8NK 3AZGB 3V5MA 4GB7A 5B1MA 4R23A 5AV9D 5B33C 4PM9A 1YUEA 4U3TA 3AZND 4S2PA 3PBNA 2QPNA 5B33D 5AV9C 5B2JD 1BH8A 3ZVTA 3VP0A 5GT0B 4X23A 1L0DA 2AROD 3MVDB 4S2OA 5B24C 4ZTKA 3N4IA 2ZY3A 1P3MB 1ES3A 3VP1A 2Y2QA 1K54A 4P6BA 3MZEA 3WX7A 3MGPD 3V39A 5E5AC 3N3FA 5FATA 2BYMA 3ITBA 4X69A 4ZDXA 5AY8A 1L0GA 5E5AD 3MGPA 4PM8A 1M19B 1CEGA 3L28A 4C6YA 5GSUA 2R9WA 5CGXA 1AOID 3WA9A 1KX4A 1U35C 1L2SA 4KG5A 4RVAA 3SS4A 3NQUA 5BNVB 1S32B 5L2FA 3WA9C 4E44A 1JTDA 2Q9NA 3SOIA 1RCJA 2FJ7D 1K6RA 5TGFA 4Z5TD 1YLYA 1P3FC 1BT5A 1NYYA 2ZQ7A 4KZBA 3RELC 5B31B 2G2WA 4E3NA 4LCLA 3OPLA 2NZDD 3WWXA 3B6FD 1GHIA 5FAPA 2HDQA 3X1SA 1P3IA 1SKFA 5HAQA 2VGJA 3MGQD 1H8ZA 3PBTA 5GT3A 2EFUA 4PMAA 4FH4A 3S4XA 3ZG8B 3MGQC 1IYOA 4WV4B 3AN2C 3AZEC 2ZC6B 4ZUXD 1KX3C 3ZFZA 5BOHA 4KUDC 3MXRA 4H9PB 4QY5A 2HP9A 3UTAD 4CJNA 2WGVA 4GD8A 3AZLD 4H9NA 3AZIA 2Y55A 1KDWA 1WWSA 3S1YA 1G6AA 4MBHA 5JA4B 3IF5A 2ZQDA 1K56D 2Y2KA 4B4XA 4YM6D 1KX5D 3VP2A 4OLDA 5CPIA 1MXOA 1K55C 1Q2PA 2CV5A 3AZMC 5EOEA 4E3OA 2EFXA 1XGJA 3WAAD 4E3KA 4FH2A 1YT4A 4IJEA 3AV1A 4IBIA 2X71A 3N8RA 1NY0A 1C3BA 5B2JA 2ZQ8A 1O7EA 4BD0A 1PI5A 2XH9A 5GT0D 3HL9A 3AZKC 4LV2A 3W96C 4GDBA 1W8YA 4XZQC 3REJC 5AY8D 3TU4B 1P3PD 3RXWA 4C3QA 2JC7A 4KQQA 4KZ6A 1P3MC 2HIOA 3A6NC 2F8NA 3FKVA 3GR2A 3KUYA 4BL3A 3TU4C 2ZC7A 4X23D 5E5AB 3UT9D 3FKWA 4H9NB 5JYPA 4XUXA 1P3GC 3NDGA 3LY4A 5FAQA 4MLLA 5AQAA 1EROA 2FJ7A 1LL9A 3S22A 4HEFA 5EUAA 3AFAB 5CXWA 4LD9D 4EO5C 2HPBA 4NFTA 5GLAA 4DKIA 2CV5B 2WK0A 3IH9A 1FCNA 5CP6D 1CI8A 2EX2A 1YU4A 5KZHA 3ZHHA 4NE6A 5CP6A 5F83A 3V3SA 4KGCA 3AZHA 1JTGA 2XF3A 5AV5C 3LELC 2ZC4B 3LY3A 4NYYA 1XGIA 2XK1A 1M1AC 4DE2A 4PPRA 3Q1FA 1G68A 1W8QA 4PM5A 5AV8C 4J8VD 4WZ5C 3G30A 1N9BA 3O62B 1TAFB 3AZED 3LELB 1YMXA 3WTPE 2ZY4A 3TG9A 4Q8IA 3DTMA 1P3MA 3BFCA 1EI5A 5AV8B 3AZKD 1PYYA 3MXSA 1ONGA 2Y2OA 1FR6A 1YLWA 4YS3A 4OPYA 4Z9QA 2C6WB 2BYMB 5J8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWV A;  2V1Z A;  1CK3 A;  1YLJ A;  5GLB A;  5CRF A;  2H5S A;  2PU2 A;  1YMS A;  4UHU A;  4K0X A;  1I5Q A;  5CHJ A;  2Y4A A;  3G4P A;  3NIA A;  3W4Q A;  4Y7P A;  3PAG A;  2DRW A;  5CED A;  3NBL A;  3BEC A;  4WZ4 A;  1W5D A;  5FAS A;  2OSU A;  3VFH A;  1BLS A;  4LCM A;  3N7W A;  3G2Y A;  2XGN A;  1CI9 A;  4KZ7 A;  1K55 A;  2VGK A;  3BRM A;  3GRJ A;  4GZB A;  4JPM A;  1Q2Q A;  5CHU A;  3Q82 A;  4JF4 A;  3RXX A;  4OQ0 A;  1FCO A;  5EVI C;  2BG1 A;  2IWC A;  5GLC A;  4E6X A;  3HLC A;  3NY4 A;  4X55 A;  1HTZ A;  2RCX A;  3UY6 A;  2Y2L A;  2OLU A;  5FAO A;  5M18 A;  2C5W B;  2HDS A;  3ITA A;  4JF5 A;  1YLP A;  3FYZ A;  2XEP A;  4OOM A;  3E2L A;  5CTN A;  3OZH A;  1N4O A;  3IHA A;  3BFG A;  1MBL A;  3HLG A;  2PU4 A;  1TVF A;  3BYD A;  4JKT A;  4YIN A;  1K56 A;  2X02 A;  4JBF A;  5HAP A;  3MFD A;  4KZ5 A;  1IEL A;  4K0W A;  2FFF B;  3EQV A;  3G35 A;  1ES2 A;  1MWS A;  4NK3 A;  5EVI A;  4GNU A;  3LO7 A;  4P87 A;  1IKG A;  2EXB A;  1E3U D;  3A3D A;  3HLB A;  3OCN A;  4X68 A;  3V50 A;  2EX6 A;  3GVB A;  4OQG A;  3OC2 A;  5EOO A;  1K25 A;  4LV1 A;  5CEC A;  4BEN A;  4QB8 A;  4FSF A;  1BUE A;  3DWK A;  1XPB A;  3NI9 A;  1MWT A;  1KE0 A;  2HP6 A;  3HLW A;  5AQ7 A;  4EV4 A;  4HBU A;  1L0E A;  3AGE A;  5CHM A;  5DTS A;  1Y54 A;  3C4P A;  1JWP A;  3WS5 A;  2R9X A;  5FA7 A;  2IWB A;  4PM6 A;  4LV0 A;  2H10 A;  3N8S A;  1ERQ A;  2QMI A;  5FI7 A;  3SH8 A;  3UPN A;  2ZC3 B;  1BLC A;  4N9L A;  1FSW A;  1MWR A;  4R1G A;  3A3J A;  5FQI A;  3IH8 A;  3CG5 A;  5AQB A;  5GHY A;  1PWC A;  3BFF A;  3LCE A;  2ZC5 B;  2I72 A;  4OQI A;  3HBR A;  3FZC A;  4R3B A;  2XFT A;  4IBX A;  3UN7 A;  3Q7V A;  1MWU A;  3QNC A;  3SH9 A;  2PBY A;  5CGS A;  1KE4 A;  4R4R A;  4WMC D;  4EBL A;  2IWD A;  4ZJ3 A;  2WUQ A;  1NRF A;  4L0L A;  2Y2G A;  3SH7 A;  1NZU A;  3FV7 A;  1HVB A;  3ZVW A;  5EVL A;  5FDH A;  2J9P A;  4RX3 A;  3CJM A;  4IBR A;  4U0X A;  5EVI B;  1PW1 A;  4X6T A;  4KZA A;  3UDI A;  5CEB A;  1E4D A;  4S2N A;  4DE1 A;  4KZ9 A;  2HDU A;  4QU3 A;  1JWZ A;  4RX2 A;  3C4O A;  4QD4 A;  5GL9 A;  3PBO A;  1O07 A;  4OKP A;  1XKZ A;  5GLD A;  5GHZ A;  3TSG A;  1IEM A;  3M6H A;  3W4O A;  3HRE A;  1GA9 A;  3O87 A;  2GDN A;  3WS0 A;  1W7F A;  4IVI A;  2DNS A;  2XFS A;  1SHV A;  2WAD A;  2OV5 A;  3VOY A;  1K54 C;  3BLS A;  4DXC A;  3HLF A;  2QZ6 A;  3GQZ A;  4ID4 A;  3IXH A;  1DJB A;  5EVI D;  2XD5 A;  1PI4 A;  3NDE A;  4X53 A;  4WEL A;  3FWL A;  1PIO A;  1SDN A;  1NYM A;  4JXV A;  5EEC A;  2Y91 A;  4HES A;  1XA7 A;  1ZKJ A;  3MZD A;  3BM6 A;  4E3M A;  3HLD A;  2HDR A;  4WEJ A;  1MKI A;  2WAF A;  5EE8 A;  3W4P A;  5GHX A;  1Z6F A;  2Z2L B;  3G2Z A;  1RGY A;  3V5M A;  3G32 A;  3OPR A;  4ZJ2 A;  5KSC A;  4GB7 A;  1FQG A;  1FSY A;  4WZ5 A;  5FSR A;  4R23 A;  1KE3 A;  2OLV A;  4PM9 A;  4Y0U A;  4U3T A;  3IXD A;  4S2P A;  2WGW A;  3PBN A;  2QPN A;  4DRT A;  5FQK A;  4OPR A;  1QMF A;  4LV3 A;  3ZCZ A;  3B3X A;  3VP0 A;  2A49 A;  3ZVT A;  3ZG9 B;  2EX9 A;  5A92 A;  1ZG4 A;  3G31 A;  3OPP A;  5E43 A;  1NXY A;  2V2F F;  1L0D A;  3ISG A;  5FI6 A;  4JXS A;  4S2O A;  5A93 A;  4S2J A;  5DF8 A;  4IVK A;  3EQU A;  5FQQ A;  4EBN A;  3HUM A;  4ZTK A;  3N4I A;  3ZDJ A;  1ES3 A;  3VP1 A;  2WYX A;  4B88 A;  3PBQ A;  4DDY A;  4OOL A;  1S6R A;  3VSK A;  2Y2Q A;  4GOG A;  5KSH A;  4N9K A;  3VFF A;  1K54 A;  4P6B A;  1LI9 A;  3MZE A;  3UPP A;  4R3J A;  1YM1 A;  3V39 A;  4E3I A;  5HAI A;  1K4E A;  5F1G A;  2G2U A;  3N6I A;  4OON A;  5TR7 A;  5FAT A;  3ITB A;  3N8L A;  4X69 A;  4ZDX A;  3CMZ A;  1K6S A;  2FFY A;  1EWZ A;  3M2J A;  3P98 A;  5DTK A;  4PM8 A;  1L0G A;  1CEG A;  2EXA A;  5U47 A;  4EWF A;  2WAE A;  3GTC A;  2WKH A;  4GKU A;  4UAA A;  4C6Y A;  1PZP A;  2ZJ9 A;  4S2N C;  3AGF A;  3Q07 A;  2R9W A;  1ES4 A;  5CGX A;  3G34 A;  3QHY A;  1I2W A;  1DY6 A;  4JXG A;  5IHV A;  3WRT A;  4KG5 A;  1L2S A;  4RVA A;  3SS4 A;  5D3O A;  4BL2 A;  3Q81 A;  5L2F A;  2XQZ A;  3NCK A;  1JTD A;  2Y2P A;  1VM1 A;  2Q9N A;  4M3K A;  4NET A;  3SOI A;  4OPQ A;  1RCJ A;  4MBK A;  2Y59 A;  1ERM A;  4XXR A;  5HW3 A;  3WRZ A;  3PAE A;  3WS4 A;  4MBF A;  3VMA A;  1K6R A;  3IWI A;  4FCF A;  1YQS A;  3PTE A;  5TGF A;  4KEN B;  1YLY A;  4RA7 A;  1ES5 A;  1BT5 A;  4EBP A;  1NYY A;  2ZQ7 A;  4IED