2Y2PA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
489
structure length
466
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 157
structure length 466
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2pA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2pA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2pA02
5GLDA 3VSKA 3ISGA 3QNBA 2X02A 3DTMA 1MWSA 5AQBA 1H5XA 4Q8IA 1NXYA 3IWIA 2WADA 3BFGA 3CMZA 4WZ5C 4BD0A 3OPHA 4BL2A 5E2HA 1MKIA 3PBRA 2EX8A 1Q2PA 4OONA 3IF5A 3MFDA 1XKZA 3W4QA 4KQOA 3RJUA 1IELA 1FCOA 4L0LA 1VQQA 4QB8A 1L0GA 5A93A 4RYEA 5AQ9A 4E3KA 3G34A 1PWDA 2A3UA 4EUZA 3IXGA 1ERQA 4RX3A 4DDSA 4LCMA 4ZDXA 1MPLA 5CERA 1WE4A 1GA0A 2EXAA 3DWKA 3UO9A 3HBRA 2XFTA 3UE3A 2VGKA 5CRFA 1NYMA 4WEJA 4EV4A 5HAQA 1JWPA 1BZAA 3C5AA 2E8IA 2WKIA 5TR7A 3IF6A 4S2KA 2HPBA 2XLNA 1DJBA 4KZ8A 4RA7A 4S2OA 3W4PA 4BL3A 4DKIA 4D2OA 1EROA 1K6SA 1XP4A 3PAGA 2BG1A 4GB7A 2ZLYA 3CZDA 4S2JA 4GD8A 3IF6C 5EOEA 5EE8A 1E25A 1TVFA 1IEMA 3G4PA 1U60A 1W79A 1Q2QA 5CHMA 2V2FF 2ZQ8A 1IKGA 3LEZA 3UDIA 3Q81A 4DE0A 3M2KA 1YQSA 5BOHA 2XF3A 1GHMA 2EFXA 2VGJA 1FSYA 4S2IA 1XGIA 2R9XA 4DE1A 1BLCA 1PWGA 1PZOA 1YLWA 3HLBA 4Y0TA 1PI4A 2WZZA 4KQQA 1FCNA 4S2LA 1IKIA 4OQHA 3N8SA 1L2SA 1O07A 4U3TA 3GTCA 3C7UA 4OPZA 1LL5A 4WEKA 5F83A 4DF6A 2ZM0A 4OPRA 1G68A 5E2FA 1OMEA 1JVJA 4QY6A 3W8KA 4P87A 3A3FA 3QNCA 4GDNA 3BM6A 5HARA 1H8YA 2WZXA 2RCXA 1GHPA 1LI9A 1YT4A 4OP8A 5CTNA 4WM9A 4HBTA 1KGGA 3QHYA 4EQIA 2JCHA 3HLGA 3HLCA 2DNSA 5FQ9A 1K54A 3S22A 4F94A 2X01A 4KG6A 3N6IA 2BLSA 4GZBA 4OLGA 5FI6A 3ZNTA 3OPPA 1K54C 1N9BA 3GR2A 1LL9A 4OQIA 4XXRA 3VP4A 1Y54A 3VOYA 3N8LA 3HREA 4R1GA 2ZQAA 3BFCA 4IBXA 3FYZA 3CG5A 5FSRA 3RXXA 1FSWA 5EUAA 3FZCA 1O7EA 1K56A 4WMCA 5EECA 5GLAA 2H0YA 4X6TA 4FH4A 4UHUA 1YLJA 1EWZA 1GCEA 1XPBA 4JF5A 3D4FA 4M3KA 4ZAMA 4JF6A 2WKHA 3PBTA 1PW1A 2ZQCA 3O88A 4R3JA 4OOLA 5CGWA 3G2YA 5GHZA 5D3OA 4C75A 4RX2A 3CJMA 2ZC3B 5CGSA 3B3XA 3C4OA 3EQVA 4ZJ1A 2EX9A 1W5DA 1K56D 2JBFA 3PBNA 4WMCD 3UPOA 1DY6A 1ES3A 1QMEA 3IHBA 2IWDA 2Y55A 3O3VA 4NK3A 4N1XA 1NZOA 4E6WA 3HUMA 5M19A 4DXBA 5EPHA 1KGEA 3ZCZA 2Y2MA 1WYBA 1JWZA 4LV1A 4UA7A 5FA7A 2Q9NA 3TOIA 3HUOA 3V3RA 1K38A 4E3NA 1CEFA 1CK3A 4JXVA 3VMAA 2ZM2A 4FD8A 4CPKA 1YMXA 4HESA 4R3BA 1SKFA 3ZVTA 3G35A 2Y2PA 3JYIA 4PM8A 3S1YA 1IYPA 4KZAA 4IVIA 4S2NC 1GA9A 1MWRA 3LY4A 4X69A 5A90A 4DE3A 4UA9A 2ZM8A 2H0TA 2OLUA 4GKUA 2J8YA 3M6BA 1ES4A 4K91A 2UWXA 2JE5A 5I94A 4PM9A 3OCNA 3GMWA 4DDYA 2HP9A 4PM5A 2ZQ9A 1ESUA 3FV7A 3MBZA 3WS0A 1PW8A 3UE1A 2V1ZA 3IXBA 3OC2A 2Y59A 4KZ7A 4QD4A 5DF9A 3UY6A 4DXCA 1MWTA 4LV0A 5M18A 1KE4A 5TFQA 5DTSA 1SDEA 3MZEA 1MBLA 2ZJ9A 4DE2A 3MXRA 4GOGA 5JYPA 1W7FA 1TEMA 1ZG4A 2P9VB 1NRFA 5FQQA 3BRMA 4E3LA 4BQMA 4OOMA 4P85A 5HAIA 1ERMA 2Z2LB 4N9LA 3WS1A 2H10A 1GHIA 1SDNA 2ZD8A 5CTMA 3Q82A 3VP3A 4HBUA 4WYYA 3ZG5A 3IT9A 4N92A 4R0QA 4U0TA 4DRTA 1HTZA 4KG2A 3V39A 1YM1A 2HP6A 3C4PA 3AGFA 3PBSA 4MBKA 4WZ4A 1PZPA 3Q07A 2HP5A 5IHVA 2ZC5B 3Q1FA 4KG5A 3PBQA 1RP5A 4PPRA 5F1FA 2IWBA 4B88A 2Y2LA 4PMAA 3LCEA 1FCMA 3IH8A 2GDNA 3NDGA 3ZNYA 4KZBA 3IH9A 5CHJA 5CECA 5A92A 1Z6FA 2J7VA 5DF7A 4LCLA 4ZJ2A 3ITAA 1KGFA 4IEDA 3MKEA 1XGJA 1KDWA 4K0XA 4HEFA 4PM6A 3V50A 3ZHHA 2RL3A 3ZG7B 3LO7A 2JC7A 3NIAA 3ZDJA 3GSGA 1FOFA 1MXOA 3NI9A 1IYQA 1CI8A 2CC1A 3WWXA 3OPRA 4N1HA 1K57A 2Q9MA 1ONGA 2EX6A 4FSFA 1S0WA 4KZ6A 3HL9A 3ZG8B 1ZG6A 4IVKA 5FQMA 2WAFA 4C6YA 2QPNA 3GRJA 2XFSA 3P98A 2EXBA 3MKFA 1K57C 1M40A 3A3JA 2QZ6A 3N8RA 3O86A 3TSGA 2J9PA 3VP1A 1ALQA 2P9VA 3M2JA 4GN2A 5KSCA 3RXWA 5DF8A 5A91A 5EVLA 3A3DA 1TDGA 3NC8A 3SOIA 1XA7A 5FQKA 3MZFA 1FQGA 1ZC2A 3Q7ZA 3W4OA 3UDXA 3N7WA 1JTGA 2WUQA 2XQZA 4BJPA 4JF4A 1YLYA 4KZ4A 2PU4A 4GNUA 4OQGA 5EVIB 2DCFA 4X68A 5FASA 5E43A 5HAPA 1SHVA 1LLBA 2ZQ7A 3FKWA 1NJ4A 1NYYA 3BECA 4IBRA 5L2FA 3ZVWA 4UA6A 1WYCA 3BFFA 3PTEA 3SH9A 4KZ3A 3OPLA 2V20A 5JYOA 1YLPA 5F82A 1I5QA 1BLPA 1BUEA 3HLEA 5CGXA 3MZDA 1SCWA 2I72A 2ZC4B 3Q7VB 1XA1A 2FFFB 1C3BA 4JBFA 1YLTA 1VM1A 5DVAA 4OP5A 2Y2OA 3DW0A 1H8ZA 3I7JA 3SS3A 2Y2QA 1JWVA 1L0FA 1LHYA 3IWQA 2XD1A 1PYYA 3ZGAB 1K55A 1ONHA 1K4FA 4OPYA 5F1GA 4JXWA 1CI9A 1YLZA 2Y4AA 3SS5A 2XR0A 1BSGA 3BFDA 3G32A 5E2EA 3AGDA 1K55C 2Y2KA 1NY0A 2H5SA 2Y2HA 4XUXA 5FQIA 1W8YA 3A3IA 5HX9A 3PAEA 4EBLA 1G6AA 2X71A 2ZC6B 4E3IA 3M6HA 3OCLA 1RGYA 3WRTA 3UE0A 1L0DA 4LV3A 1HD8A 1MWUA 5KMWA 4B4ZA 2HDUA 3P09A 5FQJA 5TGFA 3WS2A 4ID4A 4JXGA 5CEBA 4P0MA 1YMSA 1KE3A 4FCFA 5FI7A 3ITBA 2G2WA 2WAEA 4JXSA 5EVIA 2IWCA 4XUZA 2C6WB 2EX2A 4P6BA 3HLWA 2OSUA 4MNRA 2P74A 4R4SA 1TDLA 2A49A 4QU3A 3DWZA 5FATA 4RVAA 4E3MA 1DJAA 5AQ7A 5EVIC 4WBGA 3UPNA 5EOOA 3SH7A 1BULA 2Y91A 3HVFA 1LI0A 5EVID 4QJGA 2QMIA 4OPQA 1K4EA 1HVBA 4KENB 2R9WA 1ESIA 4S2PA 5AQAA 1J9MA 3BEBA 3Q7VA 5CXWA 3VP0A 4MEZA 3FWLA 3NCKA 5HL1A 2WGIA 5FI2A 1KVMA 2Z2MB 3IQAA 2XGNA 4K0WA 1KDSA 4R4RA 2WGVA 4MLLA 3S4XA 2WGWB 4JKTA 4YINA 5G18A 4UAAA 3WS5A 4MBFA 3V3SA 3FKVA 4QY5A 1L0EA 3GVBA 1E3UA 3NDEA 4A5RA 4MBHA 3UPPA 3BYDA 2HDSA 4C3QA 3SH8A 4ZJ3A 1IYOA 3OZHA 4JPMA 2ZQDA 4LENA 2XDMA 1IYSA 4N9KA 5FDHA 3IHAA 3GQZA 4Y0OA 5DTKA 2Y2IA 1E4DA 3VOZA 4KQRA 2Y2GA 1E3UD 5M1AA 4R23A 1RCJA 1PWCA 3BLMA 3G2ZA 1BTLA 4OH0A 4WELA 3BFEA 5KZHA 2WYXA 2G2UA 4GDBA 1K25A 4GD6A 3G31A 3MXSA 3UDFA 1AXBA 3A3EA 3IWOA 5CHUA 5HFOA 1K6RA 3IXDA 3WRZA 5GHYA 3N4IA 1ZKJA 4BLMA 2HDQA 1RGZA 4OLDA 3GV9A 3ZFZA 4EBNA 3UN7A 4ZTKA 1PI5A 2B5RA 3EQUA 4E3OA 2WKEA 1MY8A 1FR1A 3WS4A 2XEPA 4OQ0A 3ZG9B 3HLFA 1ES2A 4EBPA 5U47A 4ZBEA 3HLDA 5GLCA 2PU2A 1M6KA 5FAQA 3NY4A 4FH2A 2ZC7A 3HUNA 5GLBA 1KVLA 5DTTA 4X55A 4X53A 3ZG0A 2HDRA 4S2MA 2OV5A 1I2SA 1JTDA 4OVDA 1DJCA 3SS4A 3V5MA 2XH9A 1BT5A 1CEGA 2WK0A 3PBOA 3UNWA 4B4XA 2DRWA 4Y0UA 1S6RA 5GHXA 4EWFA 2WGWA 2XK1A 3BLSA 1EI5A 3NBLA 3E2LA 3E2KA 5FAOA 4O7DA 1W8QA 3VFFA 2J9OA 4JLFA 3C7VA 1N4OA 3G30A 3IF6B 4Y7PA 4BD1A 3LY3A 2EFUA 4CJNA 1NZUA 1HZOA 5KSHA 3IXHA 1BLSA 5GL9A 2PBYA 1FR6A 1QMFA 2Y2NA 1I2WA 1XXMA 1KE0A 5E2GA 4X56A 4BENA 4Z9QA 4LV2A 2FFYA 4YFMA 1PIOA 2XD5A 2OLVA 4H8RA 2Y2JA 3VSLA 1ES5A 4KZ9A 4QHCA 4U0XA 1BLHA 5FAPA 4E3JA 5HW3A 3AGEA 4PM7A 3VP2A 5J8XA 4OKPA 4KZ5A 4OOYA 3VFHA 4WZ5A 3TG9A 2ZMAA 5CEDA 1XX2A 4NETA 4E6XA 4S2NA 3O87A 2C5WB
chains in the Genus database with same CATH superfamily
3C8CA 2X02A 1NXYA 3IWIA 5B31B 4Q0JA 2OWHA 5EM1A 4NY2A 3AN2B 2HZ5A 4G91C 4B93A 2F8NG 3W4QA 1D1JA 4L0LA 4QB8A 5A93A 2YFWB 1PWDA 4Z66C 4EUZA 3IXGA 3WKJD 4DDSA 3AYWD 3CWFA 1MPLA 1GA0A 3DWKA 3AZFC 2O99A 1W1TA 4CLCD 4J8UD 1Y4OA 3AZJC 1UWNX 1GPFA 1NYMA 3CLOA 1VEUB 1OJ5A 5TR7A 2XLNA 4BL3A 2ACGA 4LG2A 1K6SA 5HWTA 3CZDA 3IF6C 5EOEA 5EE8A 1TVFA 4Y5FA 2B02A 1KX4C 3G4PA 1W79A 4XUJA 5CHMA 5B33B 3NOTC 3Q81A 4DE0A 1YQSA 4KGCC 2EFXA 1KX5C 1P3OA 5B32C 1XGIA 2F8ND 1S32D 3WTPB 3UTBB 1NRJA 3HLBA 1PI4A 5CPIC 1W1YA 4KQQA 3REHB 3CI6A 4EO5C 1P3KC 2CV5D 4U3TA 3GTCA 5B0YC 4WEKA 5GXQC 3W8KA 3A3FA 3QNCA 4Y17A 2FJ7D 3MXQA 3LZ1D 2RCXA 3W99C 1O6IA 4DRBA 1LI9A 1GSXA 4HBTA 4EQIA 2KOIA 2JCHA 3HLCA 3AZNB 5FQ9A 3TU4C 2EA9A 2VJWA 1AIWA 4WU8C 4GZBA 4OLGA 5FI6A 5HD3A 1K54C 1N9BA 1OGBA 5AV6C 2OOLA 3NECA 3VP4A 3VOYA 4XZQB 1DP9A 5HSQA 1P3PA 5B1LB 4Z5TB 4X23B 4JJND 1FSWA 1XJ4A 4FH4A 4UHUA 1YLJA 3T4KA 3WA9D 1P3IC 2ZQCA 5CGWA 4R3JA 3G2YA 5DNMB 4WNNA 3MVDC 2EX9A 1YSQA 1DY6A 1ES3A 1QMEA 3IHBA 3T4LA 2Y55A 4KHAA 4NK3A 5HPIA 1NZOA 3HUMA 5CPJB 4DXBA 5EPHA 3C1CC 1KGEA 3UB7A 2Y2MA 1JWZA 4UA7A 3V3RA 3HUOA 1H0MA 4R8PB 3B6FD 5CPKB 3MR0A 4FD8A 4FTXA 4R3BA 3WAAA 2W1TB 4PM8A 3VH6T 2HUEC 4KZAA 3UTAC 4D60A 1B6WA 4NG2A 2OLUA 5JRGD 4ZUXC 4K91A 4J8XD 1YUEA 1W63M 2D02A 4F3LA 3OCNA 3MF0A 4LD9C 4PM5A 2ZQ9A 2LB5A 2W0NA 3K2NA 3WS0A 3LR4A 3UE1A 4Z66D 2J8PA 5FDSA 3OC2A 4KUKA 1F9IA 4KZ7A 4M6BA 3WTPE 5BO0A 4DXCA 1ID3D 3ULFA 5M18A 2VGLM 1P34B 2AVXA 3VE4A 3MXRA 5JYPA 3U2AA 3H0RC 1CF0A 1ZG4A 1NRFA 3BRMA 2JSSA 5B40A 2H10A 1SDNA 3X1VA 3Q82A 4HH3A 3ZG5A 4R0QA 5AV8A 4U0TA 2PD8A 2NZDB 1HTZA 1EQZC 2QJ7A 4LPZA 4KGCD 1ZLAD 4MBKA 4WZ4A 5B32D 5IHVA 2L4RA 1XJ6A 3A6ND 2Y2LA 2Z6DA 5GT0D 3AZKD 4KZBA 3MJQA 1KGFA 4NZ5A 3MKEA 4K0XA 4GW9A 5B0YD 4OJLA 5AV9C 3AZGA 2RL3A 5K5BA 1W1VA 3W97A 1FOFA 3NI9A 1YAXA 3LR3A 3P7NA 3MGSB 1HQ3C 2Q9MA 3MGRD 4WUJA 3EWKA 3L2AA 2ZM5A 1L6JA 5FQMA 2P08A 2VLGA 4MCWA 1K57C 1M40A 3A3JA 1DRMA 2QZ6A 3O86A 5AY8A 2D49A 4GN2A 5CP6A 4QLCD 3KFUG 1XA7A 4LLOB 5FQKA 3MZFA 3LR0A 3DTKA 3AYWB 5AVCD 1JTGA 2D01A 4BJPA 5GSUD 5EVIB 4CLCB 3UT9A 3EEHA 4J8UB 3O5YA 4X68A 3L7HA 5FASA 1LLBA 2ZQ7A 3FKWA 2W8SA 1P3ID 4UA6A 4WJ3C 4KZ3A 2V20A 4NZ3A 3E0YA 5F82A 5JYOA 3KXBD 4IJGA 1P3AD 5E5AD 5CGXA 3KO6A 3R7WB 3WTPC 3AFAD 4H9NB 4BWIA 4JBFA 3C1CD 3KUYB 3T1QB 3F1NB 1VM1A 3REHC 4OP5A 2Y2OA 1EW0A 3MGQD 2ZOIA 2Y2QA 3C38A 1S32B 3S7OA 2GZAA 4OJPA 1N9LA 2JHEA 2Y4AA 4B9OA 2XR0A 4HJ3A 3X1SC 3G32A 3AGDA 1K55C 2Y2KA 2CV5B 5FQIA 1G6AA 2X71A 2ZC6B 4LD9D 4NXEA 4I3IA 4H9RA 4B4ZA 3P09A 3LZ1B 3LJAC 4Y15A 3AV1A 5FQJA 3S7PA 1M18D 1YMSA 4Q0HA 5FI7A 4DJ2A 3D9YA 4OJ6A 1OPXA 3C1BC 4XUZA 1AWIA 4P6BA 3HLWA 5F99B 4K08A 4ME4A 1M19D 2A49A 5B1LC 3DWZA 1Z2CB 2AROB 3W98C 3NQUA 2M7VA 4E3MA 5AQ7A 3UPNA 1TS8A 1U35B 2Y91A 1OTEA 4QJGA 1M1AD 1K4EA 4JJNB 4HOIA 3V9RA 4NKPA 4GCZA 3FWLA 2W3FA 1KX4A 3LR5A 1BH9A 2PYOB 5CPJC 2WGWB 3K3CA 3AV2B 4YINA 5G18A 4WU9C 1KX5A 3WS5A 4MBFA 3FKVA 5AV5A 1L0EA 1E3UA 1P3FB 3NDEA 1V9YA 4R38A 5HDDA 5CPIA 2HDSA 2ZBBA 3KWQC 3SH8A 3UB6A 1IYOA 2HIOC 4NE5A 3L28A 3GQZA 5AV9D 1P3BC 4HHDA 1E4DA 4CLCE 5B24D 4IBIA 4LRYC 3VH5W 3REKD 4OH0A 1BTLA 3BFEA 4M4XA 2MJ6A 3MXSA 3W99A 1VB6A 3A3EA 5HFOA 3UDFA 2V8FA 1ODVA 3IXDA 3N4IA 2HDQA 1WWIA 3E4QA 1RGZA 3AZMC 4G91B 4R70A 4EBNA 3TU4A 4E3OA 2O9CA 1MY8A 2ZMVA 3H0LC 1FR1A 3X1TC 2XEPA 3ZG9B 4H9OA 3HLFA 2WKPA 1P3LD 4Z66B 4HH2A 1AOID 4UEYA 3AZFB 4JGQA 1F1EA 4FH2A 5B0ZA 1ID3B 3EEAA 4X53A 1J7MA 2I9VA 4DMZA 2IA2A 3W96C 1DJCA 3SZTA 4HMEA 2NZDC 5HD5A 4WZSB 4Y2FA 4EWFA 2PD7A 3AZEA 3F1PB 4DRAA 4GS9B 4JLFA 3C7VA 1N4OA 4Y7PA 3IF6B 4BD1A 1NZUA 2IOUA 1CK7A 4KGCB 4IBCA 3LIDA 1ZLAB 1KE0A 3CUEC 5B32B 4X56A 4QWOA 1S1YA 3B0BA 4H8RA 5JA4B 2Y2JA 4FOFA 3A6NB 1WWSA 5B1MA 4Z2MG 4Z2IA 5BS7C 3UE6A 3AZKB 5AVBD 3X1SD 4WZ5A 1P3KB 2ZMAA 4WN5A 4NETA 4ARZA 3UTAA 2M1CA 3O87A 2NQBA 2GNXA 3DAVA 5B0YB 2O0YA 3ISGA 5GXQB 3O62D 1MWSA 3DTMA 3IX4A 4Q8IA 3WD3A 4CSRB 4BD0A 4BL2A 3IX8A 3REJC 1MKIA 4Z2GA 5HWVA 1Q2PA 4UQIS 4KUDA 1XKZA 2ZL1A 4IBEA 1OT9A 1FCOA 4NYUA 5TJJA 3WKJC 3IBRA 3AYWC 1L0GA 4E3KA 3G34A 4YOFA 5I5LA 4CLCC 3AZHA 5CERA 4J8UC 4EXOA 5AV6B 3HBRA 2XFTA 5F6AA 3UE3A 3LI9A 2VGKA 4WEJA 2FH5A 2VGLS 5HAQA 1JWPA 1KOUA 3JPUA 4IBFA 3LIEA 4LGWA 1E15A 3P5JB 2J80A 5B2IA 2BG1A 1P3IB 4GB7A 4JGOA 3H7WA 1N1JB 4S2JA 5EFWA 1IEMA 4WU9D 4RQ9A 3MVDB 4J8WA 4H9QB 1HLUP 1P3AB 1IKGA 1GHMA 2VGJA 3WD2A 4S2IA 4L9GA 4DE1A 3C1CB 4LFUA 4XUJD 3MGQB 1GSWA 1FCNA 5C3IB 2JKFA 4OQHA 5B31A 3DBAA 5KDMA 3AN2A 3C7UA 2HUEB 2K2NA 2FJ7C 1OMEA 3LZ1C 2PT7A 4ZUXB 1H8YA 3B6GA 2YFWA 2KDKA 2VZWA 4OP8A 5CTNA 4CQHA 4WM9A 3QHYA 4LD9B 5DNND 1P0ZA 4F94A 3KYQA 2X01A 5DFYA 1P3GA 3MQLA 1M18B 5AVEA 2BLSA 1VEUA 3REIA 3OPPA 3PR6A 5L8MA 3GR2A 3RH8B 4OQIA 3N8LA 3HREA 4E45A 4R1GA 3LELD 3MFXA 4WL9A 3CG5A 4O0PA 5FSRA 3RXXA 1MZUA 5EUAA 1K56A 4WMCA 3WA9C 1XPBA 4ZAMA 3D4FA 5B33A 2WKHA 4O8GA 1PW1A 4OOLA 5KIZA 3CJMA 2ZC3B 1P3PD 1S67L 3B3XA 3WTPA 3UTBA 2JBFA 3UPOA 4KQDA 3N3FA 4N1XA 1H0IA 2L1MA 4E6WA 2XSSA 5M19A 4AFIA 3ZCZA 2W3HA 1WYBA 5FA7A 4LV1A 2Q9NA 3TOIA 3B6FC 1CK3A 1E6PA 3QP5A 2ZM2A 3MS6A 2Y2PA 4GHLA 2PBDP 3S1YA 5AV9B 3F1OB 5B24B 1MWRA 4X69A 5JRGC 3AZNA 3VE3A 3REJD 3REKB 4J8XC 2J8YA 1ES4A 1HQ3B 2JE5A 5IS1A 5I94A 3WAAD 4NZ1A 4PM9A 3GMWA 1ESUA 1XFNA 3BW6A 3MBZA 1PW8A 4XZQA 3IXBA 1F66C 2FN2A 5G4YA 4QD4A 5B1LA 4Z5TA 1ID3C 3BJNA 4X23A 1MWTA 1P3LB 3TE8A 1SDEA 1MBLA 1TF1A 2ZJ9A 2NUTC 4CAYB 3R45B 2GJ3A 2P9VB 4II7A 5DNMA 4E3LA 1SZVA 3TJZC 4HY8A 3OBFA 3PXPA 3B33A 1IFQA 3HCYA 4TX8A 5CPJA 1ZLAC 1YM1A 4DJ3A 2HP6A 1L3LA 1TZYD 3LZ0C 4R8PA 2HP5A 2VA0A 3MNNC 5BNVB 3X1VD 3A6NC 5CPKA 3PBQA 5F1FA 2IWBA 5AV8D 2W1TA 5GT0C 3AZKC 4PMAA 3LCEA 1FCMA 3LIAA 5CHJA 5A92A 1Z6FA 3AZID 4UPKA 4YWZA 4ZJ2A 3ITAA 4R6LA 4ETXA 1KDWA 4HEFA 2QKPA 3X1UD 4QPRA 5AVBB 1E6RA 3ZHHA 3ZG7B 3X1SB 4J8VC 3NIAA 3MQ0A 1YU1A 1A7WA 1CI8A 3MGRC 2ZOHA 5HPFA 1ONGA 2EX6A 1OTBA 1S0WA 1ZG6A 1CJFA 3LJAB 2B18A 4C6YA 1PZRA 3L29A 4NEED 1ED7A 3KYZA 1P34A 1CXWA 3AZLC 4H9PB 3MKFA 3C1BB 1ZHHB 4QLCC 5DF8A 5EVLA 3BQAA 5AVCC 3A3DA 3NC8A 5GSUC 3W98B 1ZC2A 3VH6W 3S7QA 3N7WA 2XQZA 1JNUA 3PYPA 2F8NK 1YLYA 1DP6A 3T4JA 2DCFA 2A24B 2NZDA 4YS3D 1SHVA 3UB9A 4IBRA 3ZVWA 2Z6CA 3PTEA 3KXBC 3SH9A 1P3AC 3OPLA 5E5AC 5A8BA 1I5QA 4YNRA 3UT9D 1A0KA 3AFAC 3IS2A 4WU9B 3Q7VB 1HTAA 2BASA 3HJKA 3MGQC 5C3IC 1QO6A 1TS7A 3KWQB 1JWVA 3IWQA 2HIOB 1PYYA 3ZGAB 4HP4A 5DJTA 1K4FA 2BYKB 5F1GA 1P3BB 1EAKA 1OTIA 3MGSA 4WF0A 2BYMB 2VKSA 1CI9A 3SS5A 2V5OA 4X25A 3VV4A 4UQIM 2YKHA 4H9SC 5E2EA 3KS8A 2Y2HA 4XUXA 3A0VA 1P9RA 3A3IA 4HGAC 3OCLA 3EPJA 1L0DA 4LV3A 1HD8A 1MWUA 1M18C 5HZHA 3AZMB 3WS2A 4P0MA 1F66D 2EWVA 1YSPA 4HJ6A 4FCFA 2WAEA 3X1TB 5DNNB 2CWEA 2A2LA 5EVIA 2IWCA 1M19C 4CLCA 1VHMA 1TS0A 2P74A 4R4SA 1TDLA 3AV1D 3LUQA 3DTIA 3C30A 1M1AC 1LI0A 3LELB 3W96B 3B0DC 3R7WA 2R9WA 1ESIA 1YU2A 1OJGA 4NXGA 3BEBA 4H9NA 5J7EA 3RELC 3KUYA 3HSHA 4Z2LA 5HDCA 1GSVA 3NCKA 3LZ0D 2WGIA 2J3TD 3F1NA 3RTYA 2Z2MB 4K0WA 2XGNA 1YU0A 3OOVA 3MNND 1G28A 1MKMA 2NUPC 4UAAA 1TD5A 1S32A 2QJ5A 4A5RA 4ZJ3A 1NLYA 2ZQDA 2CV5A 1P9WA 5FDHA 5B24C 4BBUA 5AV5D 1IOUA 4J8VD 3REKC 2Y2GA 1E3UD 1RCJA 3BLMA 5KZHA 3LZ1A 2G2UA 4GDBA 2W27A 1AXBA 3IWOA 3WRZA 1K6RA 5GHYA 1ZKJA 5EV0A 3REJB 5F99A 3AZLD 2VK3A 3KX0X 2AROA 1P3LC 1AOIC 3WKJB 1U35A 3BY8A 3T4OA 4ZBEA 1KX3D 3HLDA 2PU2A 4PHTA 1M6KA 1P3MD 5FEFA 4JJNA 2CMNA 5GLBA 1KVLA 5DTTA 4X55A 1I2SA 1BT5A 2WK0A 3PBOA 2JKGA 2PYOA 3UNWA 2DRWA 1LL8A 1S6RA 5GHXA 3V67A 2WGWA 3AV2A 2RVQD 1EI5A 1R4VA 1VETB 3A1IA 2XA7S 3NBLA 4I5SA 1ULYA 5B0ZD 4NXFA 3VFFA 1N9NA 3MGPD 1JFIB 1P3FA 3KYEA 3LY3A 3H82A 3IXHA 3AZED 5TBMB 2PBYA 1TZYB 1FR6A 1I2WA 2F8NB 5E2GA 4BENA 2WKQA 5GT3C 4YFMA 2XD5A 2OLVA 4Z1WA 2VV7A 1ES5A 5AVBC 1BLHA 3AGEA 3VP2A 4GHIB 1BH8B 3T50A 1LSXA 3AZIB 2V0WA 1XX2A 4E6XA 2C5WB 3O62C 1UWPX 5GLDA 3VSKA 4HMDA 3X1UB 2FJ7B 3CMZA 1T1BA 3OPHA 5E2HA 1G6OA 4Z66A 1XFQA 3IF5A 3E98A 3MFDA 2NQBD 4KQOA 3RJUA 2YFVB 3AZFA 2DQNC 3VH6A 3AZJA 5B2JD 5AQ9A 3WD0A 2W3GA 1ERQA 4RX3A 2KLIA 4FUWA 1WE4A 5CRFA 1YPRA 3F1PA 4GS9A 4IBBA 3C5AA 2E8IA 2WKIA 5B31G 3IF6A 4S2KA 4EEUA 3RELD 3WA9B 3ICYA 4YS3B 4DKIA 4D2OA 1EROA 1XP4A 4KGCA 4EW7A 2ZLYA 5B32A 2V8CA 1E25A 2Q0OA 4IHQA 5JA4A 2V2FF 3UT9B 3A6NA 2ZQ8A 3LEZA 4YM6D 5BOHA 2XF3A 1FSYA 1P3KA 2PR5A 3B0CW 3QP4A 4XUJC 2JN7A 1BLCA 1PWGA 1PZOA 1YLWA 3B6FB 4Y0TA 5B0YA 3QP8A 5GXQA 1P3OC 2B95A 4CSRA 3N8SA 4P6ZS 2XRNA 1O07A 5G49B 3WD1A 1LSVA 4DF6A 1W63Q 5JRGB 1G68A 4OPRA 4WV4B 4GDNA 3D3OA 4J8XB 3BM6A 3R4KA 5B31D 4WU8A 1OGGA 1YT4A 5DNNC 2V9AA 3HLGA 3S22A 1K54A 5AV6A 4O01A 1F66B 3N6IA 4MB4A 2ZY5A 3FDDA 3B6GD 3ZNTA 4X1MA 3NQJB 3LELC 1Y54A 2E8JA 2WKRA 3BFCA 1P3GD 1P3IA 3WD4A 1N1JA 3REID 3FZCA 5GLAA 5EECA 3MVDA 4X6TA 4H9QA 2HJ9C 1EWZA 1GCEA 1P3AA 4JF5A 3MQOA 4JF6A 1T1CA 3O88A 3PBTA 1P3PC 1SKOA 5GHZA 3T12B 5HWWA 3EQVA 3C1CA 1V9ZA 1K56D 3VH5T 3LZ0B 3PBNA 1PDCA 4AWLC 3JVVA 4Q0IA 4WMCD 2IWDA 3O3VA 3MGQA 3MNNB 5GT3D 5GT0B 3PHYA 4E3NA 1K38A 1CEFA 1TAFB 4JXVA 2OAQ1 1W2EA 3VMAA 1BH9B 1YMXA 4HESA 3ZVTA 5CX7A 4ZUXA 2V1AA 3JYIA 2G7UA 1IYPA 5AV5B 3F6TA 4J8VB 4LD9A 5A90A 4DE3A 4UA9A 2ZM8A 4R3AA 2H0TA 3MGRB 3WAAC 2UWXA 2QWSA 5LBRA 3FV7A 4ZBJB 3AZND 2G5IC 4G3WA 3AZLB 4I3AA 2Y59A 4UUZB 3QP1A 4QLCB 2V0UA 2ZMFA 4LV0A 1T19A 5AVCB 1KE4A 5TFQA 1KX3B 5GSUB 2VEAA 4OJOA 4XZQD 1P3MB 5FQQA 4BQMA 5HAIA 4Z5TD 4P85A 1ERMA 4X23D 1EQZA 4N9LA 2ZD8A 2G5HC 3L26A 4WYYA 3KXBB 3IT9A 3KSYA 5E5AB 4DRTA 5B40C 4KG2A 1TZYC 2JKTM 5DNMD 3C4PA 3FC7A 3AGFA 5B0ZB 3AFAB 3X1VC 3PBSA 3MGPB 3Q07A 1FILA 5AV8C 4KG5A 5BNXB 1RP5A 4B88A 1B67A 1UR9A 2GDNA 3NDGA 3AZIC 5AV9A 1P3OD 3F1OA 2XROA 5HDSA 5B24A 1YU3A 5DF7A 4R8PD 4LCLA 3REKA 4IEDA 3X1UC 1Y28A 1HQ3A 1KS0A 3LO7A 2JC7A 3ZDJA 3GSGA 1IYQA 4NXBA 2CC1A 4XT2B 3WWXA 4HGAB 4N1HA 1K57A 4FSFA 4JGPA 3AZGC 4KZ6A 3LICA 3ZG8B 3W97C 4IVKA 2W3EA 2WAFA 2R78A 4HMCA 2QPNA 1P3LA 2XFSA 3P98A 2EXBA 4CAYA 3R45A 1H8PA 3TSGA 3T1XA 3VP1A 3A0RA 1M19B 1ALQA 2P9VA 3M2JA 5B2JB 5A91A 5L09A 3Q7ZA 4L9EA 3W4OA 2WUQA 2XA7M 4KZ4A 4BBVA 4GNUA 4OQGA 4YS3C 1M1AB 5CP6C 5E43A 5HAPA 1NYYA 3B0DB 1WYCA 5DJUA 5BNVA 3UT9C 3RELB 1YLPA 4Y3IA 5FUGB 