A;  4R4S A;  4KZB A;  1XX2 A;  5E2H A;  3V3R A;  3ZGA B;  2G2W A;  4E3N A;  4LCL A;  4WM9 A;  4JLF A;  3GV9 A;  4DE3 A;  3OPL A;  3MKE A;  2XR0 A;  3WWX A;  3C7V A;  2WGI A;  3VOZ A;  4WYY A;  1ESU A;  1RGZ A;  1BLH A;  2EX8 A;  2BLS A;  1GHI A;  3UNW A;  1E3U A;  5FAP A;  1YLT A;  2HDQ A;  1PWG A;  1SKF A;  4E3L A;  5HAQ A;  1K4F A;  2ZQA A;  3IXG A;  2VGJ A;  3OCL A;  2DCF A;  3UO9 A;  2XLN A;  3IF6 B;  4ZAM A;  1H8Z A;  1ALQ A;  4BQM A;  1BTL A;  3PBT A;  4X56 A;  1XXM A;  2EFU A;  4PMA A;  3UDX A;  4FH4 A;  1FOF A;  3S4X A;  3ZG8 B;  4Y0T A;  1IYO A;  4JF6 A;  1XA1 A;  3A3I A;  3BEB A;  5DF9 A;  2ZC6 B;  2ZLY A;  4QHC A;  3DW0 A;  1WYC A;  4C75 A;  4S2K A;  3ZFZ A;  2P9V B;  5BOH A;  3C7U A;  3IF6 C;  2E8I A;  4OVD A;  3IHB A;  3MXR A;  4P85 A;  1SDE A;  4QY5 A;  1I2S A;  3WS1 A;  2HP9 A;  2WZZ A;  4KG2 A;  4CJN A;  4KZ4 A;  4K91 A;  5A90 A;  2H0T A;  2WGV A;  4KQR A;  4GD8 A;  4PM7 A;  3D4F A;  2Y55 A;  4OP8 A;  4DF6 A;  1KDW A;  1SCW A;  1TDL A;  1G6A A;  3GMW A;  1YLZ A;  3S1Y A;  2WKE A;  4MBH A;  1BSG A;  1BZA A;  3IF5 A;  2UWX A;  3QNB A;  2Y2J A;  4EQI A;  2P9V A;  2ZQD A;  1K56 D;  2Y2K A;  4OLG A;  5A91 A;  2Y2I A;  4B4X A;  3ZNT A;  4BLM A;  4DXB A;  2Z2M B;  3VP2 A;  1FR1 A;  1TEM A;  4OLD A;  5KMW A;  1DJA A;  1LLB A;  3DWZ A;  5CER A;  3WS2 A;  3UE0 A;  1BUL A;  1MXO A;  1K55 C;  1LHY A;  1IYQ A;  3M6B A;  2JCH A;  1JVJ A;  5E2E A;  1Q2P A;  2ZMA A;  3Q7Z A;  5EOE A;  4E3O A;  1KGE A;  5HFO A;  1MPL A;  1XGJ A;  2EFX A;  4E3J A;  4E3K A;  4FH2 A;  3AGD A;  3UE1 A;  5CGW A;  3ZNY A;  4QY6 A;  1NZO A;  4DE0 A;  1YT4 A;  1CEF A;  2Q9M A;  3NC8 A;  1KDS A;  1E25 A;  1ESI A;  4A5R A;  1IKI A;  4CPK A;  4OPZ A;  3ZG0 A;  2X71 A;  4KG6 A;  4N92 A;  3P09 A;  4HBT A;  3N8R A;  2H0Y A;  1NY0 A;  1KGF A;  3MKF A;  5DTT A;  2Y2M A;  1AXB A;  1U60 A;  1RP5 A;  5E2F A;  5FQM A;  3SS5 A;  1C3B A;  3PBS A;  2ZQ8 A;  4OH0 A;  1O7E A;  4BD0 A;  1PI5 A;  2XH9 A;  1GCE A;  3SS3 A;  1K57 C;  3UE3 A;  3BFE A;  4FD8 A;  3HL9 A;  2X01 A;  3VP3 A;  4LV2 A;  2WZX A;  5F82 A;  4QJG A;  4MEZ A;  4KQO A;  4GDB A;  1GHP A;  2ZM2 A;  1ZG6 A;  3IF6 A;  3CZD A;  1IYS A;  1KGG A;  1WYB A;  1W8Y A;  1H8Y A;  4YFM A;  1K38 A;  4ZBE A;  1HD8 A;  3RXW A;  2P74 A;  2ZM0 A;  4C3Q A;  2JC7 A;  3JYI A;  1PWD A;  4KZ6 A;  4KQQ A;  3UDF A;  4BJP A;  4LEN A;  2J9O A;  4XUZ A;  3FKV A;  2J8Y A;  1KVL A;  1PZO A;  3W8K A;  3A3F A;  2WKI A;  3GR2 A;  3VSL A;  4BL3 A;  3GSG A;  5E2G A;  4EUZ A;  5G18 A;  5F1F A;  3ZG7 B;  3ZG5 A;  2ZC7 A;  3HVF A;  4B4Z A;  1LI0 A;  2Y2N A;  1ZC2 A;  3FKW A;  3VP4 A;  2RL3 A;  3Q7V B;  4OQH A;  5CTM A;  3MZF A;  4XUX A;  3C5A A;  2ZQ9 A;  3NDG A;  5TFQ A;  3LY4 A;  5FAQ A;  5JYP A;  3UPO A;  4MLL A;  2JE5 A;  5AQA A;  1ERO A;  1LL9 A;  3S22 A;  4P0M A;  4HEF A;  4RYE A;  4U0T A;  3HUN A;  2XD1 A;  5HL1 A;  2A3U A;  5EUA A;  1GA0 A;  5FI2 A;  2J7V A;  5CXW A;  4KZ3 A;  5FQJ A;  3HLE A;  4S2I A;  2HPB A;  3O86 A;  5FQ9 A;  5HAR A;  5GLA A;  1DJC A;  4DKI A;  4KZ8 A;  1VQQ A;  4GD6 A;  2XDM A;  1LL5 A;  5EPH A;  4OOY A;  2WK0 A;  3IH9 A;  1FCN A;  3OPH A;  1CI8 A;  3M2K A;  1NJ4 A;  2ZQC A;  5HX9 A;  4ZJ1 A;  2EX2 A;  3IWQ A;  5JYO A;  4UA7 A;  5KZH A;  3ZHH A;  4D2O A;  5M19 A;  5I94 A;  3BLM A;  4Y0O A;  5M1A A;  4O7D A;  1S0W A;  5F83 A;  3V3S A;  3IWO A;  1QME A;  1JTG A;  4WEK A;  2XF3 A;  3RJU A;  1MY8 A;  3O3V A;  2ZC4 B;  4MNR A;  4UA6 A;  5AQ9 A;  2WGW B;  3LY3 A;  1XGI A;  2CC1 A;  4E6W A;  3IT9 A;  4F94 A;  2XK1 A;  1KVM A;  1L0F A;  4DE2 A;  4PPR A;  3Q1F A;  1G68 A;  4WBG A;  1W8Q A;  4PM5 A;  1TDG A;  4WZ5 C;  4UA9 A;  3G30 A;  1PW8 A;  1N9B A;  2JBF A;  3IQA A;  1YMX A;  2ZD8 A;  4H8R A;  1M6K A;  3IXB A;  2Y2H A;  3PBR A;  1K57 A;  1M40 A;  1WE4 A;  4BD1 A;  1H5X A;  1BLP A;  4OP5 A;  1IYP A;  3TG9 A;  1GHM A;  3DTM A;  4N1X A;  4Q8I A;  1J9M A;  3BFC A;  3BFD A;  3TOI A;  2ZM8 A;  1W79 A;  4S2M A;  5DVA A;  3LEZ A;  1EI5 A;  3A3E A;  4GN2 A;  1ONH A;  3MBZ A;  1FCM A;  2HP5 A;  1HZO A;  2V20 A;  1XP4 A;  4N1H A;  1PYY A;  4S2L A;  5DF7 A;  3MXS A;  4WMC A;  1ONG A;  2Y2O A;  1FR6 A;  1YLW A;  3I7J A;  3O88 A;  4GDN A;  4DDS A;  3E2K A;  4OPY A;  4R0Q A;  4Z9Q A;  3HUO A;  2C6W B;  4JXW A;  1OME A;  2B5R A;  5J8X A; 
#chains in the Genus database with same CATH topology
 3C1B C;  1O6I A;  1P3P A;  2V1Z A;  3VV4 A;  5F99 B;  1WWI A;  4JJN B;  2GZA A;  4CQH A;  2PU2 A;  1YMS A;  4ZBJ B;  4ETZ A;  5J3W A;  4WZ4 A;  5FAS A;  2OSU A;  3VFH A;  1YAX A;  2HJE A;  1BLS A;  4LPZ A;  5HD3 A;  2XGN A;  3X1T C;  1K55 A;  3RXX A;  3C1C B;  4OQ0 A;  5BO0 A;  3X1V A;  2IWC A;  5GLC A;  3L2A A;  3NY4 A;  4OJL A;  3MQO A;  3W98 D;  5CPI D;  3LYX A;  2OOL A;  4JGP A;  3AZI D;  1DP6 A;  4I5S A;  5M18 A;  1M19 C;  2QKP A;  4JF5 A;  1R4V A;  2LB5 A;  3FYZ A;  2XEP A;  4LRX C;  4OOM A;  3E2L A;  3IHA A;  4Z66 B;  3HLG A;  5EM1 A;  2V0U A;  5B2I D;  3WA9 D;  2X02 A;  4JBF A;  2PD7 A;  4NY2 A;  3MFD A;  1KX5 A;  4IUH A;  5GSU B;  3EQV A;  1ES2 A;  3B0B A;  3UB6 A;  1P97 A;  4HJ3 A;  1F66 D;  3P5J B;  4FSF A;  1L0E A;  4IBJ A;  3REJ D;  1G28 A;  3O62 A;  5FI7 A;  1TAF A;  4H9P A;  5AV8 A;  1P9W A;  3DAV A;  3LJA B;  5BO0 B;  3LR0 A;  1YKD A;  3BY9 A;  3BFF A;  3AYW B;  4OQI A;  4R3B A;  5IS1 A;  4H6J A;  4P6Z M;  3SH9 A;  4R4R A;  5I5L A;  2IWD A;  1UR9 A;  4L0L A;  3AZI B;  3SH7 A;  1HVB A;  1MZU A;  5EVL A;  3QP2 A;  4H9S A;  1H8M A;  3CJM A;  3UDI A;  4IBF A;  1PW1 A;  5CEB A;  5B2I B;  1YPR A;  4QU3 A;  3MQ0 A;  1P3K C;  5GL9 A;  4IBE A;  1U35 B;  3KSG A;  1PFL A;  4YM6 A;  3M6H A;  5KDM A;  1GA9 A;  4DMZ A;  4K08 A;  4WU8 C;  4LD9 B;  2P08 A;  5B40 B;  1SHV A;  2WAD A;  4BBV A;  3GQZ A;  3LIB A;  2CV5 D;  1S1Y A;  3IXH A;  3KSF A;  3FWL A;  2NZD C;  2W1T A;  4NXG A;  5JA4 A;  1NYM A;  3MGS C;  3BM6 A;  4IBB A;  5KIZ A;  1F66 C;  4H9O B;  1RGY A;  4ZJ2 A;  3UE6 A;  5KSC A;  3L27 A;  3W97 B;  4EER A;  5K5B A;  1Y28 A;  2OLV A;  2H28 A;  5C3I C;  2B95 A;  4DRT A;  1SKO A;  5CHL B;  1QMF A;  1P3O D;  4LV3 A;  4OPR A;  3ZCZ A;  4DQY B;  4MN5 A;  2EX9 A;  1T18 A;  3G31 A;  3AN2 D;  5E43 A;  1NXY A;  1P3O A;  1N9O A;  5B32 G;  1P3F A;  3LR5 A;  3LR4 A;  5FI6 A;  2O0Y A;  1F66 A;  3O62 D;  3AZH D;  4F3L B;  1KX3 A;  5GT0 C;  5DNM A;  1P34 C;  4IVK A;  5FQQ A;  3AZL C;  4OUI A;  3PBQ A;  3MGQ A;  1S6R A;  5GT0 A;  1TZY D;  4GOG A;  5KSH A;  2VX8 A;  3MGR D;  3VFF A;  3AZJ B;  2OWH A;  4WU8 A;  5HAI A;  1K4E A;  1YU1 A;  3P01 A;  2G2U A;  4OON A;  5TR7 A;  3CMZ A;  3LFV A;  1K6S A;  4YM6 C;  1D1J A;  2FFY A;  4CLC D;  3REL D;  3P98 A;  2W3F A;  2D02 A;  4GKU A;  4UAA A;  2HIO D;  2ZJ9 A;  1XJ2 A;  3UB9 A;  5AVC A;  2G5I C;  3G34 A;  3QHY A;  3AZM D;  3X1V C;  1I2W A;  2F2A C;  2PYO B;  3NCK A;  2O99 A;  4LD9 A;  4P6Z S;  3WTP B;  1VM1 A;  4DJ2 A;  1ERM A;  3WS4 A;  3REH A;  4HMD A;  3R4K A;  3IWI A;  3PTE A;  3WA9 B;  4BMW A;  4WF0 A;  4KEN B;  4RA7 A;  3X1S B;  2PD8 A;  3ZGA B;  5GXQ A;  4JLF A;  4DE3 A;  2Z6D A;  5CPK B;  1BYW A;  5CPJ D;  1BLH A;  4GHI A;  4H9Q A;  1PWG A;  4E3L A;  1K4F A;  3IXG A;  3W96 B;  5B24 A;  2DCF A;  3MR0 A;  4PHT A;  3UO9 A;  5CPK C;  4BQM A;  2O9B A;  3AV2 B;  4G91 B;  3MNN D;  4JF6 A;  1L6J A;  1GXD A;  3A3I A;  5DF9 A;  4HMC A;  1XJ4 A;  1EAK A;  3KS4 A;  1WYC A;  4C75 A;  4S2K A;  3MMH A;  5B1L C;  2P9V B;  4Y15 A;  3LEL A;  2E8I A;  5B0Z C;  3WKJ C;  3IHB A;  3AN2 B;  3O62 C;  4GJ4 A;  4MDZ A;  3R7W B;  4NZ4 A;  1P3K D;  3MS6 A;  5A90 A;  1XFN A;  2H0T A;  4J8U A;  1AOI C;  4HH3 A;  3CI6 A;  3LZ0 B;  1SCW A;  5J8X A;  3GMW A;  5GXQ B;  1W1T A;  1TS6 A;  2KOI A;  1BZA A;  3S7Q A;  2Y2J A;  1T3U A;  3REK B;  4G3V A;  1TZY B;  4OLG A;  1GOI A;  2Z2M B;  3L7H A;  5LBR A;  5KMW A;  1DJA A;  3UE0 A;  3T4J A;  1BUL A;  4QLC C;  5CPJ B;  1KX5 B;  3REL B;  3FKE A;  1EQZ A;  2PYO A;  1KGE A;  3B0D C;  5HFO A;  1QO6 A;  3W96 D;  5B40 D;  3LID A;  4E3J A;  1ZLA C;  4IJG A;  1L3L A;  2XSS A;  4QY6 A;  1NZO A;  3E4P A;  3L9K A;  4KGC C;  3L25 A;  1KDS A;  1E25 A;  3DBA A;  4A5R A;  3MGS B;  3W99 C;  3ZG0 A;  4J8V C;  3REI A;  4KG6 A;  5BS7 C;  3P09 A;  4HBT A;  4UQI M;  3WTP D;  1KGF A;  3W99 D;  2Y2M A;  1AXB A;  2YFV B;  3H82 A;  4J8W D;  3WAA B;  3B6G C;  1GCE A;  3SS3 A;  3BFE A;  1P3A C;  4ZUX A;  4J8W A;  4HOI A;  1BH9 B;  2WZX A;  5F82 A;  3B6G D;  4MEZ A;  3AZK A;  4KQO A;  2ARO B;  1E8B A;  1PNE A;  3W2Z A;  2ZM2 A;  3REK D;  2W1R A;  3IF6 A;  3CZD A;  1KGG A;  1WYB A;  4MB5 A;  2YFW A;  3JVV A;  3IS2 A;  4WUJ A;  3R45 A;  3S7P A;  1P3B B;  3IX3 A;  3B6G B;  1P3G A;  5BNX A;  4XUJ D;  2P74 A;  4WJ3 C;  1LL8 A;  5B1M C;  4G92 B;  4FUW A;  4XUZ A;  4DRB A;  3F1N B;  3C2W A;  2WKI A;  3VSL A;  5E2G A;  5HWW A;  5G18 A;  3ZG5 A;  2HIO C;  4CLC A;  1TD5 A;  4H9R B;  3CHW P;  1LI0 A;  2RL3 A;  3AZF A;  3C5A A;  5B0Z D;  3WKJ D;  3PHY A;  1W2E A;  5AY8 B;  2GX5 A;  3UPO A;  4IBC A;  3AZF C;  4FTX A;  2A3U A;  1TS7 A;  1UR8 A;  1KS0 A;  2J7V A;  3UTB C;  4KZ3 A;  2FJ7 C;  5L8M A;  5FQ9 A;  3PXP A;  5B2J C;  1VQQ A;  5B2I C;  2PR6 A;  3QP6 A;  3AFA C;  3IBJ A;  3LIE A;  3OPH A;  5HX9 A;  2ZQC A;  5KDM B;  2W3H A;  4J8X C;  3E4Q A;  2DF4 C;  3V67 A;  4D2O A;  1ZTU A;  2ZOI A;  5I94 A;  3BLM A;  4Y0O A;  4O7D A;  3B6F C;  4J8X D;  4OJP A;  3IWO A;  1ODV A;  3VH6 A;  2VGL M;  4KUD A;  3REI B;  2CC1 A;  1KOU A;  3IT9 A;  1B67 A;  4J8X B;  4H9R A;  3M7P A;  4XZQ A;  2NZD B;  1STZ A;  3ZQ5 A;  3REI D;  4WBG A;  1TDG A;  3B6F B;  4UA9 A;  3KSH A;  2W1T B;  1A0K A;  5F68 A;  2JBF A;  3IQA A;  4H8R A;  2Y2H A;  1N9L A;  5B1M D;  3AYW C;  3ICY A;  1IYP A;  1M18 C;  4GHA A;  1GHM A;  4N1X A;  2M7U A;  2ARO A;  1YU3 A;  4S2M A;  3AZE B;  4Z2M G;  3A3E A;  5J4E A;  3IS2 B;  1FCM A;  3MQL A;  3AV2 D;  3REJ A;  5G49 A;  2V20 A;  3LIC A;  2HJ9 C;  2L1M A;  1WA9 A;  4S2L A;  3AZI C;  5EFW A;  3I7J A;  4GDN A;  4NYU A;  3K3C A;  4DDS A;  4L9F A;  2JKR I;  4R0Q A;  1AWI A;  3UTA B;  4LRY C;  1OME A;  1DJB A;  2B5R A;  3F1N A;  4Z2K A;  4HI4 A;  3VH5 W;  5GLB A;  1GPF A;  4MMN A;  3EOI A;  4K0X A;  5CHJ A;  3NIA A;  1P3K A;  3W4Q A;  4Z5T C;  2EWW A;  2DRW A;  3MGR C;  3AZL B;  3LZ0 C;  3EG5 B;  3B33 A;  1W5D A;  2CV5 C;  4LCM A;  3N7W A;  4II7 A;  1S4R A;  4WU8 B;  4Z66 A;  2VGK A;  3GRJ A;  4CLC E;  1AOI A;  1Q2Q A;  5CPI C;  5CHU A;  3Q82 A;  2RVQ D;  1FCO A;  4KQD A;  5BPV A;  2V0W A;  5EVI C;  3CPT A;  4X55 A;  3UY6 A;  2Y2L A;  2RVQ C;  1OGB A;  1LSX A;  3KO6 A;  3X1V D;  1LSW A;  5CTN A;  2J8P A;  1ULY A;  3FPW A;  2B02 A;  3BYD A;  4JKT A;  3UB7 A;  4BWI A;  2YKH A;  4KZ5 A;  3X1V B;  4IUK A;  5CPK A;  4NK3 A;  4EUV A;  4P87 A;  1IKG A;  4J8X A;  2EXB A;  3AL0 C;  3W99 B;  4X68 A;  2EX6 A;  3GVB A;  5AVB D;  2VA0 A;  4OQG A;  5FEF A;  3OC2 A;  4X25 A;  5EOO A;  2B18 A;  1E88 A;  4ME4 A;  4LV1 A;  2PRF A;  4EXO A;  1BUE A;  3H7W A;  1MWT A;  2HP6 A;  3WS5 A;  4HY8 A;  4PM6 A;  2H10 A;  3N8S A;  1ERQ A;  2QMI A;  3SH8 A;  4ETX A;  4N9L A;  2G5H C;  1H0M A;  3A3J A;  1YU0 A;  4I3I A;  3IH8 A;  3H0M C;  3CG5 A;  4PKY A;  4LRZ E;  3NOP C;  3HBR A;  3AZE A;  3UN7 A;  3EPK A;  3IBR A;  1GSX A;  2PBY A;  4M6B A;  3LJA C;  4GHI B;  3AYW D;  1KE4 A;  5B1M B;  2Y2G A;  4G92 C;  3TRC A;  4WU9 D;  2PYP A;  2J9P A;  1OTA A;  4IBR A;  4X6T A;  4I38 A;  4DE1 A;  4HGA C;  2HIO B;  3EPJ A;  3HON A;  3MGR A;  4RX2 A;  3QP8 A;  3C4O A;  4R8P C;  2RIQ A;  5B31 G;  4QNL A;  5AV6 C;  5AY8 C;  2INW A;  5GHZ A;  1IEM A;  4X23 B;  1P3P C;  3W4O A;  5A8B A;  3HRE A;  3REL A;  3O87 A;  1EQZ B;  4IBK A;  3VOY A;  5JRG C;  5GSU C;  4DXC A;  2QZ6 A;  1KX4 B;  1E6P A;  1OT9 A;  5B0Y B;  2FJ7 B;  3C8C A;  2XD5 A;  1K0K A;  3NDE A;  3T12 B;  3AFA A;  3B47 A;  5L07 A;  3H82 B;  3KYE A;  2K7S A;  1ZKJ A;  2HDR A;  3F6T A;  2JKT I;  3W99 A;  1Z6F A;  3G2Z A;  3G32 A;  3OPR A;  5CPJ C;  4Z2G A;  4WZ5 A;  5CP6 B;  1KE3 A;  2WKQ A;  4NXE A;  3B0D B;  4Y0U A;  2LY8 A;  4KGC D;  1B6W A;  3IXD A;  1HTA A;  4EEU A;  1J3W A;  3MGQ B;  3B3X A;  4MB3 A;  1FIL A;  1KU5 A;  5CP6 C;  3AV2 C;  3FC7 A;  3ISG A;  3EGD C;  5B32 D;  3MQQ A;  5A93 A;  3EQU A;  1P3L B;  4KUD D;  4DDY A;  4OOL A;  3VSK A;  4XUJ A;  1DP8 A;  1F2K A;  4J8U C;  1P34 B;  4N9K A;  1LI9 A;  2KDK A;  4R3J A;  4E3I A;  4LLO B;  4EW7 A;  5F1G A;  5B0Z A;  