1BLPA 1BUEA 2W3DA 3HLEA 3NULA 4EESA 3REHA 4H6JB 2VX8A 2OWJA 2ZC4B 2PYRA 1XA1A 1C3BA 4YM6B 1YLTA 5DVAA 4GJ4A 3DW0A 1J3WA 4HQAA 1H8ZA 5AVBA 4Z2HA 3I7JA 3X1SA 3SS3A 1LHYA 1K55A 1ONHA 5F69A 3DTEA 4PKYA 3WX7A 2V1BA 1KU5A 3LJAA 1NY0A 2H5SA 1W8YA 3BQ8A 5HX9A 4E3IA 3M6HA 4H9PA 1RGYA 3WRTA 3TRCA 3KSHA 3UE0A 2UV0E 3MGSD 3C1BA 1TS6A 3B42A 3W2ZA 2HDUA 5TGFA 3U4LP 3SW1A 4ID4A 1KE3A 5KDMB 3W98A 2K31A 4JXSA 3EPLA 1AOIB 2A24A 2W1RA 4MB5A 2OSUA 3AV1C 4MNRA 4QU3A 3LI8A 5FATA 3B6GB 4RVAA 3UMEA 5DFXA 1DJAA 4JGRA 3HVFA 5AJGA 5EVID 4IJEA 1D7EA 1P3GB 4HNBA 4KENB 2IO5C 4E44A 1H3OB 3CAXA 3LGOA 3REIB 5AQAA 5B40D 4WU9A 1E8BA 1J9MA 3Q7VA 4MEZA 2J3TC 2PR6A 3G6OA 3A1KA 5HL1A 4EUVA 3IQAA 1KDSA 4R4RA 3TW8A 3KWQA 1XJ3A 2HIOA 4I38A 4QY5A 3GVBA 3UB5P 5IU1A 4EEPA 2BYKA 2F2AC 1P3BA 3KUYD 4P6ZM 4MBHA 2BYMA 3BYDA 4PAUA 5GT3B 4C3QA 2P7JA 4JPMA 4LENA 5AV5C 1IYSA 2HGVA 4Y0OA 1PNEA 2Y2IA 4KQRA 3IBJA 3AZMA 2PRFA 3O62B 4WELA 3EPKA 2WYXA 4EU0A 3G31A 3AZGD 3H0MC 3X1TA 4ETZA 5DNNA 4NFTA 4ZBJC 3W97D 3CPTB 4BLMA 4OLDA 3GV9A 3ZFZA 2B5RA 2F8NH 4IUKA 1KX3C 1E6ZA 1ES2A 5U47A 5BT1D 3LELA 1P3MC 3W96A 5GLCA 5F99D 5AY8D 3NY4A 1H8MA 2AROD 5CP6D 2HDRA 4S2MA 2OV5A 1JTDA 1U35D 2XH9A 2RVQC 4B4XA 4Y0UA 3BLSA 2XK1A 2PAVP 5B0ZC 4MDZA 3E2KA 3MGPC 2VQRA 5FAOA 4O7DA 4IBKA 1W8QA 3JVUA 5EVEA 5DKKA 3CUEA 3GECA 4IBGA 2HV1A 3IX3A 3AZEC 2PYOD 1BLSA 1MC0A 3AV2D 3MSHA 5BS7A 2Y2NA 1XXMA 4IUHA 4Z9QA 3S7NA 1P3FD 2FFYA 4XUJB 2KX6A 2PYPA 4U0XA 4E3JA 1F2KA 4PM7A 1P3OB 4OKPA 4OOYA 5L07A 3VFHA 1YKDA 5CEDA 3E4PA 5BPVA 3REJA 2PHYA 5B1MC 3E4OA 3KSFA 2ZY2A 3QNBA 5AQBA 1H5XA 3B47A 4WZ5C 2WADA 3BFGA 4G3KA 4ZRRA 3T1RA 3WKJA 1YU4A 3AYWA 2NQBC 2EX8A 3PBRA 4OONA 2P04A 5B32G 4J8UA 1IELA 5B2JC 1NWZA 1VQQA 1K0KA 4RYEA 2HF6A 2A3UA 4KUDC 4LCMA 4ZDXA 5G4ZA 2EXAA 3NOPC 3UO9A 2GX5A 1LSWA 2PDRA 1CQAA 1VETA 5HL6A 3AZFD 1OT6A 4EV4A 1BZAA 3AZJD 1JFIA 3AZHC 2HPBA 1DJBA 4KZ8A 4RA7A 4S2OA 3VOLA 3W4PA 3FPWA 3PAGA 5TBMA 2BTFP 1TZYA 1P3PB 4EETB 3L9KA 2F8NA 4GD8A 3KS4A 2O9AA 4YM6C 1U60A 1Q2QA 5J4EA 3UDIA 1KX4D 4AWLB 3M2KA 5B2IC 3KSIA 4GHIA 1BH8A 3AZIA 2DMWA 4WNNB 1KX5D 2R9XA 4J8WC 4QNLA 2LY8A 4KHAB 3NOUC 2WZZA 3X1UA 2FJ7A 1BYWA 2EWWA 4S2LA 5CPID 1IKIA 3IS2B 1E6NA 4I3JA 5MC7A 1L2SA 1P3KD 2QYBA 1STZA 4OPZA 3T4TA 1LL5A 5F83A 2ZM0A 5E2FA 2YFVA 1JVJA 4QY6A 3T4QA 4P87A 5B31C 5GXQD 2INWA 5HARA 3MQQA 3WAAB 2WZXA 3AN2C 1GHPA 1KGGA 3W99D 3FPVA 4G92B 1Z09A 2DNSA 1S4RA 5J3WA 2K7SA 1DP8A 4KG6A 3B6GC 3TU4D 3LFVA 1ZTUA 2RTSA 4F3LB 4WU8D 3GDIA 3QP6A 3M7PA 4MN6A 1LL9A 3WA9A 2FZ0A 2LB9A 4XXRA 1P3GC 4YS3A 5AV6D 2ZQAA 4EERA 4IBXA 3REIC 3FYZA 5BO0B 4MN7A 1O7EA 1XJ2A 3T1SA 2H0YA 4M3KA 4GLQA 1FIKA 1ACFA 5D3OA 4C75A 4RX2A 5B40B 5CGSA 3C4OA 4ZJ1A 3AL0C 3MMHA 1Q9CA 1W5DA 3X1VB 5B33C 3MVDD 3B6FA 4HP9A 5EM0A 2VV6A 5AV8B 1G5UA 3UTBC 3P01A 2ZY4A 5G49A 5DKLA 1W1PA 4HJ4A 5FEGA 3EG5B 5JRGA 4CPKA 1SKFA 4J8XA 2ZY3A 3G35A 5B1MD 4IVIA 4S2NC 1GA9A 3LY4A 3UTAD 3LIFA 3RFBA 3EGXC 4GKUA 3M6BA 1F66A 1E88A 3L27A 4ZUXD 3AZGB 4DDYA 1ID3A 2HP9A 3AZNC 3W97B 3NQJA 2V1ZA 5F5YA 1T3UA 4KUDD 4BMWA 5DF9A 3UY6A 4E04A 4NE3A 5DTSA 4XZQC 3MZEA 3H9WA 2OAP1 3FG8A 4DE2A 3AZHD 4GOGA 1W7FA 1TEMA 2L0WA 4HIAA 4KUOA 2M7UA 4Z5TC 5AY8B 4LRZE 4X23C 5CP6B 4OOMA 1ZLAA 2Z2LB 3WS1A 1GHIA 5CTMA 3LZ0A 4Z2KA 3VP3A 4HBUA 3MNNA 4I39A 1PRQA 4N92A 5DNMC 4DQYB 3V39A 1BFMA 5GT0A 3AZKA 1OTDA 5B2ID 4MN5A 1D06A 1PFLA 1EQZD 1PZPA 1TAFA 4MB3A 2ZC5B 3Q1FA 4J8WD 2Y79A 4PPRA 3IH8A 1T1AA 3NJAA 3ZNYA 4R8PC 3IH9A 4EQ1A 5CECA 4J8VA 2J7VA 5CPKC 2QHKA 3MGRA 1XGJA 3H82B 4PM6A 3V50A 1S4SA 5IT5A 1MXOA 4IJFA 3AN2D 3OPRA 3AZLA 3D72A 4UUZA 1T18A 3HL9A 1HQ3D 4X1LA 4QLCA 1P97A 3QP2A 2VV8A 5AVCA 3GRJA 1KX3A 5GSUA 3EOIA 3N8RA 2J9PA 1P3MA 4H9RB 5KSCA 3RXWA 3AV1B 4LRXC 1TDGA 3SOIA 1P34C 1FQGA 3UDXA 3LIBA 3UMDA 4WLAA 4JF4A 3KXBA 2PU4A 5E5AA 4Y13A 4PKYG 1NJ4A 3B0CT 3BECA 5L2FA 3AZJB 2IO5B 3AFAA 3NQUB 3MGPA 3BFFA 4HI4A 5BNXA 3LYXA 5B33D 3IP4C 1H0GA 3MZDA 1SCWA 2I72A 3V9RB 4BBTA 2FFFB 3WTPD 3UTBD 1KX4B 3REHD 1GOIA 1KX5B 1L0FA 4H9SA 2XD1A 2J3WA 3CITA 3LEQA 4XT2A 4OPYA 4JXWA 4DN0A 1YLZA 5CPIB 1BSGA 3BFDA 1M18A 4EO5B 4G92C 3PAEA 4EBLA 4L9FA 2YKFA 3MGSC 1GXDA 1M19A 5KMWA 1WA9A 5CEBA 5B2JA 4JXGA 3LJAD 3HJIA 3ITBA 3W99B 2G2WA 2C6WB 2EX2A 1M1AA 3C1BD 3TU4B 3C2WA 3EGDC 1X0OA 3OLOA 4WU8B 5B1LD 1NLZA 1N9OA 2Y8HA 3FKEA 4OJ5A 3W98D 5EVIC 4WBGA 5EOOA 3SH7A 4H9OB 3RELA 1BULA 5FUGA 3L25A 2QMIA 4OPQA 4H6JA 3T4SA 1HVBA 4S2PA 5CXWA 3VP0A 4YM6A 5FI2A 1KVMA 5F68A 4NZ4A 3BY9A 4IBDA 2JKRM 2WGVA 4MLLA 3S4XA 4JKTA 3AZEB 5CPJD 3NHQA 3V3SA 3KUYC 5CHLB 3UPPA 5CPKD 1SKOB 3OZHA 1S32C 2L5AA 2XDMA 3BWLA 3KWQD 4N9KA 3IHAA 2HIOD 4Z2MH 5DTKA 3VOZA 1P3BD 4G3VA 5M1AA 2HJEA 4R23A 2JKTI 1PWCA 3G2ZA 5B1MB 3UB8A 2CV5C 3HONA 1K25A 4GD6A 4GH9A 4ARZB 5CHUA 1S66L 3UTAB 1AOIA 2JKRI 2NQBB 5FL3A 3UN7A 2RIQA 1PI5A 3EQUA 4ZTKA 3AZMD 2WKEA 1OTAA 3EPHA 3WS4A 4OQ0A 5BT1C 3X1TD 2O9BA 4EBPA 5F99C 1P34D 1F98A 4KUDB 1S1ZA 5AY8C 2ZL1B 2AROC 5FAQA 1H3OA 2ZC7A 1F5MA 3HUNA 1U35C 3ZG0A 1UR8A 5AVFA 4OUIA 4OVDA 3AZHB 3SS4A 3V5MA 1CEGA 5C5KA 3W96D 3CHWP 3KSGA 4JJNC 2NZDD 3E2LA 1UGUA 2J9OA 2H28A 3A0SA 3G30A 3K3DA 4IBJA 2PYOC 4NE6A 2EFUA 4CJNA 1HZOA 3AV2C 5GT3A 5KSHA 5GL9A 5B2IB 5L10A 1H3QA 1QMFA 4MMNA 3H7WB 1EQZB 1P3FC 3ZYTA 4J8WB 4GHAA 4LV2A 4NYYA 1LT0A 1PIOA 3VSLA 3O62A 4KZ9A 5FAPA 4QHCA 5HW3A 5J8XA 4ESPA 4KZ5A 3ZQ5A 3TG9A 3VH5A 3CPTA 4S2NA 4Z2JA 2DF4C
chains in the Genus database with same CATH topology
2X02A 1NXYA 3IWIA 5B31B 4NY2A 3AN2B 4G91C 2F8NG 3W4QA 4L0LA 4QB8A 5A93A 2YFWB 1PWDA 4Z66C 4EUZA 3IXGA 3WKJD 4DDSA 3AYWD 1MPLA 1GA0A 3DWKA 3AZFC 4J8UD 3AZJC 1NYMA 5TR7A 2XLNA 4BL3A 4LG2A 1K6SA 3CZDA 3IF6C 5EOEA 5EE8A 1TVFA 1KX4C 3G4PA 1W79A 4XUJA 5CHMA 5B33B 3Q81A 4DE0A 1YQSA 4KGCC 2EFXA 1KX5C 1P3OA 5B32C 1XGIA 2F8ND 1S32D 3WTPB 3UTBB 3HLBA 1PI4A 5CPIC 4KQQA 3REHB 4EO5C 1P3KC 2CV5D 4U3TA 3GTCA 5B0YC 4WEKA 5GXQC 3W8KA 3A3FA 3QNCA 2FJ7D 3LZ1D 2RCXA 3W99C 4DRBA 1LI9A 4HBTA 4EQIA 2JCHA 3HLCA 3AZNB 5FQ9A 3TU4C 4WU8C 4GZBA 4OLGA 5FI6A 1K54C 1N9BA 5AV6C 3VP4A 3VOYA 4XZQB 1P3PA 5B1LB 4Z5TB 4X23B 4JJND 1FSWA 4FH4A 4UHUA 1YLJA 3WA9D 1P3IC 2ZQCA 5CGWA 4R3JA 3G2YA 5DNMB 4WNNA 3MVDC 2EX9A 1DY6A 1ES3A 1QMEA 3IHBA 2Y55A 4KHAA 4NK3A 1NZOA 3HUMA 5CPJB 4DXBA 5EPHA 3C1CC 1KGEA 2Y2MA 1JWZA 4UA7A 3V3RA 3HUOA 4R8PB 3B6FD 5CPKB 4FD8A 4R3BA 3WAAA 4PM8A 3VH6T 2HUEC 4KZAA 3UTAC 1B6WA 2OLUA 5JRGD 4ZUXC 4K91A 4J8XD 1YUEA 3OCNA 4LD9C 4PM5A 2ZQ9A 3WS0A 3UE1A 4Z66D 2J8PA 3OC2A 4KZ7A 4M6BA 3WTPE 5BO0A 4DXCA 1ID3D 5M18A 1P34B 3MXRA 5JYPA 3H0RC 1ZG4A 1NRFA 3BRMA 2JSSA 5B40A 2H10A 1SDNA 3X1VA 3Q82A 3ZG5A 4R0QA 5AV8A 4U0TA 2NZDB 1HTZA 1EQZC 4KGCD 1ZLAD 4MBKA 4WZ4A 5B32D 5IHVA 3A6ND 2Y2LA 5GT0D 3AZKD 4KZBA 1KGFA 4NZ5A 3MKEA 4K0XA 5B0YD 4OJLA 5AV9C 3AZGA 2RL3A 3W97A 1FOFA 3NI9A 3MGSB 1HQ3C 2Q9MA 3MGRD 3L2AA 2ZM5A 5FQMA 1K57C 1M40A 3A3JA 2QZ6A 3O86A 5AY8A 4GN2A 5CP6A 4QLCD 3KFUG 1XA7A 5FQKA 3MZFA 3AYWB 5AVCD 1JTGA 4BJPA 5GSUD 5EVIB 3UT9A 4J8UB 4X68A 5FASA 1LLBA 2ZQ7A 3FKWA 2W8SA 1P3ID 4UA6A 4WJ3C 4KZ3A 2V20A 4NZ3A 5F82A 5JYOA 3KXBD 1P3AD 5E5AD 5CGXA 3WTPC 3AFAD 4H9NB 4JBFA 3C1CD 3KUYB 1VM1A 3REHC 4OP5A 2Y2OA 3MGQD 2Y2QA 1S32B 4OJPA 2Y4AA 2XR0A 3X1SC 3G32A 3AGDA 1K55C 2Y2KA 2CV5B 5FQIA 1G6AA 2X71A 2ZC6B 4LD9D 4H9RA 4B4ZA 3P09A 3LZ1B 3LJAC 5FQJA 3AV1A 1M18D 1YMSA 5FI7A 4OJ6A 3C1BC 4XUZA 4P6BA 3HLWA 5F99B 1M19D 2A49A 5B1LC 3DWZA 1Z2CB 2AROB 3W98C 3NQUA 4E3MA 5AQ7A 3UPNA 1U35B 2Y91A 4QJGA 1M1AD 1K4EA 4JJNB 3V9RA 3FWLA 1KX4A 1BH9A 2PYOB 5CPJC 2WGWB 3AV2B 4YINA 5G18A 4WU9C 1KX5A 3WS5A 4MBFA 3FKVA 5AV5A 1L0EA 1E3UA 1P3FB 3NDEA 5CPIA 2HDSA 3KWQC 3SH8A 1IYOA 2HIOC 4NE5A 3L28A 3GQZA 5AV9D 1P3BC 1E4DA 5B24D 4IBIA 3VH5W 3REKD 4OH0A 1BTLA 3BFEA 3MXSA 3W99A 3UDFA 3A3EA 5HFOA 3IXDA 3N4IA 2HDQA 1WWIA 1RGZA 3AZMC 4G91B 4EBNA 3TU4A 4E3OA 1MY8A 3H0LC 1FR1A 3X1TC 2XEPA 3ZG9B 4H9OA 3HLFA 1P3LD 4Z66B 1AOID 3AZFB 1F1EA 4FH2A 5B0ZA 1ID3B 4X53A 3W96C 1DJCA 2NZDC 4WZSB 4EWFA 3AZEA 4DRAA 4JLFA 3C7VA 1N4OA 4Y7PA 3IF6B 4BD1A 1NZUA 2IOUA 4KGCB 4IBCA 1ZLAB 1KE0A 5B32B 4X56A 3B0BA 4H8RA 5JA4B 2Y2JA 3A6NB 1WWSA 5B1MA 4Z2MG 5BS7C 3AZKB 5AVBD 3X1SD 4WZ5A 1P3KB 2ZMAA 