3WKJ A;  1X0O A;  4CSR A;  3MVD D;  3T1R A;  4KHA A;  4CAY A;  3JVU A;  5U47 A;  4YS3 B;  3KXB B;  2WKH A;  2F8N D;  3Q07 A;  1ES4 A;  5IU1 A;  5GT3 B;  1DY6 A;  3T4S A;  3WRT A;  1HQ3 A;  3EGX C;  3MGS D;  3KSY A;  3V9R B;  3Q81 A;  4BL2 A;  4NE5 A;  5CPI B;  2Y2P A;  4R8P D;  3MJQ A;  4NET A;  1HQ3 D;  4JGO A;  4OPQ A;  2PT7 A;  5HW3 A;  4XXR A;  3WRZ A;  3PAE A;  2V8C A;  3VMA A;  1M18 A;  2Z6C A;  3C1C A;  5AVE A;  3S7O A;  1ES5 A;  3WTP C;  3W98 B;  1EQZ D;  4IED A;  4UPK A;  1XX2 A;  3UTB B;  3B6F A;  2E8J A;  4WM9 A;  4WN5 A;  2XR0 A;  4TX8 A;  2JKF A;  2JN7 A;  2WGI A;  4H6J B;  3VOZ A;  1RGZ A;  2BLS A;  3UNW A;  3B0C T;  4LFU A;  2O9A A;  4MCW A;  3PYP A;  3REJ B;  2NQB C;  3MNN C;  1ALQ A;  1BTL A;  4X56 A;  1XXM A;  4XUJ C;  3UDX A;  2NQB D;  4Y0T A;  1XA1 A;  3X1T D;  4NG2 A;  1ID3 A;  2ZLY A;  4YM6 B;  4QHC A;  3DW0 A;  5HPI A;  5B24 B;  5DKK A;  1H0I A;  3C7U A;  3MNN B;  3D3O A;  4OVD A;  1SDE A;  3IP4 C;  3WD4 A;  1I2S A;  3WS1 A;  2WZZ A;  4KG2 A;  4KZ4 A;  3W98 A;  1P3G D;  3E4O A;  2JSS A;  1E6N A;  4PM7 A;  3D4F A;  4OP8 A;  4DF6 A;  4ESP A;  5B0Z B;  3WKJ B;  5BT1 D;  1BSG A;  4CSR B;  4J8U D;  2P9V A;  1OJ5 A;  4HGA B;  4EO5 B;  4BLM A;  2HUE C;  3AFA D;  5L09 A;  1TEM A;  3V9R A;  5G49 B;  2PAV P;  1LLB A;  3DWZ A;  3M6B A;  3MXQ A;  3UMD A;  5B40 C;  5AVB A;  5FUG A;  2ZMA A;  2BTF P;  1S32 A;  3LZ1 A;  4R8P A;  5GXQ D;  3KWQ D;  1A7W A;  3AV1 D;  3TE8 A;  3AGD A;  1KX4 D;  3LZ1 C;  4OJ6 A;  1S32 C;  5CGW A;  3REH D;  3ZNY A;  4YNR A;  4X1M A;  4ARZ A;  1CEF A;  3NC8 A;  1F66 B;  1IKI A;  1W63 M;  3REI C;  4CPK A;  3LGO A;  4WLA A;  4HJ4 A;  4H9O A;  2H0Y A;  1TS0 A;  3MKF A;  4KGC B;  3EPH A;  1RP5 A;  5E2F A;  5FQM A;  3SS5 A;  3PBS A;  4J8V B;  3RH8 B;  3AZJ A;  1DP9 A;  3NQJ B;  2HV1 A;  1K57 C;  1VHM A;  3UE3 A;  1P3I D;  4FD8 A;  3VH6 T;  1F9I A;  5F69 A;  3VP3 A;  4QJG A;  3CUE A;  4HH2 A;  4O8G A;  5HDS A;  3AZN B;  3WAA C;  3F1P B;  1GSV A;  1ZG6 A;  3KS8 A;  1ID3 B;  1P3O B;  4YFM A;  3H7W B;  1HD8 A;  2ZM0 A;  3C1B B;  4Q0I A;  1W1Y A;  4JJN C;  1PWD A;  4ZUX B;  3UDF A;  4BJP A;  4LEN A;  4QLC A;  1CF0 A;  1UWN X;  4Y3I A;  3AZH B;  2J8Y A;  4ZBJ C;  1KVL A;  1PZO A;  1XFQ A;  3A3F A;  1P3O C;  5G4Y A;  3A6N A;  4EUZ A;  3AV1 B;  4QWO A;  4B4Z A;  3X1T B;  3REH B;  3T1Q B;  4UUZ B;  1ZC2 A;  2QWS A;  3EEA A;  5B1L A;  4OQH A;  4JGQ A;  4YS3 D;  2ZQ9 A;  1P3B D;  5AV5 D;  5B0Y A;  2YKF A;  4P0M A;  3AZM A;  4RYE A;  4U0T A;  5HL1 A;  2XD1 A;  3L26 A;  5C5K A;  2J3T D;  3KWQ C;  2UV0 E;  2ZL1 B;  1ZLA D;  2XRO A;  1GA0 A;  5FI2 A;  5FQJ A;  3HLE A;  3D72 A;  3O86 A;  5HAR A;  1DJC A;  4KZ8 A;  2XDM A;  1LL5 A;  5AVC B;  3UT9 B;  4OOY A;  3JPU A;  1UGU A;  1M18 D;  5DNN C;  4R8P B;  4ZJ1 A;  4Z5T A;  1Y4O A;  2JKR M;  5JRG D;  4UA7 A;  1CJF A;  4OJ5 A;  5M19 A;  5M1A A;  3W96 A;  1S0W A;  2JHE A;  1QME A;  3KWQ A;  3WD1 A;  1NLZ A;  4WNN B;  3O3V A;  4UA6 A;  5DNN B;  5AQ9 A;  5B33 B;  2ZOH A;  4EQ1 A;  4DJ3 A;  1KVM A;  1L0F A;  3AN2 A;  2HF6 A;  3NUL A;  2ZM5 A;  3EEH A;  3HJI A;  4IBG A;  1XJ3 A;  1M6K A;  3IXB A;  4JJN D;  1WE4 A;  4OP5 A;  4G3W A;  2NQB B;  3KX0 X;  3LIF A;  3LR3 A;  1CQA A;  5DKL A;  4N1H A;  3MGP B;  5DF7 A;  1P9R A;  3O88 A;  4WU9 C;  4XT2 B;  1TZY A;  3E2K A;  5AJG A;  2BYK B;  5BT1 C;  4JXW A;  5E5A A;  4NXF A;  2ZY2 A;  1YLJ A;  4CAY B;  5CRF A;  3A6N B;  1I5Q A;  2Y4A A;  1P3L C;  4Y7P A;  3PAG A;  3MGP C;  5AV6 B;  4UUZ A;  3X1U B;  5DNN A;  2V5O A;  1H8P A;  4H9S C;  3G2Y A;  5GSU D;  4GH9 A;  4J8U B;  3BRM A;  1XJ6 A;  2VQR A;  5DNN D;  4GZB A;  4JF4 A;  2HUE B;  1KX4 C;  5B1L D;  2F8N H;  2BG1 A;  4E6X A;  3NJA A;  3HLC A;  3MFX A;  1S32 D;  1HTZ A;  2RCX A;  5DJT A;  2ZY5 A;  2OLU A;  2C5W B;  2HDS A;  3OZH A;  3W97 C;  3HJK A;  3LEQ A;  3BFG A;  1M19 A;  5CPK D;  1MBL A;  1TVF A;  4YIN A;  3CIT A;  3WAA A;  3LI9 A;  1IEL A;  4K0W A;  2FFF B;  1F1E A;  3C38 A;  1YSP A;  3G35 A;  5EVI A;  1MWS A;  4GNU A;  3LO7 A;  3LJA D;  3OCN A;  4WNN A;  4JJN A;  1M18 B;  2WKR A;  2A24 A;  1K25 A;  1JFI A;  5CEC A;  4BEN A;  2D49 A;  1XPB A;  3HSH A;  3AZG C;  4EV4 A;  3RTY A;  5BNX B;  4HBU A;  2Q0O A;  3AGE A;  1JWP A;  2NQB A;  2R9X A;  1P34 D;  4J8W B;  2ZC3 B;  5DNM D;  1BLC A;  2XA7 S;  4FOF A;  5GHY A;  2NUT C;  4L9E A;  1PWC A;  5AQB A;  3AZJ C;  4WU8 D;  2ZC5 B;  1ID3 C;  3BQA A;  3FZC A;  1YSQ A;  3Q7V A;  3BWL A;  4QLC D;  3MGR B;  1MWU A;  3OLO A;  4GS9 A;  5FDS A;  3KUY C;  4J8W C;  3MVD C;  4I3J A;  1LT0 A;  1ED7 A;  1D06 A;  1NRF A;  3P7N A;  4YWZ A;  2W3E A;  1NZU A;  5FDH A;  4RX3 A;  3KXB C;  4U0X A;  5EVI B;  1S67 L;  3UB5 P;  1OTD A;  4KZ9 A;  2HDU A;  3PBO A;  3AZF B;  1XKZ A;  2V8F A;  5AV5 A;  5AVB B;  2GDN A;  3WS0 A;  4IVI A;  2FN2 A;  1K54 C;  3VE4 A;  4EEP A;  5TJJ A;  3TJZ C;  1PI4 A;  4X53 A;  4NKP A;  3RFB A;  3EPL A;  1FIK A;  3GDI A;  5JRG B;  1SDN A;  4MN6 A;  3UT9 C;  4HES A;  4DN0 A;  5B0Y D;  1XA7 A;  3HLD A;  2DQN C;  4J8V A;  2WAF A;  4WEJ A;  5EE8 A;  3W4P A;  5GHX A;  4Y13 A;  2Z2L B;  5FEG A;  4LG2 A;  3VH5 A;  1FQG A;  1FSY A;  3IX8 A;  4HHD A;  5FSR A;  5HWT A;  1P3M D;  2I9V A;  3L29 A;  1H3O A;  2WGW A;  2V9A A;  5FQK A;  2K2N A;  2A49 A;  3KYZ A;  3AZJ D;  3ZG9 B;  3TU4 D;  2L0W A;  5A92 A;  1ZG4 A;  4UEY A;  3AZN A;  3FDD A;  4G3K A;  3OPP A;  2V2F F;  3LI8 A;  3WTP A;  1V9Z A;  4JXS A;  4XZQ B;  4S2J A;  3AZF D;  4R38 A;  5DF8 A;  3BW6 A;  4EBN A;  3HUM A;  3ZDJ A;  5B24 D;  2WYX A;  4B88 A;  3LEL D;  5AVF A;  1AOI B;  3KXB A;  4XZQ D;  2MJ6 A;  1VEU B;  4IBD A;  4R6L A;  3KFU G;  1M1A D;  3UPP A;  1YM1 A;  3X1T A;  3LZ0 D;  3AZN C;  3N6I A;  2CWE A;  5TBM A;  3N8L A;  2AVX A;  3A6N D;  1F5M A;  3W97 A;  1EWZ A;  3M2J A;  5DTK A;  4E04 A;  2EXA A;  4EWF A;  2WAE A;  4Y2F A;  3GTC A;  4QLC B;  2RTS A;  3UTA A;  1PZP A;  1CXW A;  4S2N C;  3AGF A;  4Y5F A;  3C1B A;  5B40 A;  4JXG A;  4ZRR A;  5IHV A;  3A1I A;  5D3O A;  1HQ3 C;  3AV1 C;  2XQZ A;  3UT9 A;  3REH C;  1P3F B;  4M3K A;  3CPT B;  4MBK A;  2Y59 A;  4QPR A;  4F3L A;  4MBF A;  4LD9 C;  5B31 D;  5BS7 A;  1YQS A;  4FCF A;  3A1K A;  5B32 B;  1HQ3 B;  2WKP A;  3BQ8 A;  4EBP A;  4R4S A;  3AZM B;  5HPF A;  5E2H A;  3V3R A;  4DRA A;  3AZG D;  4AWL C;  4HJ6 A;  3GV9 A;  5HZH A;  1H3O B;  3MKE A;  3C7V A;  3G6O A;  1P3A B;  1S66 L;  4WYY A;  1ESU A;  2IOU A;  2EX8 A;  1E3U A;  3WD2 A;  1M1A B;  1YLT A;  2ZQA A;  4NZ1 A;  5DNM C;  1DRM A;  1S4S A;  5CPJ A;  1TF1 A;  3OCL A;  4AWL B;  1YU2 A;  4KUK A;  3MNN A;  1T1C A;  2XLN A;  1KX3 B;  3IF6 B;  4ZAM A;  2BYK A;  1FOF A;  1BH9 A;  3B0C W;  3VE3 A;  4OJO A;  2GNX A;  3BEB A;  3BY8 A;  5DNM B;  1NLY A;  4E45 A;  3IF6 C;  2XRN A;  5F99 D;  3X1U A;  2W3D A;  4P85 A;  1EW0 A;  4B9O A;  4K91 A;  4KQR A;  5F99 C;  5AV6 A;  1TDL A;  1YLZ A;  5TBM B;  2WKE A;  2OWJ A;  2UWX A;  3QNB A;  4EQI A;  3CAX A;  4CLC B;  4XT2 A;  2K31 A;  4HP4 A;  2Y2I A;  3UTB D;  4Q0J A;  5A91 A;  3ZNT A;  3T1S A;  4DXB A;  5HDD A;  1FR1 A;  4X23 C;  1P3P B;  5CER A;  3WS2 A;  4ARZ B;  1LHY A;  1IYQ A;  2JCH A;  1JVJ A;  5E2E A;  1P3B A;  5AVC C;  3Q7Z A;  1P3G B;  4LGW A;  4WU9 A;  5B0Y C;  1U35 D;  4NZ3 A;  1MPL A;  1OJG A;  1Z2C B;  1GSW A;  3UE1 A;  2PYO C;  4B93 A;  4Z66 D;  3DTE A;  2A24 B;  4DE0 A;  2Q9M A;  2VKS A;  1ESI A;  1BH8 B;  3X1S D;  4OPZ A;  4N92 A;  1E6Z A;  2J3W A;  1P3F D;  5DTT A;  3X1S C;  5B31 C;  2PHY A;  2L5A A;  1U60 A;  5HL6 A;  2NZD A;  4XUJ B;  3A0V A;  4GCZ A;  1P3L A;  1P34 A;  4OH0 A;  3AYW A;  1MKM A;  1PZR A;  2X01 A;  4EU0 A;  3CUE C;  3AV2 A;  4IHQ A;  3LJA A;  1GHP A;  1IYS A;  1H8Y A;  3SZT A;  2HZ5 A;  2M1C A;  1K38 A;  4ZBE A;  2KLI A;  4WU9 B;  1SZV A;  1BFM A;  4KHA B;  3JYI A;  2J9O A;  4G91 C;  1OT6 A;  2VEA A;  3W8K A;  4KUD B;  2O9C A;  3GSG A;  3FPV A;  4O01 A;  5F1F A;  1D7E A;  3ZG7 B;  3MGS A;  3HVF A;  3X1U C;  2V1B A;  3AZL A;  2Y2N A;  3VP4 A;  5HDC A;  3Q7V B;  4GS9 B;  3LZ0 A;  5CTM A;  3KUY D;  3MZF A;  5TFQ A;  4MN7 A;  2Y79 A;  2JE5 A;  3WD0 A;  2F8N B;  3C1B D;  4GHL A;  3HUN A;  3UTB A;  3KXB D;  5GXQ C;  3KUY B;  5GT3 C;  3T4K A;  1NWZ A;  1N1J A;  1TZY C;  1OGG A;  4S2I A;  2ZBB A;  2ZMF A;  2R78 A;  4GD6 A;  2OAQ 1;  1P3I B;  4D60 A;  5EPH A;  5B33 A;  5B2I A;  3M2K A;  1NJ4 A;  5J7E A;  5AV5 B;  2V1A A;  3IWQ A;  5JYO A;  3H0R C;  4HIA A;  3W98 C;  1W1V A;  5HD5 A;  5AVC D;  3VH6 W;  1U35 A;  1MC0 A;  1ZLA B;  4WEK A;  1Z09 A;  1P3I C;  1MY8 A;  2PDR A;  4WZS B;  1H0G A;  4JGR A;  3RJU A;  4MNR A;  2WGW B;  5CX7 A;  2VV6 A;  1OTI A;  2ACG A;  1Q9C A;  4E6W A;  4F94 A;  1P3L D;  5B31 A;  1PW8 A;  1T19 A;  4ZUX C;  2YFW B;  1KX3 D;  2ZD8 A;  3PBR A;  5AV8 D;  1K57 A;  1M40 A;  4BD1 A;  3OOV A;  1H5X A;  1BLP A;  3B6G A;  3AZK B;  1J9M A;  3BFD A;  3TOI A;  2ZM8 A;  1W79 A;  5DVA A;  3LEZ A;  4HNB A;  4GN2 A;  4M4X A;  1ONH A;  3MBZ A;  1P0Z A;  3R45 B;  2ARO C;  2ZMV A;  2KX6 A;  2HP5 A;  4NEE D;  1HZO A;  1XP4 A;  4WMC A;  3WD3 A;  5MC7 A;  1T1B A;  1P3B C;  3HUO A;  1JWV A;  2EWV A;  1CK3 A;  2H5S A;  1ZLA A;  4HME A;  5GT3 D;  2VK3 A;  3H9W A;  3OBF A;  4UHU A;  2PYR A;  3G4P A;  1E15 A;  5CED A;  3NBL A;  3BEC A;  1EQZ C;  3C1C D;  4I39 A;  5AVB C;  3NEC A;  2QHK A;  3QP1 A;  1CI9 A;  4KZ7 A;  3F1O B;  4GW9 A;  4JPM A;  5F99 A;  3X1U D;  5DFY A;  3S7N A;  1CK7 A;  4Z66 C;  2PYO D;  1N1J B;  5FAO A;  5FUG B;  1OPX A;  3ITA A;  1YLP A;  3LZ1 B;  1N4O A;  2PU4 A;  1JFI B;  4O0P A;  1K56 A;  5HAP A;  5B2J B;  5EV0 A;  4H9Q B;  3NQJ A;  2W8S A;  1P3A A;  5AV9 A;  1E3U D;  3A3D A;  3HLB A;  3V50 A;  3AZG A;  4R3A A;  4Z2M H;  1H3Q A;  5B32 A;  4QB8 A;  3DWK A;  3NI9 A;  3TU4 A;  1KE0 A;  1UWP X;  3HLW A;  5AQ7 A;  2NUP C;  5CHM A;  4BBU A;  5DTS A;  1Y54 A;  3C4P A;  5FA7 A;  2IWB A;  2JKG A;  4LV0 A;  3UB8 A;  5AV6 D;  3UPN A;  1ID3 D;  4NZ5 A;  1FSW A;  5C3I B;  1MWR A;  4YOF A;  3VH5 T;  4L9G A;  4R1G A;  5FQI A;  1PDC A;  1M1A A;  3LCE A;  2I72 A;  2XFT A;  4IBX A;  4Z2J A;  3KSI A;  5B1L B;  2ZL1 A;  3H0L C;  3QNC A;  3A0R A;  5CGS A;  3AZH C;  4I3A A;  4WMC D;  2G7U A;  4EBL A;  4ZJ3 A;  2F8N G;  2WUQ A;  1N9N A;  4YS3 C;  1VB6 A;  4HP9 A;  3FV7 A;  1P3K B;  3ZVW A;  3LZ1 D;  3REK A;  3MF0 A;  2PR5 A;  4KZA A;  1E4D A;  4S2N A;  3UTA C;  1ZHH B;  2IO5 B;  3REK C;  2EA9 A;  4NE3 A;  1JWZ A;  4GLQ A;  4QD4 A;  4OKP A;  1O07 A;  5GLD A;  5JRG A;  1HLU P;  3TSG A;  3KWQ B;  2GJ3 A;  3NQU B;  5BNV A;  4Z5T B;  3MVD A;  5DFX A;  3W97 D;  1W7F A;  3A0S A;  2DNS A;  2XFS A;  1KX5 C;  3PR6 A;  4KUO A;  4PKY G;  2FH5 A;  3BLS A;  2OV5 A;  2IA2 A;  3HLF A;  2IO5 C;  1W1P A;  1G5U A;  3C1C C;  1LSV A;  4ID4 A;  4Z1W A;  2P7J A;  5EVI D;  2QYB A;  1P3A D;  2QJ7 A;  3LIA A;  4IJF A;  4EET B;  2P04 A;  5B32 C;  3HCY A;  4WEL A;  1PIO A;  3LUQ A;  3C30 A;  2VV8 A;  3K2N A;  4JXV A;  2YFV A;  5EEC A;  3T4Q A;  2Y91 A;  1M19 D;  3MZD A;  4E3M A;  5F6A A;  5AV9 B;  1MKI A;  2F8N K;  3AZG B;  3V5M A;  5HSQ A;  4GB7 A;  5B1M A;  4R23 A;  5AV9 D;  5B33 C;  4PM9 A;  3ZYT A;  1YUE A;  4U3T A;  3AZN D;  4S2P A;  3PBN A;  2QPN A;  5B33 D;  5AV9 C;  4BBT A;  1TS8 A;  5B2J D;  1BH8 A;  3ZVT A;  3VP0 A;  2D01 A;  5L10 A;  5GT0 B;  2LB9 A;  4UQI S;  1VEU A;  3B42 A;  4X23 A;  1L0D A;  2ARO D;  3MVD B;  4S2O A;  5B24 C;  4ZTK A;  3N4I A;  2ZY3 A;  1P3M B;  1ES3 A;  3O5Y A;  1V9Y A;  3VP1 A;  2Y8H A;  1NRJ A;  3VOL A;  2Y2Q A;  1OTE A;  2VJW A;  3FG8 A;  1K54 A;  4P6B A;  3MZE A;  3WX7 A;  3MGP D;  3V39 A;  5E5A C;  3N3F A;  5FAT A;  2BYM A;  3ITB A;  4X69 A;  4ZDX A;  5AY8 A;  1G6O A;  1L0G A;  5E5A D;  3MGP A;  4PM8 A;  1M19 B;  1CEG A;  2VV7 A;  3L28 A;  4C6Y A;  5GSU A;  2R9W A;  3KYQ A;  5CGX A;  1AOI D;  1W63 Q;  3WA9 A;  3TW8 A;  1KX4 A;  1U35 C;  1L2S A;  4KG5 A;  4RVA A;  3SS4 A;  3NQU A;  5BNV B;  1S32 B;  5L2F A;  3WA9 C;  4E44 A;  1JTD A;  2Q9N A;  3SOI A;  1RCJ A;  2FJ7 D;  1K6R A;  5TGF A;  4Z5T D;  1YLY A;  2DMW A;  1P3F C;  1BT5 A;  4EES A;  1NYY A;  4Z2I A;  2ZQ7 A;  4KZB A;  3REL C;  3ULF A;  5B31 B;  2G2W A;  4E3N A;  4LCL A;  3OPL A;  2NZD D;  3WWX A;  3GEC A;  5G4Z A;  2W27 A;  3B6F D;  4HQA A;  3U2A A;  1GHI A;  5FAP A;  2HDQ A;  3X1S A;  1P3I A;  1SKF A;  5HAQ A;  4PAU A;  2VGJ A;  3MGQ D;  1E6R A;  1H8Z A;  1PRQ A;  3PBT A;  5GT3 A;  2EFU A;  4PMA A;  