4NETA 3UTAA 3O87A 2NQBA 5B0YB 3ISGA 5GXQB 3O62D 1MWSA 3DTMA 4Q8IA 4CSRB 4BD0A 4BL2A 3REJC 1MKIA 1Q2PA 4KUDA 1XKZA 4IBEA 1FCOA 4NYUA 3WKJC 1L0GA 3AYWC 4E3KA 3G34A 3AZHA 5CERA 4J8UC 5AV6B 3HBRA 2XFTA 3UE3A 2VGKA 4WEJA 5HAQA 1JWPA 4IBFA 3P5JB 5B2IA 2BG1A 1P3IB 4GB7A 1N1JB 4S2JA 1IEMA 4WU9D 3MVDB 4J8WA 4H9QB 1P3AB 1IKGA 1GHMA 2VGJA 4S2IA 4DE1A 3C1CB 4XUJD 3MGQB 1FCNA 5C3IB 4OQHA 5B31A 5KDMA 3AN2A 3C7UA 2HUEB 2FJ7C 1OMEA 3LZ1C 4ZUXB 1H8YA 3B6GA 2YFWA 4OP8A 5CTNA 4WM9A 3QHYA 4LD9B 5DNND 4F94A 2X01A 1P3GA 1M18B 2BLSA 3REIA 3OPPA 3GR2A 4OQIA 3N8LA 3HREA 4E45A 4R1GA 3LELD 3CG5A 5FSRA 3RXXA 5EUAA 1K56A 4WMCA 3WA9C 1XPBA 4ZAMA 3D4FA 5B33A 2WKHA 1PW1A 4OOLA 3CJMA 2ZC3B 1P3PD 3B3XA 3WTPA 3UTBA 2JBFA 3UPOA 3N3FA 4N1XA 4E6WA 5M19A 3ZCZA 1WYBA 5FA7A 4LV1A 2Q9NA 3TOIA 3B6FC 1CK3A 2ZM2A 2Y2PA 4GHLA 3S1YA 5AV9B 5B24B 1MWRA 4X69A 5JRGC 3AZNA 3REJD 3REKB 4J8XC 2J8YA 1ES4A 1HQ3B 2JE5A 5I94A 3WAAD 4NZ1A 4PM9A 3GMWA 1ESUA 3MBZA 1PW8A 4XZQA 3IXBA 1F66C 4QD4A 5B1LA 4Z5TA 1ID3C 4X23A 1MWTA 1P3LB 1SDEA 1MBLA 2ZJ9A 4CAYB 3R45B 2P9VB 5DNMA 4E3LA 5CPJA 1ZLAC 1YM1A 2HP6A 1TZYD 3LZ0C 4R8PA 2HP5A 3MNNC 5BNVB 3X1VD 3A6NC 5CPKA 3PBQA 5F1FA 2IWBA 5AV8D 5GT0C 3AZKC 4PMAA 3LCEA 1FCMA 5CHJA 5A92A 1Z6FA 3AZID 4UPKA 4ZJ2A 3ITAA 1KDWA 4HEFA 3X1UD 5AVBB 3ZHHA 3ZG7B 3X1SB 4J8VC 3NIAA 1YU1A 1A7WA 1CI8A 3MGRC 1ONGA 2EX6A 1S0WA 1ZG6A 3LJAB 4C6YA 1PZRA 3L29A 1P34A 3AZLC 4H9PB 3MKFA 3C1BB 4QLCC 5DF8A 5EVLA 5AVCC 3A3DA 3NC8A 5GSUC 3W98B 1ZC2A 3VH6W 3N7WA 2XQZA 2F8NK 1YLYA 2DCFA 2NZDA 4YS3D 1SHVA 4IBRA 3ZVWA 3PTEA 3KXBC 3SH9A 1P3AC 3OPLA 5E5AC 1I5QA 3UT9D 3AFAC 4WU9B 3Q7VB 1HTAA 3MGQC 5C3IC 3KWQB 1JWVA 3IWQA 2HIOB 1PYYA 3ZGAB 1K4FA 2BYKB 5F1GA 1P3BB 3MGSA 2BYMB 1CI9A 3SS5A 4H9SC 5E2EA 3KS8A 2Y2HA 4XUXA 3A3IA 4HGAC 3OCLA 3EPJA 1L0DA 4LV3A 1HD8A 1MWUA 1M18C 3AZMB 3WS2A 4P0MA 1F66D 4FCFA 2WAEA 3X1TB 5DNNB 2CWEA 5EVIA 2IWCA 1M19C 2P74A 4R4SA 1TDLA 3AV1D 1M1AC 1LI0A 3LELB 3W96B 3B0DC 2R9WA 1ESIA 1YU2A 3BEBA 4H9NA 3RELC 3KUYA 3HSHA 3NCKA 3LZ0D 2WGIA 2Z2MB 4K0WA 2XGNA 1YU0A 3MNND 4UAAA 1S32A 4A5RA 4ZJ3A 2ZQDA 2CV5A 5FDHA 5B24C 5AV5D 4J8VD 3REKC 2Y2GA 1E3UD 1RCJA 3BLMA 5KZHA 3LZ1A 2G2UA 4GDBA 1AXBA 3IWOA 3WRZA 1K6RA 5GHYA 1ZKJA 3REJB 5F99A 3AZLD 2AROA 1P3LC 1AOIC 3WKJB 1U35A 4ZBEA 1KX3D 3HLDA 2PU2A 1M6KA 1P3MD 4JJNA 5GLBA 1KVLA 5DTTA 4X55A 1I2SA 1BT5A 2WK0A 3PBOA 3UNWA 2PYOA 2DRWA 1S6RA 5GHXA 2WGWA 3AV2A 2RVQD 1EI5A 1R4VA 3A1IA 3NBLA 1ULYA 5B0ZD 3VFFA 3MGPD 1JFIB 1P3FA 3LY3A 3IXHA 3AZED 2PBYA 1TZYB 1FR6A 1I2WA 2F8NB 5E2GA 4BENA 5GT3C 4YFMA 2XD5A 2OLVA 1ES5A 5AVBC 1BLHA 3AGEA 3VP2A 1BH8B 3AZIB 1XX2A 4E6XA 2C5WB 3O62C 5GLDA 3VSKA 3X1UB 2FJ7B 3CMZA 3OPHA 5E2HA 4Z66A 3IF5A 3MFDA 2NQBD 4KQOA 3RJUA 2YFVB 3AZFA 2DQNC 3VH6A 3AZJA 5B2JD 5AQ9A 1ERQA 4RX3A 1WE4A 5CRFA 4IBBA 3C5AA 2E8IA 2WKIA 5B31G 3IF6A 4S2KA 3RELD 3WA9B 4YS3B 4DKIA 4D2OA 1EROA 1XP4A 4KGCA 2ZLYA 5B32A 1E25A 5JA4A 2V2FF 3UT9B 3A6NA 3LEZA 2ZQ8A 4YM6D 5BOHA 2XF3A 1FSYA 1P3KA 3B0CW 4XUJC 1BLCA 1PWGA 1PZOA 1YLWA 3B6FB 4Y0TA 5B0YA 5GXQA 1P3OC 4CSRA 3N8SA 1O07A 5G49B 4DF6A 5JRGB 1G68A 4OPRA 4WV4B 4GDNA 4J8XB 3BM6A 5B31D 4WU8A 1YT4A 5DNNC 3HLGA 3S22A 1K54A 5AV6A 1F66B 3N6IA 2ZY5A 3FDDA 3B6GD 3ZNTA 3NQJB 3LELC 1Y54A 3BFCA 1P3GD 1P3IA 1N1JA 3REID 3FZCA 5GLAA 5EECA 3MVDA 4X6TA 4H9QA 1EWZA 1GCEA 1P3AA 4JF5A 4JF6A 3PBTA 3O88A 1P3PC 5GHZA 3EQVA 3C1CA 1K56D 3VH5T 3LZ0B 3PBNA 4WMCD 4AWLC 2IWDA 3O3VA 3MGQA 3MNNB 5GT3D 5GT0B 4E3NA 1K38A 1CEFA 1TAFB 4JXVA 1W2EA 3VMAA 1BH9B 1YMXA 4HESA 3ZVTA 4ZUXA 3JYIA 1IYPA 5AV5B 3F6TA 4J8VB 4LD9A 5A90A 4DE3A 4UA9A 2ZM8A 2H0TA 3MGRB 3WAAC 2UWXA 3FV7A 4ZBJB 3AZND 2G5IC 3AZLB 2Y59A 4UUZB 4QLCB 4LV0A 5AVCB 1KE4A 5TFQA 1KX3B 5GSUB 4OJOA 4XZQD 1P3MB 5FQQA 4BQMA 5HAIA 4Z5TD 4P85A 1ERMA 4X23D 1EQZA 4N9LA 2ZD8A 2G5HC 3L26A 4WYYA 3KXBB 3IT9A 3KSYA 5E5AB 4DRTA 5B40C 4KG2A 1TZYC 5DNMD 3C4PA 3AGFA 5B0ZB 3AFAB 3X1VC 3PBSA 3MGPB 3Q07A 5AV8C 4KG5A 5BNXB 1RP5A 4B88A 1B67A 2GDNA 3NDGA 3AZIC 5AV9A 1P3OD 5B24A 1YU3A 5DF7A 4R8PD 4LCLA 3REKA 4IEDA 3X1UC 1HQ3A 3LO7A 2JC7A 3ZDJA 3GSGA 1IYQA 2CC1A 3WWXA 4HGAB 4N1HA 1K57A 4FSFA 3AZGC 4KZ6A 3ZG8B 3W97C 4IVKA 2WAFA 2QPNA 1P3LA 2XFSA 3P98A 2EXBA 4CAYA 3R45A 3TSGA 3VP1A 1M19B 1ALQA 2P9VA 3M2JA 5B2JB 5A91A 3Q7ZA 3W4OA 2WUQA 4KZ4A 4GNUA 4OQGA 4YS3C 1M1AB 5CP6C 5E43A 5HAPA 1NYYA 3B0DB 1WYCA 5BNVA 3UT9C 3RELB 1YLPA 5FUGB 1BLPA 1BUEA 3HLEA 3REHA 2ZC4B 1XA1A 1C3BA 4YM6B 1YLTA 5DVAA 3DW0A 1H8ZA 5AVBA 3I7JA 3X1SA 3SS3A 1LHYA 1K55A 1ONHA 3WX7A 1KU5A 3LJAA 1NY0A 2H5SA 1W8YA 5HX9A 4E3IA 3M6HA 4H9PA 1RGYA 3WRTA 3UE0A 3MGSD 3C1BA 2HDUA 5TGFA 4ID4A 1KE3A 5KDMB 3W98A 4JXSA 3EPLA 1AOIB 2OSUA 3AV1C 4MNRA 4QU3A 5FATA 3B6GB 4RVAA 1DJAA 3HVFA 5EVID 4IJEA 1P3GB 4KENB 2IO5C 4E44A 1H3OB 3REIB 5AQAA 5B40D 4WU9A 1J9MA 3Q7VA 4MEZA 3A1KA 5HL1A 3IQAA 1KDSA 4R4RA 3KWQA 2HIOA 4QY5A 3GVBA 2BYKA 2F2AC 1P3BA 3KUYD 4MBHA 2BYMA 3BYDA 5GT3B 4C3QA 4JPMA 4LENA 5AV5C 1IYSA 4Y0OA 2Y2IA 4KQRA 3AZMA 4WELA 3O62B 3EPKA 2WYXA 3G31A 3AZGD 3H0MC 3X1TA 5DNNA 4NFTA 4ZBJC 3W97D 4BLMA 4OLDA 3GV9A 3ZFZA 2B5RA 2F8NH 1KX3C 1ES2A 5U47A 5BT1D 3LELA 1P3MC 3W96A 5GLCA 5F99D 5AY8D 3NY4A 2AROD 5CP6D 2HDRA 4S2MA 2OV5A 1JTDA 1U35D 2XH9A 2RVQC 4B4XA 4Y0UA 3BLSA 2XK1A 5B0ZC 3E2KA 3MGPC 2VQRA 5FAOA 4O7DA 4IBKA 1W8QA 4IBGA 3AZEC 2PYOD 1BLSA 3AV2D 5BS7A 2Y2NA 1XXMA 4Z9QA 1P3FD 2FFYA 4XUJB 4U0XA 4E3JA 4PM7A 1P3OB 4OKPA 4OOYA 3VFHA 5CEDA 5BPVA 3REJA 5B1MC 2ZY2A 3QNBA 5AQBA 1H5XA 4WZ5C 2WADA 3BFGA 3WKJA 1YU4A 3AYWA 2NQBC 2EX8A 3PBRA 4OONA 5B32G 4J8UA 1IELA 5B2JC 1VQQA 4RYEA 2A3UA 4KUDC 4LCMA 4ZDXA 2EXAA 3UO9A 3AZFD 4EV4A 1BZAA 3AZJD 1JFIA 3AZHC 2HPBA 1DJBA 4KZ8A 4RA7A 4S2OA 3W4PA 3PAGA 1TZYA 1P3PB 2F8NA 4GD8A 3KS4A 4YM6C 1U60A 1Q2QA 3UDIA 1KX4D 4AWLB 3M2KA 5B2IC 1BH8A 3AZIA 4WNNB 1KX5D 2R9XA 4J8WC 4QNLA 2LY8A 4KHAB 2WZZA 3X1UA 2FJ7A 4S2LA 5CPID 1IKIA 1L2SA 1P3KD 4OPZA 1LL5A 5F83A 2ZM0A 5E2FA 2YFVA 1JVJA 4QY6A 4P87A 5B31C 5GXQD 5HARA 3WAAB 2WZXA 3AN2C 1GHPA 1KGGA 3W99D 4G92B 2DNSA 4KG6A 3B6GC 3TU4D 4WU8D 1LL9A 3WA9A 4XXRA 1P3GC 4YS3A 5AV6D 2ZQAA 4IBXA 3REIC 3FYZA 5BO0B 1O7EA 2H0YA 4M3KA 5D3OA 4C75A 4RX2A 5B40B 5CGSA 3C4OA 4ZJ1A 3AL0C 1Q9CA 1W5DA 3X1VB 5B33C 3MVDD 3B6FA 5AV8B 3UTBC 2ZY4A 5G49A 3EG5B 5JRGA 4CPKA 1SKFA 4J8XA 2ZY3A 3G35A 5B1MD 4IVIA 4S2NC 1GA9A 3LY4A 3UTAD 4GKUA 3M6BA 1F66A 3L27A 4ZUXD 3AZGB 4DDYA 1ID3A 2HP9A 3AZNC 3W97B 3NQJA 2V1ZA 1T3UA 4KUDD 5DF9A 3UY6A 4NE3A 5DTSA 4XZQC 3MZEA 4DE2A 3AZHD 4GOGA 1W7FA 1TEMA 4Z5TC 5AY8B 4X23C 5CP6B 4OOMA 1ZLAA 2Z2LB 3WS1A 1GHIA 5CTMA 3LZ0A 3VP3A 4HBUA 3MNNA 4N92A 5DNMC 4DQYB 3V39A 1BFMA 5GT0A 3AZKA 5B2ID 1EQZD 1PZPA 1TAFA 2ZC5B 3Q1FA 4J8WD 4PPRA 3IH8A 3ZNYA 4R8PC 3IH9A 5CECA 4J8VA 2J7VA 5CPKC 3MGRA 1XGJA 4PM6A 3V50A 1MXOA 4IJFA 3AN2D 3OPRA 3AZLA 4UUZA 3HL9A 1HQ3D 4QLCA 5AVCA 3GRJA 1KX3A 5GSUA 3N8RA 2J9PA 1P3MA 4H9RB 5KSCA 3RXWA 3AV1B 1TDGA 3SOIA 1P34C 1FQGA 3UDXA 4JF4A 3KXBA 2PU4A 5E5AA 1NJ4A 3B0CT 3BECA 5L2FA 3AZJB 2IO5B 3AFAA 3NQUB 3MGPA 3BFFA 5BNXA 5B33D 3IP4C 3MZDA 1SCWA 2I72A 3V9RB 2FFFB 3WTPD 3UTBD 1KX4B 3REHD 1L0FA 1KX5B 4H9SA 2XD1A 4OPYA 4JXWA 1YLZA 5CPIB 1BSGA 3BFDA 1M18A 4EO5B 4G92C 3PAEA 4EBLA 3MGSC 1M19A 5KMWA 5CEBA 5B2JA 4JXGA 3LJAD 3ITBA 3W99B 2G2WA 2C6WB 2EX2A 1M1AA 3C1BD 3TU4B 4WU8B 5B1LD 3FKEA 4OJ5A 3W98D 5EVIC 4WBGA 5EOOA 3SH7A 4H9OB 3RELA 1BULA 5FUGA 3L25A 2QMIA 4OPQA 1HVBA 4S2PA 5CXWA 3VP0A 4YM6A 5FI2A 1KVMA 4NZ4A 4IBDA 2WGVA 4MLLA 3S4XA 4JKTA 3AZEB 5CPJD 3V3SA 3KUYC 5CHLB 3UPPA 5CPKD 3OZHA 1S32C 2L5AA 2XDMA 3KWQD 4N9KA 3IHAA 2HIOD 4Z2MH 5DTKA 3VOZA 1P3BD 5M1AA 4R23A 1PWCA 3G2ZA 5B1MB 2CV5C 3HONA 1K25A 4GD6A 4GH9A 5CHUA 3UTAB 1AOIA 2NQBB 3UN7A 2RIQA 1PI5A 3EQUA 4ZTKA 3AZMD 2WKEA 3EPHA 3WS4A 4OQ0A 5BT1C 3X1TD 4EBPA 5F99C 1P34D 4KUDB 5AY8C 2AROC 5FAQA 1H3OA 2ZC7A 3HUNA 1U35C 3ZG0A 4OUIA 4OVDA 3AZHB 3SS4A 3V5MA 1CEGA 3W96D 4JJNC 2NZDD 3E2LA 2J9OA 3G30A 4IBJA 2PYOC 4NE6A 2EFUA 4CJNA 1HZOA 3AV2C 5GT3A 5KSHA 5GL9A 5B2IB 1QMFA 1EQZB 1P3FC 4J8WB 4GHAA 4LV2A 4NYYA 1PIOA 3VSLA 3O62A 4KZ9A 5FAPA 4QHCA 5HW3A 5J8XA 4KZ5A 3TG9A 3VH5A 4S2NA 2DF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLD A;  3VSK A;  3ISG A;  3QNB A;  2X02 A;  3DTM A;  1MWS A;  5AQB A;  1H5X A;  4Q8I A;  1NXY A;  3IWI A;  2WAD A;  3BFG A;  3CMZ A;  4WZ5 C;  4BD0 A;  3OPH A;  4BL2 A;  5E2H A;  1MKI A;  3PBR A;  2EX8 A;  1Q2P A;  4OON A;  3IF5 A;  3MFD A;  1XKZ A;  3W4Q A;  4KQO A;  3RJU A;  1IEL A;  1FCO A;  4L0L A;  1VQQ A;  4QB8 A;  1L0G A;  5A93 A;  4RYE A;  5AQ9 A;  4E3K A;  3G34 A;  1PWD A;  2A3U A;  4EUZ A;  3IXG A;  1ERQ A;  4RX3 A;  4DDS A;  4LCM A;  4ZDX A;  1MPL A;  5CER A;  1WE4 A;  1GA0 A;  2EXA A;  3DWK A;  3UO9 A;  3HBR A;  2XFT A;  3UE3 A;  2VGK A;  5CRF A;  1NYM A;  4WEJ A;  4EV4 A;  5HAQ A;  1JWP A;  1BZA A;  3C5A A;  2E8I A;  2WKI A;  5TR7 A;  3IF6 A;  4S2K A;  2HPB A;  2XLN A;  1DJB A;  4KZ8 A;  4RA7 A;  4S2O A;  3W4P A;  4BL3 A;  4DKI A;  4D2O A;  1ERO A;  1K6S A;  1XP4 A;  3PAG A;  2BG1 A;  4GB7 A;  2ZLY A;  3CZD A;  4S2J A;  4GD8 A;  3IF6 C;  5EOE A;  5EE8 A;  1E25 A;  1TVF A;  1IEM A;  3G4P A;  1U60 A;  1W79 A;  1Q2Q A;  5CHM A;  2V2F F;  2ZQ8 A;  1IKG A;  3LEZ A;  3UDI A;  3Q81 A;  4DE0 A;  3M2K A;  1YQS A;  5BOH A;  2XF3 A;  1GHM A;  2EFX A;  2VGJ A;  1FSY A;  4S2I A;  1XGI A;  2R9X A;  4DE1 A;  1BLC A;  1PWG A;  1PZO A;  1YLW A;  3HLB A;  4Y0T A;  1PI4 A;  2WZZ A;  4KQQ A;  1FCN A;  4S2L A;  1IKI A;  4OQH A;  3N8S A;  1L2S A;  1O07 A;  4U3T A;  3GTC A;  3C7U A;  4OPZ A;  1LL5 A;  4WEK A;  5F83 A;  4DF6 A;  2ZM0 A;  4OPR A;  1G68 A;  5E2F A;  1OME A;  1JVJ A;  4QY6 A;  3W8K A;  4P87 A;  3A3F A;  3QNC A;  4GDN A;  3BM6 A;  5HAR A;  1H8Y A;  2WZX A;  2RCX A;  1GHP A;  1LI9 A;  1YT4 A;  4OP8 A;  5CTN A;  4WM9 A;  4HBT A;  1KGG A;  3QHY A;  4EQI A;  2JCH A;  3HLG A;  3HLC A;  2DNS A;  5FQ9 A;  1K54 A;  3S22 A;  4F94 A;  2X01 A;  4KG6 A;  3N6I A;  2BLS A;  4GZB A;  4OLG A;  5FI6 A;  3ZNT A;  3OPP A;  1K54 C;  1N9B A;  3GR2 A;  1LL9 A;  4OQI A;  4XXR A;  3VP4 A;  1Y54 A;  3VOY A;  3N8L A;  3HRE A;  4R1G A;  2ZQA A;  3BFC A;  4IBX A;  3FYZ A;  3CG5 A;  5FSR A;  3RXX A;  1FSW A;  5EUA A;  3FZC A;  1O7E A;  1K56 A;  4WMC A;  5EEC A;  5GLA A;  2H0Y A;  4X6T A;  4FH4 A;  4UHU A;  1YLJ A;  1EWZ A;  1GCE A;  1XPB A;  4JF5 A;  3D4F A;  4M3K A;  4ZAM A;  4JF6 A;  2WKH A;  3PBT A;  1PW1 A;  2ZQC A;  3O88 A;  4R3J A;  4OOL A;  5CGW A;  3G2Y A;  5GHZ A;  5D3O A;  4C75 A;  4RX2 A;  3CJM A;  2ZC3 B;  5CGS A;  3B3X A;  3C4O A;  3EQV A;  4ZJ1 A;  2EX9 A;  1W5D A;  1K56 D;  2JBF A;  3PBN A;  4WMC D;  3UPO A;  1DY6 A;  1ES3 A;  1QME A;  3IHB A;  2IWD A;  2Y55 A;  3O3V A;  4NK3 A;  4N1X A;  1NZO A;  4E6W A;  3HUM A;  5M19 A;  4DXB A;  5EPH A;  1KGE A;  3ZCZ A;  2Y2M A;  1WYB A;  1JWZ A;  4LV1 A;  4UA7 A;  5FA7 A;  2Q9N A;  3TOI A;  3HUO A;  3V3R A;  1K38 A;  4E3N A;  1CEF A;  1CK3 A;  4JXV A;  3VMA A;  2ZM2 A;  4FD8 A;  4CPK A;  1YMX A;  4HES A;  4R3B A;  1SKF A;  3ZVT A;  3G35 A;  2Y2P A;  3JYI A;  4PM8 A;  3S1Y A;  1IYP A;  4KZA A;  4IVI A;  4S2N C;  1GA9 A;  1MWR A;  3LY4 A;  4X69 A;  5A90 A;  4DE3 A;  4UA9 A;  2ZM8 A;  2H0T A;  2OLU A;  4GKU A;  2J8Y A;  3M6B A;  1ES4 A;  4K91 A;  2UWX A;  2JE5 A;  5I94 A;  4PM9 A;  3OCN A;  3GMW A;  4DDY A;  2HP9 A;  4PM5 A;  2ZQ9 A;  1ESU A;  3FV7 A;  3MBZ A;  3WS0 A;  1PW8 A;  3UE1 A;  2V1Z A;  3IXB A;  3OC2 A;  2Y59 A;  4KZ7 A;  4QD4 A;  5DF9 A;  3UY6 A;  4DXC A;  1MWT A;  4LV0 A;  5M18 A;  1KE4 A;  5TFQ A;  5DTS A;  1SDE A;  3MZE A;  1MBL A;  2ZJ9 A;  4DE2 A;  3MXR A;  4GOG A;  5JYP A;  1W7F A;  1TEM A;  1ZG4 A;  2P9V B;  1NRF A;  5FQQ A;  3BRM A;  4E3L A;  4BQM A;  4OOM A;  4P85 A;  5HAI A;  1ERM A;  2Z2L B;  4N9L A;  3WS1 A;  2H10 A;  1GHI A;  1SDN A;  2ZD8 A;  5CTM A;  3Q82 A;  3VP3 A;  4HBU A;  4WYY A;  3ZG5 A;  3IT9 A;  4N92 A;  4R0Q A;  4U0T A;  4DRT A;  1HTZ A;  4KG2 A;  3V39 A;  1YM1 A;  2HP6 A;  3C4P A;  3AGF A;  3PBS A;  4MBK A;  4WZ4 A;  1PZP A;  3Q07 A;  2HP5 A;  5IHV A;  2ZC5 B;  3Q1F A;  4KG5 A;  3PBQ A;  1RP5 A;  4PPR A;  5F1F A;  2IWB A;  4B88 A;  2Y2L A;  4PMA A;  3LCE A;  1FCM A;  3IH8 A;  2GDN A;  3NDG A;  3ZNY A;  4KZB A;  3IH9 A;  5CHJ A;  5CEC A;  5A92 A;  1Z6F A;  2J7V A;  5DF7 A;  4LCL A;  4ZJ2 A;  3ITA A;  1KGF A;  4IED A;  3MKE A;  1XGJ A;  1KDW A;  4K0X A;  4HEF A;  4PM6 A;  3V50 A;  3ZHH A;  2RL3 A;  3ZG7 B;  3LO7 A;  2JC7 A;  3NIA A;  3ZDJ A;  3GSG A;  1FOF A;  1MXO A;  3NI9 A;  1IYQ A;  1CI8 A;  2CC1 A;  3WWX A;  3OPR A;  4N1H A;  1K57 A;  2Q9M A;  1ONG A;  2EX6 A;  4FSF A;  1S0W A;  4KZ6 A;  3HL9 A;  3ZG8 B;  1ZG6 A;  4IVK A;  5FQM A;  2WAF A;  4C6Y A;  2QPN A;  3GRJ A;  2XFS A;  3P98 A;  2EXB A;  3MKF A;  1K57 C;  1M40 A;  3A3J A;  2QZ6 A;  3N8R A;  3O86 A;  3TSG A;  2J9P A;  3VP1 A;  1ALQ A;  2P9V A;  3M2J A;  4GN2 A;  5KSC A;  3RXW A;  5DF8 A;  5A91 A;  5EVL A;  3A3D A;  1TDG A;  3NC8 A;  3SOI A;  1XA7 A;  5FQK A;  3MZF A;  1FQG A;  1ZC2 A;  3Q7Z A;  3W4O A;  3UDX A;  3N7W A;  1JTG A;  2WUQ A;  2XQZ A;  4BJP A;  4JF4 A;  1YLY A;  4KZ4 A;  2PU4 A;  4GNU A;  4OQG A;  5EVI B;  2DCF A;  4X68 A;  5FAS A;  5E43 A;  5HAP A;  1SHV A;  1LLB A;  2ZQ7 A;  3FKW A;  1NJ4 A;  1NYY A;  3BEC A;  4IBR A;  5L2F A;  3ZVW A;  4UA6 A;  1WYC A;  3BFF A;  3PTE A;  3SH9 A;  4KZ3 A;  3OPL A;  2V20 A;  5JYO A;  1YLP A;  5F82 A;  1I5Q A;  1BLP A;  1BUE A;  3HLE A;  5CGX A;  3MZD A;  1SCW A;  2I72 A;  2ZC4 B;  3Q7V B;  1XA1 A;  2FFF B;  1C3B A;  4JBF A;  1YLT A;  1VM1 A;  5DVA A;  4OP5 A;  2Y2O A;  3DW0 A;  1H8Z A;  3I7J A;  3SS3 A;  2Y2Q A;  1JWV A;  1L0F A;  1LHY A;  3IWQ A;  2XD1 A;  1PYY A;  3ZGA B;  1K55 A;  1ONH A;  1K4F A;  4OPY A;  5F1G A;  4JXW A;  1CI9 A;  1YLZ A;  2Y4A A;  3SS5 A;  2XR0 A;  1BSG A;  3BFD A;  3G32 A;  5E2E A;  3AGD A;  1K55 C;  2Y2K A;  1NY0 A;  2H5S A;  2Y2H A;  4XUX A;  5FQI A;  1W8Y A;  3A3I A;  5HX9 A;  3PAE A;  4EBL A;  1G6A A;  2X71 A;  2ZC6 B;  4E3I A;  3M6H A;  3OCL A;  1RGY A;  3WRT A;  3UE0 A;  1L0D A;  4LV3 A;  1HD8 A;  1MWU A;  5KMW A;  4B4Z A;  2HDU A;  3P09 A;  5FQJ A;  5TGF A;  3WS2 A;  4ID4 A;  4JXG A;  5CEB A;  4P0M A;  1YMS A;  1KE3 A;  4FCF A;  5FI7 A;  3ITB A;  2G2W A;  2WAE A;  4JXS A;  5EVI A;  2IWC A;  4XUZ A;  2C6W B;  2EX2 A;  4P6B A;  3HLW A;  2OSU A;  4MNR A;  2P74 A;  4R4S A;  1TDL A;  2A49 A;  4QU3 A;  3DWZ A;  5FAT A;  4RVA A;  4E3M A;  1DJA A;  5AQ7 A;  5EVI C;  4WBG A;  3UPN A;  5EOO A;  3SH7 A;  1BUL A;  2Y91 A;  3HVF A;  1LI0 A;  5EVI D;  4QJG A;  2QMI A;  4OPQ A;  1K4E A;  1HVB A;  4KEN B;  2R9W A;  1ESI A;  4S2P A;  5AQA A;  1J9M A;  3BEB A;  3Q7V A;  5CXW A;  3VP0 A;  4MEZ A;  3FWL A;  3NCK A;  5HL1 A;  2WGI A;  5FI2 A;  1KVM A;  2Z2M B;  3IQA A;  2XGN A;  4K0W A;  1KDS A;  4R4R A;  2WGV A;  4MLL A;  3S4X A;  2WGW B;  4JKT A;  4YIN A;  5G18 A;  4UAA A;  3WS5 A;  4MBF A;  3V3S A;  3FKV A;  4QY5 A;  1L0E A;  3GVB A;  1E3U A;  3NDE A;  4A5R A;  4MBH A;  3UPP A;  3BYD A;  2HDS A;  4C3Q A;  3SH8 A;  4ZJ3 A;  1IYO A;  3OZH A;  4JPM A;  2ZQD A;  4LEN A;  2XDM A;  1IYS A;  4N9K A;  5FDH A;  3IHA A;  3GQZ A;  4Y0O A;  5DTK A;  2Y2I A;  1E4D A;  3VOZ A;  4KQR A;  2Y2G A;  1E3U D;  5M1A A;  4R23 A;  1RCJ A;  1PWC A;  3BLM A;  3G2Z A;  1BTL A;  4OH0 A;  4WEL A;  3BFE A;  5KZH A;  2WYX A;  2G2U A;  4GDB A;  1K25 A;  4GD6 A;  3G31 A;  3MXS A;  3UDF A;  1AXB A;  3A3E A;  3IWO A;  5CHU A;  5HFO A;  1K6R A;  3IXD A;  3WRZ A;  5GHY A;  3N4I A;  1ZKJ A;  4BLM A;  2HDQ A;  1RGZ A;  4OLD A;  3GV9 A;  3ZFZ A;  4EBN A;  3UN7 A;  4ZTK A;  1PI5 A;  2B5R A;  3EQU A;  4E3O A;  2WKE A;  1MY8 A;  1FR1 A;  3WS4 A;  2XEP A;  4OQ0 A;  3ZG9 B;  3HLF A;  1ES2 A;  4EBP A;  5U47 A;  4ZBE A;  3HLD A;  5GLC A;  2PU2 A;  1M6K A;  5FAQ A;  3NY4 A;  4FH2 A;  2ZC7 A;  3HUN A;  5GLB A;  1KVL A;  5DTT A;  4X55 A;  4X53 A;  3ZG0 A;  2HDR A;  4S2M A;  2OV5 A;  1I2S A;  1JTD A;  4OVD A;  1DJC A;  3SS4 A;  3V5M A;  2XH9 A;  1BT5 A;  1CEG A;  2WK0 A;  3PBO A;  3UNW A;  4B4X A;  2DRW A;  4Y0U A;  1S6R A;  5GHX A;  4EWF A;  2WGW A;  2XK1 A;  3BLS A;  1EI5 A;  3NBL A;  3E2L A;  3E2K A;  5FAO A;  4O7D A;  1W8Q A;  3VFF A;  2J9O A;  4JLF A;  3C7V A;  1N4O A;  3G30 A;  3IF6 B;  4Y7P A;  4BD1 A;  3LY3 A;  2EFU A;  4CJN A;  1NZU A;  1HZO A;  5KSH A;  3IXH A;  1BLS A;  5GL9 A;  2PBY A;  1FR6 A;  1QMF A;  2Y2N A;  1I2W A;  1XXM A;  1KE0 A;  5E2G A;  4X56 A;  4BEN A;  4Z9Q A;  4LV2 A;  2FFY A;  4YFM A;  1PIO A;  2XD5 A;  2OLV A;  4H8R A;  2Y2J A;  3VSL A;  1ES5 A;  4KZ9 A;  4QHC A;  4U0X A;  1BLH A;  5FAP A;  4E3J A;  5HW3 A;  3AGE A;  4PM7 A;  3VP2 A;  5J8X A;  4OKP A;  4KZ5 A;  4OOY A;  3VFH A;  4WZ5 A;  3TG9 A;  2ZMA A;  5CED A;  1XX2 A;  4NET A;  4E6X A;  4S2N A;  3O87 A;  2C5W B; 