4FH4 A;  3S4X A;  3ZG8 B;  3MGQ C;  1IYO A;  4WV4 B;  1OTB A;  3AN2 C;  3AZE C;  2ZC6 B;  2BAS A;  4ZUX D;  1KX3 C;  3CLO A;  4WL9 A;  3ZFZ A;  5BOH A;  4KUD C;  3MXR A;  4H9P B;  2QJ5 A;  4QY5 A;  2HP9 A;  3UTA D;  4CJN A;  5FL3 A;  1ACF A;  2WGV A;  4Y17 A;  3F1O A;  4GD8 A;  3T4T A;  3AZL D;  4H9N A;  3AZI A;  2Y55 A;  1KDW A;  1WWS A;  3IX4 A;  1G6A A;  3S1Y A;  4MBH A;  5JA4 B;  3IF5 A;  4NXB A;  1IFQ A;  1F98 A;  2ZQD A;  1K56 D;  2Y2K A;  4B4X A;  4YM6 D;  1KX5 D;  3VP2 A;  4OLD A;  5CPI A;  1MXO A;  4Z2L A;  2W0N A;  1K55 C;  1VET A;  1Q2P A;  2CV5 A;  3AZM C;  5EOE A;  4E3O A;  2EFX A;  1XGJ A;  3WAA D;  4E3K A;  4FH2 A;  3T50 A;  5IT5 A;  3U4L P;  3BJN A;  3T4L A;  1YT4 A;  4IJE A;  3AV1 A;  4IBI A;  2X71 A;  3N8R A;  1NY0 A;  3MSH A;  4Z2H A;  2L4R A;  2W3G A;  4X1L A;  1C3B A;  5B2J A;  2ZQ8 A;  1O7E A;  4BD0 A;  1PI5 A;  2XH9 A;  5GT0 D;  3HL9 A;  3AZK C;  3E98 A;  4LV2 A;  3W96 C;  4GDB A;  1J7M A;  2J3T C;  1W8Y A;  1T1A A;  4XZQ C;  2A2L A;  1SKO B;  3NOU C;  2OAP 1;  3REJ C;  3CWF A;  5AY8 D;  3TU4 B;  1P3P D;  3RXW A;  4C3Q A;  2JC7 A;  4KQQ A;  2VGL S;  1P3M C;  4KZ6 A;  4RQ9 A;  2HIO A;  4CLC C;  3A6N C;  2F8N A;  3FKV A;  5DJU A;  2VLG A;  3K3D A;  2CMN A;  3GR2 A;  3KUY A;  3DTI A;  4BL3 A;  3QP5 A;  3TU4 C;  3EWK A;  2ZC7 A;  4X23 D;  5E5A B;  3UT9 D;  3FKW A;  4H9N B;  5JYP A;  4XUX A;  1P3G C;  3NDG A;  4R70 A;  3LY4 A;  4Q0H A;  1AIW A;  5FAQ A;  4MLL A;  5AQA A;  3NOT C;  1ERO A;  2FJ7 A;  1LL9 A;  3S22 A;  4HEF A;  5EUA A;  5F5Y A;  3SW1 A;  3AFA B;  5CXW A;  4LD9 D;  4EO5 C;  1VET B;  2HPB A;  4NFT A;  5GLA A;  2JKT M;  4DKI A;  3F1P A;  4MB4 A;  2CV5 B;  2J80 A;  2WK0 A;  3IH9 A;  1FCN A;  5CP6 D;  1CI8 A;  2EX2 A;  5EVE A;  1YU4 A;  5KZH A;  3UME A;  3ZHH A;  4NE6 A;  5CP6 A;  1JNU A;  5F83 A;  3V3S A;  2PBD P;  4KGC A;  3AZH A;  1JTG A;  2XF3 A;  5AV5 C;  3LEL C;  2ZC4 B;  3T1X A;  2HGV A;  2FZ0 A;  3LY3 A;  4NYY A;  1XGI A;  2XK1 A;  5HWV A;  1M1A C;  5EM0 A;  4DE2 A;  4PPR A;  3Q1F A;  1G68 A;  1W8Q A;  4PM5 A;  5AV8 C;  4J8V D;  4WZ5 C;  2XA7 M;  3G30 A;  1N9B A;  3O62 B;  1TAF B;  3AZE D;  3LEL B;  4AFI A;  1YMX A;  3E0Y A;  3T4O A;  3WTP E;  2ZY4 A;  3R7W A;  3TG9 A;  3DTM A;  4Q8I A;  1P3M A;  3BFC A;  1S1Z A;  3DTK A;  3NHQ A;  1EI5 A;  2VZW A;  5AV8 B;  3D9Y A;  1IOU A;  3AZK D;  1PYY A;  3MXS A;  1ONG A;  2Y2O A;  1FR6 A;  1YLW A;  4YS3 A;  3QP4 A;  4OPY A;  4Z9Q A;  2C6W B;  2BYM B;  2M7V A; 
#chains in the Genus database with same CATH homology
 3C1B C;  1P3P A;  2V1Z A;  5F99 B;  1WWI A;  4JJN B;  2PU2 A;  1YMS A;  4ZBJ B;  4WZ4 A;  5FAS A;  2OSU A;  3VFH A;  1BLS A;  2XGN A;  3X1T C;  1K55 A;  3RXX A;  3C1C B;  4OQ0 A;  5BO0 A;  3X1V A;  2IWC A;  5GLC A;  3L2A A;  3NY4 A;  4OJL A;  3W98 D;  5CPI D;  3AZI D;  5M18 A;  1M19 C;  4JF5 A;  1R4V A;  3FYZ A;  2XEP A;  4OOM A;  3E2L A;  3IHA A;  3HLG A;  4Z66 B;  5B2I D;  3WA9 D;  2X02 A;  4JBF A;  4NY2 A;  3MFD A;  1KX5 A;  5GSU B;  3EQV A;  1ES2 A;  3B0B A;  1F66 D;  3P5J B;  4FSF A;  1L0E A;  4IBJ A;  3REJ D;  3O62 A;  5FI7 A;  1TAF A;  4H9P A;  5AV8 A;  3LJA B;  5BO0 B;  3BFF A;  3AYW B;  4OQI A;  4R3B A;  3SH9 A;  4R4R A;  2IWD A;  4L0L A;  3AZI B;  3SH7 A;  1HVB A;  5EVL A;  4H9S A;  3CJM A;  3UDI A;  4IBF A;  1PW1 A;  5CEB A;  5B2I B;  4QU3 A;  1P3K C;  5GL9 A;  4IBE A;  1U35 B;  4YM6 A;  3M6H A;  5KDM A;  1GA9 A;  4WU8 C;  4LD9 B;  5B40 B;  1SHV A;  2WAD A;  3GQZ A;  2CV5 D;  3IXH A;  3FWL A;  2NZD C;  5JA4 A;  1NYM A;  3MGS C;  3BM6 A;  4IBB A;  1F66 C;  4H9O B;  1RGY A;  4ZJ2 A;  5KSC A;  3L27 A;  3W97 B;  2OLV A;  5C3I C;  4DRT A;  5CHL B;  1QMF A;  1P3O D;  4LV3 A;  4OPR A;  3ZCZ A;  4DQY B;  2EX9 A;  3G31 A;  3AN2 D;  5E43 A;  1NXY A;  1P3O A;  5B32 G;  1P3F A;  5FI6 A;  1F66 A;  3O62 D;  3AZH D;  1KX3 A;  5GT0 C;  5DNM A;  1P34 C;  4IVK A;  5FQQ A;  3AZL C;  4OUI A;  3PBQ A;  3MGQ A;  1S6R A;  5GT0 A;  1TZY D;  4GOG A;  5KSH A;  3MGR D;  3VFF A;  3AZJ B;  4WU8 A;  5HAI A;  1K4E A;  1YU1 A;  2G2U A;  4OON A;  5TR7 A;  3CMZ A;  1K6S A;  4YM6 C;  2FFY A;  3REL D;  3P98 A;  4GKU A;  4UAA A;  2HIO D;  2ZJ9 A;  5AVC A;  2G5I C;  3G34 A;  3QHY A;  3AZM D;  3X1V C;  1I2W A;  2F2A C;  2PYO B;  3NCK A;  4LD9 A;  3WTP B;  1VM1 A;  1ERM A;  3WS4 A;  3REH A;  3IWI A;  3PTE A;  3WA9 B;  4KEN B;  4RA7 A;  3X1S B;  3ZGA B;  5GXQ A;  4JLF A;  4DE3 A;  5CPK B;  5CPJ D;  1BLH A;  4H9Q A;  1PWG A;  4E3L A;  1K4F A;  3IXG A;  3W96 B;  5B24 A;  2DCF A;  3UO9 A;  5CPK C;  4BQM A;  3AV2 B;  4G91 B;  3MNN D;  4JF6 A;  3A3I A;  5DF9 A;  3KS4 A;  1WYC A;  4C75 A;  4S2K A;  5B1L C;  2P9V B;  3LEL A;  2E8I A;  5B0Z C;  3WKJ C;  3IHB A;  3AN2 B;  3O62 C;  4NZ4 A;  1P3K D;  5A90 A;  2H0T A;  4J8U A;  1AOI C;  3LZ0 B;  1SCW A;  3GMW A;  5GXQ B;  1BZA A;  2Y2J A;  1T3U A;  3REK B;  1TZY B;  4OLG A;  2Z2M B;  5KMW A;  1DJA A;  3UE0 A;  1BUL A;  4QLC C;  5CPJ B;  1KX5 B;  3REL B;  3FKE A;  1EQZ A;  2PYO A;  1KGE A;  3B0D C;  5HFO A;  3W96 D;  5B40 D;  4E3J A;  1ZLA C;  4QY6 A;  1NZO A;  4KGC C;  3L25 A;  1KDS A;  1E25 A;  4A5R A;  3MGS B;  3W99 C;  3ZG0 A;  4J8V C;  3REI A;  4KG6 A;  5BS7 C;  3P09 A;  4HBT A;  3WTP D;  1KGF A;  3W99 D;  2Y2M A;  1AXB A;  2YFV B;  4J8W D;  3WAA B;  3B6G C;  1GCE A;  3SS3 A;  3BFE A;  1P3A C;  4ZUX A;  4J8W A;  1BH9 B;  2WZX A;  5F82 A;  3B6G D;  4MEZ A;  3AZK A;  4KQO A;  2ARO B;  2ZM2 A;  3REK D;  3IF6 A;  3CZD A;  1KGG A;  1WYB A;  2YFW A;  3R45 A;  1P3B B;  3B6G B;  1P3G A;  5BNX A;  4XUJ D;  2P74 A;  4WJ3 C;  5B1M C;  4G92 B;  4XUZ A;  4DRB A;  2WKI A;  3VSL A;  5E2G A;  5G18 A;  3ZG5 A;  2HIO C;  4H9R B;  1LI0 A;  2RL3 A;  3AZF A;  3C5A A;  5B0Z D;  3WKJ D;  1W2E A;  5AY8 B;  3UPO A;  4IBC A;  3AZF C;  2A3U A;  2J7V A;  3UTB C;  4KZ3 A;  2FJ7 C;  5FQ9 A;  5B2J C;  1VQQ A;  5B2I C;  3AFA C;  3OPH A;  5HX9 A;  2ZQC A;  5KDM B;  4J8X C;  2DF4 C;  4D2O A;  5I94 A;  3BLM A;  4Y0O A;  4O7D A;  3B6F C;  4J8X D;  4OJP A;  3IWO A;  3VH6 A;  4KUD A;  3REI B;  2CC1 A;  3IT9 A;  1B67 A;  4J8X B;  4H9R A;  4XZQ A;  2NZD B;  3REI D;  4WBG A;  1TDG A;  3B6F B;  4UA9 A;  2JBF A;  4H8R A;  3IQA A;  2Y2H