#chains in the Genus database with same CATH topology
 3C8C A;  2X02 A;  1NXY A;  3IWI A;  5B31 B;  4Q0J A;  2OWH A;  5EM1 A;  4NY2 A;  3AN2 B;  2HZ5 A;  4G91 C;  4B93 A;  2F8N G;  3W4Q A;  1D1J A;  4L0L A;  4QB8 A;  5A93 A;  2YFW B;  1PWD A;  4Z66 C;  4EUZ A;  3IXG A;  3WKJ D;  4DDS A;  3AYW D;  3CWF A;  1MPL A;  1GA0 A;  3DWK A;  3AZF C;  2O99 A;  1W1T A;  4CLC D;  4J8U D;  1Y4O A;  3AZJ C;  1UWN X;  1GPF A;  1NYM A;  3CLO A;  1VEU B;  1OJ5 A;  5TR7 A;  2XLN A;  4BL3 A;  2ACG A;  4LG2 A;  1K6S A;  5HWT A;  3CZD A;  3IF6 C;  5EOE A;  5EE8 A;  1TVF A;  4Y5F A;  2B02 A;  1KX4 C;  3G4P A;  1W79 A;  4XUJ A;  5CHM A;  5B33 B;  3NOT C;  3Q81 A;  4DE0 A;  1YQS A;  4KGC C;  2EFX A;  1KX5 C;  1P3O A;  5B32 C;  1XGI A;  2F8N D;  1S32 D;  3WTP B;  3UTB B;  1NRJ A;  3HLB A;  1PI4 A;  5CPI C;  1W1Y A;  4KQQ A;  3REH B;  3CI6 A;  4EO5 C;  1P3K C;  2CV5 D;  4U3T A;  3GTC A;  5B0Y C;  4WEK A;  5GXQ C;  3W8K A;  3A3F A;  3QNC A;  4Y17 A;  2FJ7 D;  3MXQ A;  3LZ1 D;  2RCX A;  3W99 C;  1O6I A;  4DRB A;  1LI9 A;  1GSX A;  4HBT A;  4EQI A;  2KOI A;  2JCH A;  3HLC A;  3AZN B;  5FQ9 A;  3TU4 C;  2EA9 A;  2VJW A;  1AIW A;  4WU8 C;  4GZB A;  4OLG A;  5FI6 A;  5HD3 A;  1K54 C;  1N9B A;  1OGB A;  5AV6 C;  2OOL A;  3NEC A;  3VP4 A;  3VOY A;  4XZQ B;  1DP9 A;  5HSQ A;  1P3P A;  5B1L B;  4Z5T B;  4X23 B;  4JJN D;  1FSW A;  1XJ4 A;  4FH4 A;  4UHU A;  1YLJ A;  3T4K A;  3WA9 D;  1P3I C;  2ZQC A;  5CGW A;  4R3J A;  3G2Y A;  5DNM B;  4WNN A;  3MVD C;  2EX9 A;  1YSQ A;  1DY6 A;  1ES3 A;  1QME A;  3IHB A;  3T4L A;  2Y55 A;  4KHA A;  4NK3 A;  5HPI A;  1NZO A;  3HUM A;  5CPJ B;  4DXB A;  5EPH A;  3C1C C;  1KGE A;  3UB7 A;  2Y2M A;  1JWZ A;  4UA7 A;  3V3R A;  3HUO A;  1H0M A;  4R8P B;  3B6F D;  5CPK B;  3MR0 A;  4FD8 A;  4FTX A;  4R3B A;  3WAA A;  2W1T B;  4PM8 A;  3VH6 T;  2HUE C;  4KZA A;  3UTA C;  4D60 A;  1B6W A;  4NG2 A;  2OLU A;  5JRG D;  4ZUX C;  4K91 A;  4J8X D;  1YUE A;  1W63 M;  2D02 A;  4F3L A;  3OCN A;  3MF0 A;  4LD9 C;  4PM5 A;  2ZQ9 A;  2LB5 A;  2W0N A;  3K2N A;  3WS0 A;  3LR4 A;  3UE1 A;  4Z66 D;  2J8P A;  5FDS A;  3OC2 A;  4KUK A;  1F9I A;  4KZ7 A;  4M6B A;  3WTP E;  5BO0 A;  4DXC A;  1ID3 D;  3ULF A;  5M18 A;  2VGL M;  1P34 B;  2AVX A;  3VE4 A;  3MXR A;  5JYP A;  3U2A A;  3H0R C;  1CF0 A;  1ZG4 A;  1NRF A;  3BRM A;  2JSS A;  5B40 A;  2H10 A;  1SDN A;  3X1V A;  3Q82 A;  4HH3 A;  3ZG5 A;  4R0Q A;  5AV8 A;  4U0T A;  2PD8 A;  2NZD B;  1HTZ A;  1EQZ C;  2QJ7 A;  4LPZ A;  4KGC D;  1ZLA D;  4MBK A;  4WZ4 A;  5B32 D;  5IHV A;  2L4R A;  1XJ6 A;  3A6N D;  2Y2L A;  2Z6D A;  5GT0 D;  3AZK D;  4KZB A;  3MJQ A;  1KGF A;  4NZ5 A;  3MKE A;  4K0X A;  4GW9 A;  5B0Y D;  4OJL A;  5AV9 C;  3AZG A;  2RL3 A;  5K5B A;  1W1V A;  3W97 A;  1FOF A;  3NI9 A;  1YAX A;  3LR3 A;  3P7N A;  3MGS B;  1HQ3 C;  2Q9M A;  3MGR D;  4WUJ A;  3EWK A;  3L2A A;  2ZM5 A;  1L6J A;  5FQM A;  2P08 A;  2VLG A;  4MCW A;  1K57 C;  1M40 A;  3A3J A;  1DRM A;  2QZ6 A;  3O86 A;  5AY8 A;  2D49 A;  4GN2 A;  5CP6 A;  4QLC D;  3KFU G;  1XA7 A;  4LLO B;  5FQK A;  3MZF A;  3LR0 A;  3DTK A;  3AYW B;  5AVC D;  1JTG A;  2D01 A;  4BJP A;  5GSU D;  5EVI B;  4CLC B;  3UT9 A;  3EEH A;  4J8U B;  3O5Y A;  4X68 A;  3L7H A;  5FAS A;  1LLB A;  2ZQ7 A;  3FKW A;  2W8S A;  1P3I D;  4UA6 A;  4WJ3 C;  4KZ3 A;  2V20 A;  4NZ3 A;  3E0Y A;  5F82 A;  5JYO A;  3KXB D;  4IJG A;  1P3A D;  5E5A D;  5CGX A;  3KO6 A;  3R7W B;  3WTP C;  3AFA D;  4H9N B;  4BWI A;  4JBF A;  3C1C D;  3KUY B;  3T1Q B;  3F1N B;  1VM1 A;  3REH C;  4OP5 A;  2Y2O A;  1EW0 A;  3MGQ D;  2ZOI A;  2Y2Q A;  3C38 A;  1S32 B;  3S7O A;  2GZA A;  4OJP A;  1N9L A;  2JHE A;  2Y4A A;  4B9O A;  2XR0 A;  4HJ3 A;  3X1S C;  3G32 A;  3AGD A;  1K55 C;  2Y2K A;  2CV5 B;  5FQI A;  1G6A A;  2X71 A;  2ZC6 B;  4LD9 D;  4NXE A;  4I3I A;  4H9R A;  4B4Z A;  3P09 A;  3LZ1 B;  3LJA C;  4Y15 A;  3AV1 A;  5FQJ A;  3S7P A;  1M18 D;  1YMS A;  4Q0H A;  5FI7 A;  4DJ2 A;  3D9Y A;  4OJ6 A;  1OPX A;  3C1B C;  4XUZ A;  1AWI A;  4P6B A;  3HLW A;  5F99 B;  4K08 A;  4ME4 A;  1M19 D;  2A49 A;  5B1L C;  3DWZ A;  1Z2C B;  2ARO B;  3W98 C;  3NQU A;  2M7V A;  4E3M A;  5AQ7 A;  3UPN A;  1TS8 A;  1U35 B;  2Y91 A;  1OTE A;  4QJG A;  1M1A D;  1K4E A;  4JJN B;  4HOI A;  3V9R A;  4NKP A;  4GCZ A;  3FWL A;  2W3F A;  1KX4 A;  3LR5 A;  1BH9 A;  2PYO B;  5CPJ C;  2WGW B;  3K3C A;  3AV2 B;  4YIN A;  5G18 A;  4WU9 C;  1KX5 A;  3WS5 A;  4MBF A;  3FKV A;  5AV5 A;  1L0E A;  1E3U A;  1P3F B;  3NDE A;  1V9Y A;  4R38 A;  5HDD A;  5CPI A;  2HDS A;  2ZBB A;  3KWQ C;  3SH8 A;  3UB6 A;  1IYO A;  2HIO C;  4NE5 A;  3L28 A;  3GQZ A;  5AV9 D;  1P3B C;  4HHD A;  1E4D A;  4CLC E;  5B24 D;  4IBI A;  4LRY C;  3VH5 W;  3REK D;  4OH0 A;  1BTL A;  3BFE A;  4M4X A;  2MJ6 A;  3MXS A;  3W99 A;  1VB6 A;  3A3E A;  5HFO A;  3UDF A;  2V8F A;  1ODV A;  3IXD A;  3N4I A;  2HDQ A;  1WWI A;  3E4Q A;  1RGZ A;  3AZM C;  4G91 B;  4R70 A;  4EBN A;  3TU4 A;  4E3O A;  2O9C A;  1MY8 A;  2ZMV A;  3H0L C;  1FR1 A;  3X1T C;  2XEP A;  3ZG9 B;  4H9O A;  3HLF A;  2WKP A;  1P3L D;  4Z66 B;  4HH2 A;  1AOI D;  4UEY A;  3AZF B;  4JGQ A;  1F1E A;  4FH2 A;  5B0Z A;  1ID3 B;  3EEA A;  4X53 A;  1J7M A;  2I9V A;  4DMZ A;  2IA2 A;  3W96 C;  1DJC A;  3SZT A;  4HME A;  2NZD C;  5HD5 A;  4WZS B;  4Y2F A;  4EWF A;  2PD7 A;  3AZE A;  3F1P B;  4DRA A;  4GS9 B;  4JLF A;  3C7V A;  1N4O A;  4Y7P A;  3IF6 B;  4BD1 A;  1NZU A;  2IOU A;  1CK7 A;  4KGC B;  4IBC A;  3LID A;  1ZLA B;  1KE0 A;  3CUE C;  5B32 B;  4X56 A;  4QWO A;  1S1Y A;  3B0B A;  4H8R A;  5JA4 B;  2Y2J A;  4FOF A;  3A6N B;  1WWS A;  5B1M A;  4Z2M G;  4Z2I A;  5BS7 C;  3UE6 A;  3AZK B;  5AVB D;  3X1S D;  4WZ5 A;  1P3K B;  2ZMA A;  4WN5 A;  4NET A;  4ARZ A;  3UTA A;  2M1C A;  3O87 A;  2NQB A;  2GNX A;  3DAV A;  5B0Y B;  2O0Y A;  3ISG A;  5GXQ B;  3O62 D;  1MWS A;  3DTM A;  3IX4 A;  4Q8I A;  3WD3 A;  4CSR B;  4BD0 A;  4BL2 A;  3IX8 A;  3REJ C;  1MKI A;  4Z2G A;  5HWV A;  1Q2P A;  4UQI S;  4KUD A;  1XKZ A;  2ZL1 A;  4IBE A;  1OT9 A;  1FCO A;  4NYU A;  5TJJ A;  3WKJ C;  3IBR A;  3AYW C;  1L0G A;  4E3K A;  3G34 A;  4YOF A;  5I5L A;  4CLC C;  3AZH A;  5CER A;  4J8U C;  4EXO A;  5AV6 B;  3HBR A;  2XFT A;  5F6A A;  3UE3 A;  3LI9 A;  2VGK A;  4WEJ A;  2FH5 A;  2VGL S;  5HAQ A;  1JWP A;  1KOU A;  3JPU A;  4IBF A;  3LIE A;  4LGW A;  1E15 A;  3P5J B;  2J80 A;  5B2I A;  2BG1 A;  1P3I B;  4GB7 A;  4JGO A;  3H7W A;  1N1J B;  4S2J A;  5EFW A;  1IEM A;  4WU9 D;  4RQ9 A;  3MVD B;  4J8W A;  4H9Q B;  1HLU P;  1P3A B;  1IKG A;  1GHM A;  2VGJ A;  3WD2 A;  4S2I A;  4L9G A;  4DE1 A;  3C1C B;  4LFU A;  4XUJ D;  3MGQ B;  1GSW A;  1FCN A;  5C3I B;  2JKF A;  4OQH A;  5B31 A;  3DBA A;  5KDM A;  3AN2 A;  3C7U A;  2HUE B;  2K2N A;  2FJ7 C;  1OME A;  3LZ1 C;  2PT7 A;  4ZUX B;  1H8Y A;  3B6G A;  2YFW A;  2KDK A;  2VZW A;  4OP8 A;  5CTN A;  4CQH A;  4WM9 A;  3QHY A;  4LD9 B;  5DNN D;  1P0Z A;  4F94 A;  3KYQ A;  2X01 A;  5DFY A;  1P3G A;  3MQL A;  1M18 B;  5AVE A;  2BLS A;  1VEU A;  3REI A;  3OPP A;  3PR6 A;  5L8M A;  3GR2 A;  3RH8 B;  4OQI A;  3N8L A;  3HRE A;  4E45 A;  4R1G A;  3LEL D;  3MFX A;  4WL9 A;  3CG5 A;  4O0P A;  5FSR A;  3RXX A;  1MZU A;  5EUA A;  1K56 A;  4WMC A;  3WA9 C;  1XPB A;  4ZAM A;  3D4F A;  5B33 A;  2WKH A;  4O8G A;  1PW1 A;  4OOL A;  5KIZ A;  3CJM A;  2ZC3 B;  1P3P D;  1S67 L;  3B3X A;  3WTP A;  3UTB A;  2JBF A;  3UPO A;  4KQD A;  3N3F A;  4N1X A;  1H0I A;  2L1M A;  4E6W A;  2XSS A;  5M19 A;  4AFI A;  3ZCZ A;  2W3H A;  1WYB A;  5FA7 A;  4LV1 A;  2Q9N A;  3TOI A;  3B6F C;  1CK3 A;  1E6P A;  3QP5 A;  2ZM2 A;  3MS6 A;  2Y2P A;  4GHL A;  2PBD P;  3S1Y A;  5AV9 B;  3F1O B;  5B24 B;  1MWR A;  4X69 A;  5JRG C;  3AZN A;  3VE3 A;  3REJ D;  3REK B;  4J8X C;  2J8Y A;  1ES4 A;  1HQ3 B;  2JE5 A;  5IS1 A;  5I94 A;  3WAA D;  4NZ1 A;  4PM9 A;  3GMW A;  1ESU A;  1XFN A;  3BW6 A;  3MBZ A;  1PW8 A;  4XZQ A;  3IXB A;  1F66 C;  2FN2 A;  5G4Y A;  4QD4 A;  5B1L A;  4Z5T A;  1ID3 C;  3BJN A;  4X23 A;  1MWT A;  1P3L B;  3TE8 A;  1SDE A;  1MBL A;  1TF1 A;  2ZJ9 A;  2NUT C;  4CAY B;  3R45 B;  2GJ3 A;  2P9V B;  4II7 A;  5DNM A;  4E3L A;  1SZV A;  3TJZ C;  4HY8 A;  3OBF A;  3PXP A;  3B33 A;  1IFQ A;  3HCY A;  4TX8 A;  5CPJ A;  1ZLA C;  1YM1 A;  4DJ3 A;  2HP6 A;  1L3L A;  1TZY D;  3LZ0 C;  4R8P A;  2HP5 A;  2VA0 A;  3MNN C;  5BNV B;  3X1V D;  3A6N C;  5CPK A;  3PBQ A;  5F1F A;  2IWB A;  5AV8 D;  2W1T A;  5GT0 C;  3AZK C;  4PMA A;  3LCE A;  1FCM A;  3LIA A;  5CHJ A;  5A92 A;  1Z6F A;  3AZI D;  4UPK A;  4YWZ A;  4ZJ2 A;  3ITA A;  4R6L A;  4ETX A;  1KDW A;  4HEF A;  2QKP A;  3X1U D;  4QPR A;  5AVB B;  1E6R A;  3ZHH A;  3ZG7 B;  3X1S B;  4J8V C;  3NIA A;  3MQ0 A;  1YU1 A;  1A7W A;  1CI8 A;  3MGR C;  2ZOH A;  5HPF A;  1ONG A;  2EX6 A;  1OTB A;  1S0W A;  1ZG6 A;  1CJF A;  3LJA B;  2B18 A;  4C6Y A;  1PZR A;  3L29 A;  4NEE D;  1ED7 A;  3KYZ A;  1P34 A;  1CXW A;  3AZL C;  4H9P B;  3MKF A;  3C1B B;  1ZHH B;  4QLC C;  5DF8 A;  5EVL A;  3BQA A;  5AVC C;  3A3D A;  3NC8 A;  5GSU C;  3W98 B;  1ZC2 A;  3VH6 W;  3S7Q A;  3N7W A;  2XQZ A;  1JNU A;  3PYP A;  2F8N K;  1YLY A;  1DP6 A;  3T4J A;  2DCF A;  2A24 B;  2NZD A;  4YS3 D;  1SHV A;  3UB9 A;  4IBR A;  3ZVW A;  2Z6C A;  3PTE A;  3KXB C;  3SH9 A;  1P3A C;  3OPL A;  5E5A C;  5A8B A;  1I5Q A;  4YNR A;  3UT9 D;  1A0K A;  3AFA C;  3IS2 A;  4WU9 B;  3Q7V B;  1HTA A;  2BAS A;  3HJK A;  3MGQ C;  5C3I C;  1QO6 A;  1TS7 A;  3KWQ B;  1JWV A;  3IWQ A;  2HIO B;  1PYY A;  3ZGA B;  4HP4 A;  5DJT A;  1K4F A;  2BYK B;  5F1G A;  1P3B B;  1EAK A;  1OTI A;  3MGS A;  4WF0 A;  2BYM B;  2VKS A;  1CI9 A;  3SS5 A;  2V5O A;  4X25 A;  3VV4 A;  4UQI M;  2YKH A;  4H9S C;  5E2E A;  3KS8 A;  2Y2H A;  4XUX A;  3A0V A;  1P9R A;  3A3I A;  4HGA C;  3OCL A;  3EPJ A;  1L0D A;  4LV3 A;  1HD8 A;  1MWU A;  1M18 C;  5HZH A;  3AZM B;  3WS2 A;  4P0M A;  1F66 D;  2EWV A;  1YSP A;  4HJ6 A;  4FCF A;  2WAE A;  3X1T B;  5DNN B;  2CWE A;  2A2L A;  5EVI A;  2IWC A;  1M19 C;  4CLC A;  1VHM A;  1TS0 A;  2P74 A;  4R4S A;  1TDL A;  3AV1 D;  3LUQ A;  3DTI A;  3C30 A;  1M1A C;  1LI0 A;  3LEL B;  3W96 B;  3B0D C;  3R7W A;  2R9W A;  1ESI A;  1YU2 A;  1OJG A;  4NXG A;  3BEB A;  4H9N A;  5J7E A;  3REL C;  3KUY A;  3HSH A;  4Z2L A;  5HDC A;  1GSV A;  3NCK A;  3LZ0 D;  2WGI A;  2J3T D;  3F1N A;  3RTY A;  2Z2M B;  4K0W A;  2XGN A;  1YU0 A;  3OOV A;  3MNN D;  1G28 A;  1MKM A;  2NUP C;  4UAA A;  1TD5 A;  1S32 A;  2QJ5 A;  4A5R A;  4ZJ3 A;  1NLY A;  2ZQD A;  2CV5 A;  1P9W A;  5FDH A;  5B24 C;  4BBU A;  5AV5 D;  1IOU A;  4J8V D;  3REK C;  2Y2G A;  1E3U D;  1RCJ A;  3BLM A;  5KZH A;  3LZ1 A;  2G2U A;  4GDB A;  2W27 A;  1AXB A;  3IWO A;  3WRZ A;  1K6R A;  5GHY A;  1ZKJ A;  5EV0 A;  3REJ B;  5F99 A;  3AZL D;  2VK3 A;  3KX0 X;  2ARO A;  1P3L C;  1AOI C;  3WKJ B;  1U35 A;  3BY8 A;  3T4O A;  4ZBE A;  1KX3 D;  3HLD A;  2PU2 A;  4PHT A;  1M6K A;  1P3M D;  5FEF A;  4JJN A;  2CMN A;  5GLB A;  1KVL A;  5DTT A;  4X55 A;  1I2S A;  1BT5 A;  2WK0 A;  3PBO A;  2JKG A;  2PYO A;  3UNW A;  2DRW A;  1LL8 A;  1S6R A;  5GHX A;  3V67 A;  2WGW A;  3AV2 A;  2RVQ D;  1EI5 A;  1R4V A;  1VET B;  3A1I A;  2XA7 S;  3NBL A;  4I5S A;  1ULY A;  5B0Z D;  4NXF A;  3VFF A;  1N9N A;  3MGP D;  1JFI B;  1P3F A;  3KYE A;  3LY3 A;  3H82 A;  3IXH A;  3AZE D;  5TBM B;  2PBY A;  1TZY B;  1FR6 A;  1I2W A;  2F8N B;  5E2G A;  4BEN A;  2WKQ A;  5GT3 C;  4YFM A;  2XD5 A;  2OLV A;  4Z1W A;  2VV7 A;  1ES5 A;  5AVB C;  1BLH A;  3AGE A;  3VP2 A;  4GHI B;  1BH8 B;  3T50 A;  1LSX A;  3AZI B;  2V0W A;  1XX2 A;  4E6X A;  2C5W B;  3O62 C;  1UWP X;  5GLD A;  3VSK A;  4HMD A;  3X1U B;  2FJ7 B;  3CMZ A;  1T1B A;  3OPH A;  5E2H A;  1G6O A;  4Z66 A;  1XFQ A;  3IF5 A;  3E98 A;  3MFD A;  2NQB D;  4KQO A;  3RJU A;  2YFV B;  3AZF A;  2DQN C;  3VH6 A;  3AZJ A;  5B2J D;  5AQ9 A;  3WD0 A;  2W3G A;  1ERQ A;  4RX3 A;  2KLI A;  4FUW A;  1WE4 A;  5CRF A;  1YPR A;  3F1P A;  4GS9 A;  4IBB A;  3C5A A;  2E8I A;  2WKI A;  5B31 G;  3IF6 A;  4S2K A;  4EEU A;  3REL D;  3WA9 B;  3ICY A;  4YS3 B;  4DKI A;  4D2O A;  1ERO A;  1XP4 A;  4KGC A;  4EW7 A;  2ZLY A;  5B32 A;  2V8C A;  1E25 A;  2Q0O A;  4IHQ A;  5JA4 A;  2V2F F;  3UT9 B;  3A6N A;  2ZQ8 A;  3LEZ A;  4YM6 D;  5BOH A;  2XF3 A;  1FSY A;  1P3K A;  2PR5 A;  3B0C W;  3QP4 A;  4XUJ C;  2JN7 A;  1BLC A;  1PWG A;  1PZO A;  1YLW A;  3B6F B;  4Y0T A;  5B0Y A;  3QP8 A;  5GXQ A;  1P3O C;  2B95 A;  4CSR A;  3N8S A;  4P6Z S;  2XRN A;  1O07 A;  5G49 B;  3WD1 A;  1LSV A;  4DF6 A;  1W63 Q;  5JRG B;  1G68 A;  4OPR A;  4WV4 B;  4GDN A;  3D3O A;  4J8X B;  3BM6 A;  3R4K A;  5B31 D;  4WU8 A;  1OGG A;  1YT4 A;  5DNN C;  2V9A A;  3HLG A;  3S22 A;  1K54 A;  5AV6 A;  4O01 A;  1F66 B;  3N6I A;  4MB4 A;  2ZY5 A;  3FDD A;  3B6G D;  3ZNT A;  4X1M A;  3NQJ B;  3LEL C;  1Y54 A;  2E8J A;  2WKR A;  3BFC A;  1P3G D;  1P3I A;  3WD4 A;  1N1J A;  3REI D;  3FZC A;  5GLA A;  5EEC A;  3MVD A;  4X6T A;  4H9Q A;  2HJ9 C;  1EWZ A;  1GCE A;  1P3A A;  4JF5 A;  3MQO A;  4JF6 A;  1T1C A;  3O88 A;  3PBT A;  1P3P C;  1SKO A;  5GHZ A;  3T12 B;  5HWW A;  3EQV A;  3C1C A;  1V9Z A;  1K56 D;  3VH5 T;  3LZ0 B;  3PBN A;  1PDC A;  4AWL C;  3JVV A;  4Q0I A;  4WMC D;  2IWD A;  3O3V A;  3MGQ A;  3MNN B;  5GT3 D;  5GT0 B;  3PHY A;  4E3N A;  1K38 A;  1CEF A;  1TAF B;  4JXV A;  2OAQ 1;  1W2E A;  3VMA A;  1BH9 B;  1YMX A;  4HES A;  3ZVT A;  5CX7 A;  4ZUX A;  2V1A A;  3JYI A;  2G7U A;  1IYP A;  5AV5 B;  3F6T A;  4J8V B;  4LD9 A;  5A90 A;  4DE3 A;  4UA9 A;  2ZM8 A;  4R3A A;  2H0T A;  3MGR B;  3WAA C;  2UWX A;  2QWS A;  5LBR A;  3FV7 A;  4ZBJ B;  3AZN D;  2G5I C;  4G3W A;  3AZL B;  4I3A A;  2Y59 A;  4UUZ B;  3QP1 A;  4QLC B;  2V0U A;  2ZMF A;  4LV0 A;  1T19 A;  5AVC B;  1KE4 A;  5TFQ A;  1KX3 B;  5GSU B;  2VEA A;  4OJO A;  4XZQ D;  1P3M B;  5FQQ A;  4BQM A;  5HAI A;  4Z5T D;  4P85 A;  1ERM A;  4X23 D;  1EQZ A;  4N9L A;  2ZD8 A;  2G5H C;  3L26 A;  4WYY A;  3KXB B;  3IT9 A;  3KSY A;  5E5A B;  4DRT A;  5B40 C;  4KG2 A;  1TZY C;  2JKT M;  5DNM D;  3C4P A;  3FC7 A;  3AGF A;  5B0Z B;  3AFA B;  3X1V C;  3PBS A;  3MGP B;  3Q07 A;  1FIL A;  5AV8 C;  4KG5 A;  5BNX B;  1RP5 A;  4B88 A;  1B67 A;  1UR9 A;  2GDN A;  3NDG A;  3AZI C;  5AV9 A;  1P3O D;  3F1O A;  2XRO A;  5HDS A;  5B24 A;  1YU3 A;  5DF7 A;  4R8P D;  4LCL A;  3REK A;  4IED A;  3X1U C;  1Y28 A;  1HQ3 A;  1KS0 A;  3LO7 A;  2JC7 A;  3ZDJ A;  3GSG A;  1IYQ A;  4NXB A;  2CC1 A;  4XT2 B;  3WWX A;  4HGA B;  4N1H A;  1K57 A;  4FSF A;  4JGP A;  3AZG C;  4KZ6 A;  3LIC A;  3ZG8 B;  3W97 C;  4IVK A;  2W3E A;  2WAF A;  2R78 A;  4HMC A;  2QPN A;  1P3L A;  2XFS A;  3P98 A;  2EXB A;  4CAY A;  3R45 A;  1H8P A;  3TSG A;  3T1X A;  3VP1 A;  3A0R A;  1M19 B;  1ALQ A;  2P9V A;  3M2J A;  5B2J B;  5A91 A;  5L09 A;  3Q7Z A;  4L9E A;  3W4O A;  2WUQ A;  2XA7 M;  4KZ4 A;  4BBV A;  4GNU A;  4OQG A;  4YS3 C;  1M1A B;  5CP6 C;  5E43 A;  5HAP A;  1NYY A;  3B0D B;  1WYC A;  5DJU A;  5BNV A;  3UT9 C;  3REL B;  1YLP A;  4Y3I A;  5FUG B;  1BLP A;  1BUE A;  2W3D A;  3HLE A;  3NUL A;  4EES A;  3REH A;  4H6J B;  2VX8 A;  2OWJ A;  2ZC4 B;  2PYR A;  1XA1 A;  1C3B A;  4YM6 B;  1YLT A;  5DVA A;  4GJ4 A;  3DW0 A;  1J3W A;  4HQA A;  1H8Z A;  5AVB A;  4Z2H A;  3I7J A;  3X1S A;  3SS3 A;  1LHY A;  1K55 A;  1ONH A;  5F69 A;  3DTE A;  4PKY A;  3WX7 A;  2V1B A;  1KU5 A;  3LJA A;  1NY0 A;  2H5S A;  1W8Y A;  3BQ8 A;  5HX9 A;  4E3I A;  3M6H A;  4H9P A;  1RGY A;  3WRT A;  3TRC A;  3KSH A;  3UE0 A;  2UV0 E;  3MGS D;  3C1B A;  1TS6 A;  3B42 A;  3W2Z A;  2HDU A;  5TGF A;  3U4L