A;  5B1M D;  3AYW C;  1IYP A;  1M18 C;  4GHA A;  1GHM A;  4N1X A;  2ARO A;  1YU3 A;  4S2M A;  3AZE B;  4Z2M G;  3A3E A;  1FCM A;  3AV2 D;  3REJ A;  5G49 A;  2V20 A;  4S2L A;  3AZI C;  3I7J A;  4GDN A;  4NYU A;  4DDS A;  4R0Q A;  3UTA B;  1OME A;  1DJB A;  2B5R A;  3VH5 W;  5GLB A;  4K0X A;  5CHJ A;  3NIA A;  1P3K A;  3W4Q A;  4Z5T C;  2DRW A;  3MGR C;  3AZL B;  3LZ0 C;  3EG5 B;  1W5D A;  2CV5 C;  4LCM A;  3N7W A;  4WU8 B;  4Z66 A;  2VGK A;  3GRJ A;  1AOI A;  1Q2Q A;  5CPI C;  5CHU A;  3Q82 A;  2RVQ D;  1FCO A;  5EVI C;  5BPV A;  4X55 A;  3UY6 A;  2Y2L A;  2RVQ C;  3X1V D;  5CTN A;  2J8P A;  1ULY A;  3BYD A;  4JKT A;  4KZ5 A;  3X1V B;  5CPK A;  4NK3 A;  4P87 A;  1IKG A;  4J8X A;  2EXB A;  3AL0 C;  3W99 B;  4X68 A;  2EX6 A;  3GVB A;  5AVB D;  4OQG A;  3OC2 A;  5EOO A;  4LV1 A;  1BUE A;  1MWT A;  2HP6 A;  3WS5 A;  4PM6 A;  2H10 A;  3N8S A;  1ERQ A;  2QMI A;  3SH8 A;  4N9L A;  2G5H C;  3A3J A;  1YU0 A;  3IH8 A;  3H0M C;  3CG5 A;  3HBR A;  3AZE A;  3UN7 A;  3EPK A;  2PBY A;  4M6B A;  3LJA C;  3AYW D;  1KE4 A;  5B1M B;  2Y2G A;  4G92 C;  4WU9 D;  2J9P A;  4IBR A;  4X6T A;  4DE1 A;  4HGA C;  2HIO B;  3EPJ A;  3HON A;  3MGR A;  4RX2 A;  3C4O A;  4R8P C;  2RIQ A;  5B31 G;  4QNL A;  5AV6 C;  5AY8 C;  5GHZ A;  1IEM A;  4X23 B;  1P3P C;  3W4O A;  3HRE A;  3REL A;  3O87 A;  1EQZ B;  4IBK A;  3VOY A;  5JRG C;  5GSU C;  4DXC A;  2QZ6 A;  1KX4 B;  5B0Y B;  2FJ7 B;  2XD5 A;  3NDE A;  3AFA A;  1ZKJ A;  2HDR A;  3F6T A;  3W99 A;  1Z6F A;  3G2Z A;  3G32 A;  3OPR A;  5CPJ C;  4WZ5 A;  5CP6 B;  1KE3 A;  3B0D B;  4Y0U A;  2LY8 A;  4KGC D;  1B6W A;  3IXD A;  1HTA A;  3B3X A;  3MGQ B;  1KU5 A;  5CP6 C;  3AV2 C;  3ISG A;  5B32 D;  5A93 A;  3EQU A;  1P3L B;  4KUD D;  4DDY A;  4OOL A;  3VSK A;  4XUJ A;  4J8U C;  1P34 B;  4N9K A;  1LI9 A;  4R3J A;  4E3I A;  5F1G A;  5B0Z A;  3WKJ A;  4CSR A;  3MVD D;  4KHA A;  4CAY A;  5U47 A;  4YS3 B;  3KXB B;  2WKH A;  2F8N D;  3Q07 A;  1ES4 A;  5GT3 B;  1DY6 A;  3WRT A;  1HQ3 A;  3MGS D;  3KSY A;  3V9R B;  3Q81 A;  4BL2 A;  4NE5 A;  5CPI B;  2Y2P A;  4R8P D;  4NET A;  1HQ3 D;  4OPQ A;  5HW3 A;  4XXR A;  3WRZ A;  3PAE A;  3VMA A;  1M18 A;  3C1C A;  1ES5 A;  3WTP C;  3W98 B;  1EQZ D;  4IED A;  4UPK A;  1XX2 A;  3UTB B;  3B6F A;  4WM9 A;  2XR0 A;  2WGI A;  3VOZ A;  1RGZ A;  2BLS A;  3UNW A;  3B0C T;  3REJ B;  2NQB C;  3MNN C;  1ALQ A;  1BTL A;  4X56 A;  1XXM A;  4XUJ C;  3UDX A;  2NQB D;  4Y0T A;  1XA1 A;  3X1T D;  1ID3 A;  2ZLY A;  4YM6 B;  4QHC A;  3DW0 A;  5B24 B;  3C7U A;  3MNN B;  4OVD A;  1SDE A;  3IP4 C;  1I2S A;  3WS1 A;  2WZZ A;  4KG2 A;  4KZ4 A;  3W98 A;  1P3G D;  2JSS A;  4PM7 A;  3D4F A;  4OP8 A;  4DF6 A;  5B0Z B;  3WKJ B;  5BT1 D;  1BSG A;  4CSR B;  4J8U D;  2P9V A;  4HGA B;  4EO5 B;  4BLM A;  2HUE C;  3AFA D;  1TEM A;  3V9R A;  5G49 B;  1LLB A;  3DWZ A;  3M6B A;  5B40 C;  5AVB A;  5FUG A;  2ZMA A;  1S32 A;  3LZ1 A;  4R8P A;  5GXQ D;  3KWQ D;  1A7W A;  3AV1 D;  3AGD A;  1KX4 D;  3LZ1 C;  4OJ6 A;  1S32 C;  5CGW A;  3REH D;  3ZNY A;  1CEF A;  3NC8 A;  1F66 B;  1IKI A;  3REI C;  4CPK A;  4H9O A;  2H0Y A;  3MKF A;  4KGC B;  3EPH A;  1RP5 A;  5E2F A;  5FQM A;  3SS5 A;  3PBS A;  4J8V B;  3AZJ A;  3NQJ B;  1K57 C;  3UE3 A;  1P3I D;  4FD8 A;  3VH6 T;  3VP3 A;  4QJG A;  3AZN B;  3WAA C;  1ZG6 A;  3KS8 A;  1ID3 B;  1P3O B;  4YFM A;  1HD8 A;  2ZM0 A;  3C1B B;  4JJN C;  1PWD A;  4ZUX B;  3UDF A;  4BJP A;  4LEN A;  4QLC A;  3AZH B;  2J8Y A;  4ZBJ C;  1KVL A;  1PZO A;  3A3F A;  1P3O C;  3A6N A;  4EUZ A;  3AV1 B;  4B4Z A;  3X1T B;  3REH B;  4UUZ B;  1ZC2 A;  5B1L A;  4OQH A;  4YS3 D;  2ZQ9 A;  1P3B D;  5AV5 D;  5B0Y A;  4P0M A;  3AZM A;  4RYE A;  4U0T A;  5HL1 A;  2XD1 A;  3L26 A;  3KWQ C;  1ZLA D;  1GA0 A;  5FI2 A;  5FQJ A;  3HLE A;  3O86 A;  5HAR A;  1DJC A;  4KZ8 A;  2XDM A;  1LL5 A;  5AVC B;  3UT9 B;  4OOY A;  1M18 D;  5DNN C;  4R8P B;  4ZJ1 A;  4Z5T A;  5JRG D;  4UA7 A;  4OJ5 A;  5M19 A;  5M1A A;  3W96 A;  1S0W A;  1QME A;  3KWQ A;  4WNN B;  3O3V A;  4UA6 A;  5DNN B;  5AQ9 A;  5B33 B;  1KVM A;  1L0F A;  3AN2 A;  2ZM5 A;  4IBG A;  3IXB A;  1M6K A;  4JJN D;  1WE4 A;  4OP5 A;  2NQB B;  4N1H A;  3MGP B;  5DF7 A;  3O88 A;  4WU9 C;  1TZY A;  3E2K A;  2BYK B;  5BT1 C;  4JXW A;  5E5A A;  2ZY2 A;  1YLJ A;  4CAY B;  5CRF A;  3A6N B;  1I5Q A;  2Y4A A;  1P3L C;  4Y7P A;  3PAG A;  3MGP C;  5AV6 B;  4UUZ A;  3X1U B;  5DNN A;  4H9S C;  3G2Y A;  5GSU D;  4GH9 A;  4J8U B;  3BRM A;  2VQR A;  5DNN D;  4GZB A;  4JF4 A;  2HUE B;  1KX4 C;  5B1L D;  2F8N H;  2BG1 A;  4E6X A;  3HLC A;  1S32 D;  1HTZ A;  2RCX A;  2ZY5 A;  2OLU A;  2C5W B;  2HDS A;  3OZH A;  3W97 C;  3BFG A;  1M19 A;  5CPK D;  1MBL A;  1TVF A;  4YIN A;  3WAA A;  1IEL A;  4K0W A;  2FFF B;  1F1E A;  3G35 A;  5EVI A;  1MWS A;  4GNU A;  3LO7 A;  3LJA D;  3OCN A;  4WNN A;  4JJN A;  1M18 B;  1K25 A;  1JFI A;  5CEC A;  4BEN A;  1XPB A;  3HSH A;  3AZG C;  4EV4 A;  5BNX B;  4HBU A;  3AGE A;  1JWP A;  2NQB A;  2R9X A;  1P34 D;  4J8W B;  2ZC3 B;  5DNM D;  1BLC A;  5GHY A;  5AQB A;  1PWC A;  3AZJ C;  4WU8 D;  2ZC5 B;  1ID3 C;  3FZC A;  3Q7V A;  4QLC D;  3MGR B;  1MWU A;  3KUY C;  4J8W C;  3MVD C;  1NRF A;  1NZU A;  5FDH A;  4RX3 A;  3KXB C;  4U0X A;  5EVI B;  4KZ9 A;  2HDU A;  3PBO A;  3AZF B;  1XKZ A;  5AV5 A;  5AVB B;  2GDN A;  3WS0 A;  4IVI A;  1K54 C;  1PI4 A;  4X53 A;  3EPL A;  5JRG B;  1SDN A;  3UT9 C;  4HES A;  5B0Y D;  1XA7 A;  3HLD A;  2DQN C;  4J8V A;  2WAF A;  4WEJ A;  5EE8 A;  3W4P A;  5GHX A;  2Z2L B;  4LG2 A;  3VH5 A;  1FQG A;  1FSY A;  5FSR A;  1P3M D;  3L29 A;  1H3O A;  2WGW A;  5FQK A;  2A49 A;  3AZJ D;  3ZG9 B;  3TU4 D;  5A92 A;  1ZG4 A;  3AZN A;  3FDD A;  3OPP A;  2V2F F;  3WTP A;  4JXS A;  4XZQ B;  4S2J A;  3AZF D;  5DF8 A;  4EBN A;  3HUM A;  3ZDJ A;  5B24 D;  2WYX A;  4B88 A;  3LEL D;  1AOI B;  3KXB A;  4XZQ D;  4IBD A;  3KFU G;  1M1A D;  3UPP A;  1YM1 A;  3X1T A;  3LZ0 D;  3AZN C;  3N6I A;  2CWE A;  3N8L A;  3A6N D;  3W97 A;  1EWZ A;  3M2J A;  5DTK A;  2EXA A;  4EWF A;  2WAE A;  3GTC A;  4QLC B;  3UTA A;  1PZP A;  4S2N C;  3AGF A;  3C1B A;  5B40 A;  4JXG A;  5IHV A;  3A1I A;  5D3O A;  1HQ3 C;  3AV1 C;  2XQZ A;  3UT9 A;  3REH C;  1P3F B;  4M3K A;  4MBK A;  2Y59 A;  4MBF A;  4LD9 C;  5B31 D;  5BS7 A;  1YQS A;  4FCF A;  3A1K A;  5B32 B;  1HQ3 B;  4EBP A;  4R4S A;  3AZM B;  5E2H A;  3V3R A;  4DRA A;  3AZG D;  4AWL C;  3GV9 A;  1H3O B;  3MKE A;  3C7V A;  1P3A B;  4WYY A;  1ESU A;  2IOU A;  2EX8 A;  1E3U A;  1M1A B;  1YLT A;  2ZQA A;  4NZ1 A;  5DNM C;  5CPJ A;  3OCL A;  4AWL B;  1YU2 A;  3MNN A;  2XLN A;  1KX3 B;  3IF6 B;  4ZAM A;  2BYK A;  1FOF A;  1BH9 A;  3B0C W;  4OJO A;  3BEB A;  5DNM B;  4E45 A;  3IF6 C;  5F99 D;  3X1U A;  4P85 A;  4K91 A;  4KQR A;  5F99 C;  5AV6 A;  1TDL A;  1YLZ A;  2WKE A;  2UWX A;  3QNB A;  4EQI A;  5A91 A;  2Y2I A;  3UTB D;  3ZNT A;  4DXB A;  1FR1 A;  4X23 C;  1P3P B;  5CER A;  3WS2 A;  1LHY A;  1IYQ A;  2JCH A;  1JVJ A;  5E2E A;  1P3B A;  5AVC C;  3Q7Z A;  1P3G B;  4WU9 A;  5B0Y C;  1U35 D;  4NZ3 A;  1MPL A;  1Z2C B;  3UE1 A;  2PYO C;  4Z66 D;  4DE0 A;  2Q9M A;  1ESI A;  1BH8 B;  3X1S D;  4OPZ A;  4N92 A;  1P3F D;  5DTT A;  3X1S C;  5B31 C;  2L5A A;  1U60 A;  2NZD A;  4XUJ B;  1P3L A;  1P34 A;  4OH0 A;  3AYW A;  1PZR A;  2X01 A;  3AV2 A;  3LJA A;  1GHP A;  1IYS A;  1H8Y A;  1K38 A;  4ZBE A;  4WU9 B;  1BFM A;  4KHA B;  3JYI A;  2J9O A;  4G91 C;  3W8K A;  4KUD B;  3GSG A;  5F1F A;  3ZG7 B;  3MGS A;  3HVF A;  3X1U C;  3AZL A;  2Y2N A;  3VP4 A;  3Q7V B;  5CTM A;  3LZ0 A;  3KUY D;  3MZF A;  5TFQ A;  2JE5 A;  2F8N B;  3C1B D;  4GHL A;  3HUN A;  3UTB A;  3KXB D;  5GXQ C;  3KUY B;  5GT3 C;  1N1J A;  1TZY C;  4S2I A;  4GD6 A;  1P3I B;  5EPH A;  5B33 A;  5B2I A;  3M2K A;  1NJ4 A;  5AV5 B;  3IWQ A;  5JYO A;  3H0R C;  3W98 C;  5AVC D;  3VH6 W;  1U35 A;  1ZLA B;  4WEK A;  1P3I C;  1MY8 A;  3RJU A;  4WZS B;  4MNR A;  2WGW B;  1Q9C A;  4E6W A;  4F94 A;  1P3L D;  5B31 A;  1PW8 A;  4ZUX C;  2YFW B;  1KX3 D;  2ZD8 A;  3PBR A;  5AV8 D;  1K57 A;  1M40 A;  4BD1 A;  1H5X A;  1BLP A;  3B6G A;  3AZK B;  1J9M A;  3BFD A;  3TOI A;  2ZM8 A;  1W79 A;  5DVA A;  3LEZ A;  4GN2 A;  1ONH A;  3MBZ A;  3R45 B;  2ARO C;  2HP5 A;  1HZO A;  1XP4 A;  4WMC A;  1P3B C;  3HUO A;  1JWV A;  1CK3 A;  2H5S A;  1ZLA A;  4UHU A;  5GT3 D;  3G4P A;  5CED A;  3NBL A;  3BEC A;  1EQZ C;  3C1C D;  5AVB C;  1CI9 A;  4KZ7 A;  4JPM A;  5F99 A;  3X1U D;  4Z66 C;  2PYO D;  1N1J B;  5FAO A;  5FUG B;  3ITA A;  1YLP A;  3LZ1 B;  1N4O A;  2PU4 A;  1JFI B;  1K56 A;  5HAP A;  5B2J B;  4H9Q B;  3NQJ A;  2W8S A;  1P3A A;  5AV9 A;  1E3U D;  3A3D A;  3HLB A;  3V50 A;  3AZG A;  4Z2M H;  5B32 A;  4QB8 A;  3DWK A;  3NI9 A;  3TU4 A;  1KE0 A;  3HLW A;  5AQ7 A;  5CHM A;  5DTS A;  1Y54 A;  3C4P A;  5FA7 A;  2IWB A;  4LV0 A;  5AV6 D;  3UPN A;  1ID3 D;  4NZ5 A;  1FSW A;  5C3I B;  1MWR A;  3VH5 T;  4R1G A;  5FQI A;  1M1A A;  3LCE A;  2I72 A;  2XFT A;  4IBX A;  5B1L B;  3H0L C;  3QNC A;  5CGS A;  3AZH C;  4WMC D;  4EBL A;  4ZJ3 A;  2F8N G;  2WUQ A;  4YS3 C;  3FV7 A;  1P3K B;  3ZVW A;  3LZ1 D;  3REK A;  4KZA A;  1E4D A;  4S2N A;  3UTA C;  2IO5 B;  3REK C;  4NE3 A;  1JWZ A;  4QD4 A;  4OKP A;  1O07 A;  5GLD A;  5JRG A;  3TSG A;  3KWQ B;  3NQU B;  5BNV A;  4Z5T B;  3MVD A;  3W97 D;  1W7F A;  2DNS A;  2XFS A;  1KX5 C;  2OV5 A;  3BLS A;  3HLF A;  2IO5 C;  3C1C C;  4ID4 A;  5EVI D;  1P3A D;  4IJF A;  4WEL A;  5B32 C;  1PIO A;  4JXV A;  2YFV A;  5EEC A;  2Y91 A;  1M19 D;  3MZD A;  4E3M A;  5AV9 B;  1MKI A;  2F8N K;  3AZG B;  3V5M A;  4GB7 A;  5B1M A;  4R23 A;  5AV9 D;  5B33 C;  4PM9 A;  1YUE A;  4U3T A;  3AZN D;  4S2P A;  3PBN A;  2QPN A;  5B33 D;  5AV9 C;  5B2J D;  1BH8 A;  3ZVT A;  3VP0 A;  5GT0 B;  4X23 A;  1L0D A;  2ARO D;  3MVD B;  4S2O A;  5B24 C;  4ZTK A;  3N4I A;  2ZY3 A;  1P3M B;  1ES3 A;  3VP1 A;  2Y2Q A;  1K54 A;  4P6B A;  3MZE A;  3WX7 A;  3MGP D;  3V39 A;  5E5A C;  3N3F A;  5FAT A;  2BYM A;  3ITB A;  4X69 A;  4ZDX A;  5AY8 A;  1L0G A;  5E5A D;  3MGP A;  4PM8 A;  1M19 B;  1CEG A;  3L28 A;  4C6Y A;  5GSU A;  2R9W A;  5CGX A;  1AOI D;  3WA9 A;  1KX4 A;  1U35 C;  1L2S A;  4KG5 A;  4RVA A;  3SS4 A;  3NQU A;  5BNV B;  1S32 B;  5L2F A;  3WA9 C;  4E44 A;  1JTD A;  2Q9N A;  3SOI A;  1RCJ A;  2FJ7 D;  1K6R A;  5TGF A;  4Z5T D;  1YLY A;  1P3F C;  1BT5 A;  1NYY A;  2ZQ7 A;  4KZB A;  3REL C;  5B31 B;  2G2W A;  4E3N A;  4LCL A;  3OPL A;  2NZD D;  3WWX A;  3B6F D;  1GHI A;  5FAP A;  2HDQ A;  3X1S A;  1P3I A;  1SKF A;  5HAQ A;  2VGJ A;  3MGQ D;  1H8Z A;  3PBT A;  5GT3 A;  2EFU A;  4PMA A;  4FH4 A;  3S4X A;  3ZG8 B;  3MGQ C;  1IYO A;  4WV4 B;  3AN2 C;  3AZE C;  2ZC6 B;  4ZUX D;  1KX3 C;  3ZFZ A;  5BOH A;  4KUD C;  3MXR A;  4H9P B;  4QY5 A;  2HP9 A;  3UTA D;  4CJN A;  2WGV A;  4GD8 A;  3AZL D;  4H9N A;  3AZI A;  2Y55 A;  1KDW A;  1WWS A;  3S1Y A;  1G6A A;  4MBH A;  5JA4 B;  3IF5 A;  2ZQD A;  1K56 D;  2Y2K A;  4B4X A;  4YM6 D;  1KX5 D;  3VP2 A;  4OLD A;  5CPI A;  1MXO A;  1K55 C;  1Q2P A;  2CV5 A;  3AZM C;  5EOE A;  4E3O A;  2EFX A;  1XGJ A;  3WAA D;  4E3K A;  4FH2 A;  1YT4 A;  4IJE A;  3AV1 A;  4IBI A;  2X71 A;  3N8R A;  1NY0 A;  1C3B A;  5B2J A;  2ZQ8 A;  1O7E A;  4BD0 A;  1PI5 A;  2XH9 A;  5GT0 D;  3HL9 A;  3AZK C;  4LV2 A;  3W96 C;  4GDB A;  1W8Y A;  4XZQ C;  3REJ C;  5AY8 D;  3TU4 B;  1P3P D;  3RXW A;  4C3Q A;  2JC7 A;  4KQQ A;  4KZ6 A;  1P3M C;  2HIO A;  3A6N C;  2F8N A;  3FKV A;  3GR2 A;  3KUY A;  4BL3 A;  3TU4 C;  2ZC7 A;  4X23 D;  5E5A B;  3UT9 D;  3FKW A;  4H9N B;  5JYP A;  4XUX A;  1P3G C;  3NDG A;  3LY4 A;  5FAQ A;  4MLL A;  5AQA A;  1ERO A;  2FJ7 A;  1LL9 A;  3S22 A;  4HEF A;  5EUA A;  3AFA B;  5CXW A;  4LD9 D;  4EO5 C;  2HPB A;  4NFT A;  5GLA A;  4DKI A;  2CV5 B;  2WK0 A;  3IH9 A;  1FCN A;  5CP6 D;  1CI8 A;  2EX2 A;  1YU4 A;  5KZH A;  3ZHH A;  4NE6 A;  5CP6 A;  5F83 A;  3V3S A;  4KGC A;  3AZH A;  1JTG A;  2XF3 A;  5AV5 C;  3LEL C;  2ZC4 B;  3LY3 A;  4NYY A;  1XGI A;  2XK1 A;  1M1A C;  4DE2 A;  4PPR A;  3Q1F A;  1G68 A;  1W8Q A;  4PM5 A;  5AV8 C;  4J8V D;  4WZ5 C;  3G30 A;  1N9B A;  3O62 B;  1TAF B;  3AZE D;  3LEL B;  1YMX A;  3WTP E;  2ZY4 A;  3TG9 A;  4Q8I A;  3DTM A;  1P3M A;  3BFC A;  1EI5 A;  5AV8 B;  3AZK D;  1PYY A;  3MXS A;  1ONG A;  2Y2O A;  1FR6 A;  1YLW A;  4YS3 A;  4OPY A;  4Z9Q A;  2C6W B;  2BYM B;  5J8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...