P;  3SW1 A;  4ID4 A;  1KE3 A;  5KDM B;  3W98 A;  2K31 A;  4JXS A;  3EPL A;  1AOI B;  2A24 A;  2W1R A;  4MB5 A;  2OSU A;  3AV1 C;  4MNR A;  4QU3 A;  3LI8 A;  5FAT A;  3B6G B;  4RVA A;  3UME A;  5DFX A;  1DJA A;  4JGR A;  3HVF A;  5AJG A;  5EVI D;  4IJE A;  1D7E A;  1P3G B;  4HNB A;  4KEN B;  2IO5 C;  4E44 A;  1H3O B;  3CAX A;  3LGO A;  3REI B;  5AQA A;  5B40 D;  4WU9 A;  1E8B A;  1J9M A;  3Q7V A;  4MEZ A;  2J3T C;  2PR6 A;  3G6O A;  3A1K A;  5HL1 A;  4EUV A;  3IQA A;  1KDS A;  4R4R A;  3TW8 A;  3KWQ A;  1XJ3 A;  2HIO A;  4I38 A;  4QY5 A;  3GVB A;  3UB5 P;  5IU1 A;  4EEP A;  2BYK A;  2F2A C;  1P3B A;  3KUY D;  4P6Z M;  4MBH A;  2BYM A;  3BYD A;  4PAU A;  5GT3 B;  4C3Q A;  2P7J A;  4JPM A;  4LEN A;  5AV5 C;  1IYS A;  2HGV A;  4Y0O A;  1PNE A;  2Y2I A;  4KQR A;  3IBJ A;  3AZM A;  2PRF A;  3O62 B;  4WEL A;  3EPK A;  2WYX A;  4EU0 A;  3G31 A;  3AZG D;  3H0M C;  3X1T A;  4ETZ A;  5DNN A;  4NFT A;  4ZBJ C;  3W97 D;  3CPT B;  4BLM A;  4OLD A;  3GV9 A;  3ZFZ A;  2B5R A;  2F8N H;  4IUK A;  1KX3 C;  1E6Z A;  1ES2 A;  5U47 A;  5BT1 D;  3LEL A;  1P3M C;  3W96 A;  5GLC A;  5F99 D;  5AY8 D;  3NY4 A;  1H8M A;  2ARO D;  5CP6 D;  2HDR A;  4S2M A;  2OV5 A;  1JTD A;  1U35 D;  2XH9 A;  2RVQ C;  4B4X A;  4Y0U A;  3BLS A;  2XK1 A;  2PAV P;  5B0Z C;  4MDZ A;  3E2K A;  3MGP C;  2VQR A;  5FAO A;  4O7D A;  4IBK A;  1W8Q A;  3JVU A;  5EVE A;  5DKK A;  3CUE A;  3GEC A;  4IBG A;  2HV1 A;  3IX3 A;  3AZE C;  2PYO D;  1BLS A;  1MC0 A;  3AV2 D;  3MSH A;  5BS7 A;  2Y2N A;  1XXM A;  4IUH A;  4Z9Q A;  3S7N A;  1P3F D;  2FFY A;  4XUJ B;  2KX6 A;  2PYP A;  4U0X A;  4E3J A;  1F2K A;  4PM7 A;  1P3O B;  4OKP A;  4OOY A;  5L07 A;  3VFH A;  1YKD A;  5CED A;  3E4P A;  5BPV A;  3REJ A;  2PHY A;  5B1M C;  3E4O A;  3KSF A;  2ZY2 A;  3QNB A;  5AQB A;  1H5X A;  3B47 A;  4WZ5 C;  2WAD A;  3BFG A;  4G3K A;  4ZRR A;  3T1R A;  3WKJ A;  1YU4 A;  3AYW A;  2NQB C;  2EX8 A;  3PBR A;  4OON A;  2P04 A;  5B32 G;  4J8U A;  1IEL A;  5B2J C;  1NWZ A;  1VQQ A;  1K0K A;  4RYE A;  2HF6 A;  2A3U A;  4KUD C;  4LCM A;  4ZDX A;  5G4Z A;  2EXA A;  3NOP C;  3UO9 A;  2GX5 A;  1LSW A;  2PDR A;  1CQA A;  1VET A;  5HL6 A;  3AZF D;  1OT6 A;  4EV4 A;  1BZA A;  3AZJ D;  1JFI A;  3AZH C;  2HPB A;  1DJB A;  4KZ8 A;  4RA7 A;  4S2O A;  3VOL A;  3W4P A;  3FPW A;  3PAG A;  5TBM A;  2BTF P;  1TZY A;  1P3P B;  4EET B;  3L9K A;  2F8N A;  4GD8 A;  3KS4 A;  2O9A A;  4YM6 C;  1U60 A;  1Q2Q A;  5J4E A;  3UDI A;  1KX4 D;  4AWL B;  3M2K A;  5B2I C;  3KSI A;  4GHI A;  1BH8 A;  3AZI A;  2DMW A;  4WNN B;  1KX5 D;  2R9X A;  4J8W C;  4QNL A;  2LY8 A;  4KHA B;  3NOU C;  2WZZ A;  3X1U A;  2FJ7 A;  1BYW A;  2EWW A;  4S2L A;  5CPI D;  1IKI A;  3IS2 B;  1E6N A;  4I3J A;  5MC7 A;  1L2S A;  1P3K D;  2QYB A;  1STZ A;  4OPZ A;  3T4T A;  1LL5 A;  5F83 A;  2ZM0 A;  5E2F A;  2YFV A;  1JVJ A;  4QY6 A;  3T4Q A;  4P87 A;  5B31 C;  5GXQ D;  2INW A;  5HAR A;  3MQQ A;  3WAA B;  2WZX A;  3AN2 C;  1GHP A;  1KGG A;  3W99 D;  3FPV A;  4G92 B;  1Z09 A;  2DNS A;  1S4R A;  5J3W A;  2K7S A;  1DP8 A;  4KG6 A;  3B6G C;  3TU4 D;  3LFV A;  1ZTU A;  2RTS A;  4F3L B;  4WU8 D;  3GDI A;  3QP6 A;  3M7P A;  4MN6 A;  1LL9 A;  3WA9 A;  2FZ0 A;  2LB9 A;  4XXR A;  1P3G C;  4YS3 A;  5AV6 D;  2ZQA A;  4EER A;  4IBX A;  3REI C;  3FYZ A;  5BO0 B;  4MN7 A;  1O7E A;  1XJ2 A;  3T1S A;  2H0Y A;  4M3K A;  4GLQ A;  1FIK A;  1ACF A;  5D3O A;  4C75 A;  4RX2 A;  5B40 B;  5CGS A;  3C4O A;  4ZJ1 A;  3AL0 C;  3MMH A;  1Q9C A;  1W5D A;  3X1V B;  5B33 C;  3MVD D;  3B6F A;  4HP9 A;  5EM0 A;  2VV6 A;  5AV8 B;  1G5U A;  3UTB C;  3P01 A;  2ZY4 A;  5G49 A;  5DKL A;  1W1P A;  4HJ4 A;  5FEG A;  3EG5 B;  5JRG A;  4CPK A;  1SKF A;  4J8X A;  2ZY3 A;  3G35 A;  5B1M D;  4IVI A;  4S2N C;  1GA9 A;  3LY4 A;  3UTA D;  3LIF A;  3RFB A;  3EGX C;  4GKU A;  3M6B A;  1F66 A;  1E88 A;  3L27 A;  4ZUX D;  3AZG B;  4DDY A;  1ID3 A;  2HP9 A;  3AZN C;  3W97 B;  3NQJ A;  2V1Z A;  5F5Y A;  1T3U A;  4KUD D;  4BMW A;  5DF9 A;  3UY6 A;  4E04 A;  4NE3 A;  5DTS A;  4XZQ C;  3MZE A;  3H9W A;  2OAP 1;  3FG8 A;  4DE2 A;  3AZH D;  4GOG A;  1W7F A;  1TEM A;  2L0W A;  4HIA A;  4KUO A;  2M7U A;  4Z5T C;  5AY8 B;  4LRZ E;  4X23 C;  5CP6 B;  4OOM A;  1ZLA A;  2Z2L B;  3WS1 A;  1GHI A;  5CTM A;  3LZ0 A;  4Z2K A;  3VP3 A;  4HBU A;  3MNN A;  4I39 A;  1PRQ A;  4N92 A;  5DNM C;  4DQY B;  3V39 A;  1BFM A;  5GT0 A;  3AZK A;  1OTD A;  5B2I D;  4MN5 A;  1D06 A;  1PFL A;  1EQZ D;  1PZP A;  1TAF A;  4MB3 A;  2ZC5 B;  3Q1F A;  4J8W D;  2Y79 A;  4PPR A;  3IH8 A;  1T1A A;  3NJA A;  3ZNY A;  4R8P C;  3IH9 A;  4EQ1 A;  5CEC A;  4J8V A;  2J7V A;  5CPK C;  2QHK A;  3MGR A;  1XGJ A;  3H82 B;  4PM6 A;  3V50 A;  1S4S A;  5IT5 A;  1MXO A;  4IJF A;  3AN2 D;  3OPR A;  3AZL A;  3D72 A;  4UUZ A;  1T18 A;  3HL9 A;  1HQ3 D;  4X1L A;  4QLC A;  1P97 A;  3QP2 A;  2VV8 A;  5AVC A;  3GRJ A;  1KX3 A;  5GSU A;  3EOI A;  3N8R A;  2J9P A;  1P3M A;  4H9R B;  5KSC A;  3RXW A;  3AV1 B;  4LRX C;  1TDG A;  3SOI A;  1P34 C;  1FQG A;  3UDX A;  3LIB A;  3UMD A;  4WLA A;  4JF4 A;  3KXB A;  2PU4 A;  5E5A A;  4Y13 A;  4PKY G;  1NJ4 A;  3B0C T;  3BEC A;  5L2F A;  3AZJ B;  2IO5 B;  3AFA A;  3NQU B;  3MGP A;  3BFF A;  4HI4 A;  5BNX A;  3LYX A;  5B33 D;  3IP4 C;  1H0G A;  3MZD A;  1SCW A;  2I72 A;  3V9R B;  4BBT A;  2FFF B;  3WTP D;  3UTB D;  1KX4 B;  3REH D;  1GOI A;  1KX5 B;  1L0F A;  4H9S A;  2XD1 A;  2J3W A;  3CIT A;  3LEQ A;  4XT2 A;  4OPY A;  4JXW A;  4DN0 A;  1YLZ A;  5CPI B;  1BSG A;  3BFD A;  1M18 A;  4EO5 B;  4G92 C;  3PAE A;  4EBL A;  4L9F A;  2YKF A;  3MGS C;  1GXD A;  1M19 A;  5KMW A;  1WA9 A;  5CEB A;  5B2J A;  4JXG A;  3LJA D;  3HJI A;  3ITB A;  3W99 B;  2G2W A;  2C6W B;  2EX2 A;  1M1A A;  3C1B D;  3TU4 B;  3C2W A;  3EGD C;  1X0O A;  3OLO A;  4WU8 B;  5B1L D;  1NLZ A;  1N9O A;  2Y8H A;  3FKE A;  4OJ5 A;  3W98 D;  5EVI C;  4WBG A;  5EOO A;  3SH7 A;  4H9O B;  3REL A;  1BUL A;  5FUG A;  3L25 A;  2QMI A;  4OPQ A;  4H6J A;  3T4S A;  1HVB A;  4S2P A;  5CXW A;  3VP0 A;  4YM6 A;  5FI2 A;  1KVM A;  5F68 A;  4NZ4 A;  3BY9 A;  4IBD A;  2JKR M;  2WGV A;  4MLL A;  3S4X A;  4JKT A;  3AZE B;  5CPJ D;  3NHQ A;  3V3S A;  3KUY C;  5CHL B;  3UPP A;  5CPK D;  1SKO B;  3OZH A;  1S32 C;  2L5A A;  2XDM A;  3BWL A;  3KWQ D;  4N9K A;  3IHA A;  2HIO D;  4Z2M H;  5DTK A;  3VOZ A;  1P3B D;  4G3V A;  5M1A A;  2HJE A;  4R23 A;  2JKT I;  1PWC A;  3G2Z A;  5B1M B;  3UB8 A;  2CV5 C;  3HON A;  1K25 A;  4GD6 A;  4GH9 A;  4ARZ B;  5CHU A;  1S66 L;  3UTA B;  1AOI A;  2JKR I;  2NQB B;  5FL3 A;  3UN7 A;  2RIQ A;  1PI5 A;  3EQU A;  4ZTK A;  3AZM D;  2WKE A;  1OTA A;  3EPH A;  3WS4 A;  4OQ0 A;  5BT1 C;  3X1T D;  2O9B A;  4EBP A;  5F99 C;  1P34 D;  1F98 A;  4KUD B;  1S1Z A;  5AY8 C;  2ZL1 B;  2ARO C;  5FAQ A;  1H3O A;  2ZC7 A;  1F5M A;  3HUN A;  1U35 C;  3ZG0 A;  1UR8 A;  5AVF A;  4OUI A;  4OVD A;  3AZH B;  3SS4 A;  3V5M A;  1CEG A;  5C5K A;  3W96 D;  3CHW P;  3KSG A;  4JJN C;  2NZD D;  3E2L A;  1UGU A;  2J9O A;  2H28 A;  3A0S A;  3G30 A;  3K3D A;  4IBJ A;  2PYO C;  4NE6 A;  2EFU A;  4CJN A;  1HZO A;  3AV2 C;  5GT3 A;  5KSH A;  5GL9 A;  5B2I B;  5L10 A;  1H3Q A;  1QMF A;  4MMN A;  3H7W B;  1EQZ B;  1P3F C;  3ZYT A;  4J8W B;  4GHA A;  4LV2 A;  4NYY A;  1LT0 A;  1PIO A;  3VSL A;  3O62 A;  4KZ9 A;  5FAP A;  4QHC A;  5HW3 A;  5J8X A;  4ESP A;  4KZ5 A;  3ZQ5 A;  3TG9 A;  3VH5 A;  3CPT A;  4S2N A;  4Z2J A;  2DF4 C; 
#chains in the Genus database with same CATH homology
 2X02 A;  1NXY A;  3IWI A;  5B31 B;  4NY2 A;  3AN2 B;  4G91 C;  2F8N G;  3W4Q A;  4L0L A;  4QB8 A;  5A93 A;  2YFW B;  1PWD A;  4Z66 C;  4EUZ A;  3IXG A;  3WKJ D;  4DDS A;  3AYW D;  1MPL A;  1GA0 A;  3DWK A;  3AZF C;  4J8U D;  3AZJ C;  1NYM A;  5TR7 A;  2XLN A;  4BL3 A;  4LG2 A;  1K6S A;  3CZD A;  3IF6 C;  5EOE A;  5EE8 A;  1TVF A;  1KX4 C;  3G4P A;  1W79 A;  4XUJ A;  5CHM A;  5B33 B;  3Q81 A;  4DE0 A;  1YQS A;  4KGC C;  2EFX A;  1KX5 C;  1P3O A;  5B32 C;  1XGI A;  2F8N D;  1S32 D;  3WTP B;  3UTB B;  3HLB A;  1PI4 A;  5CPI C;  4KQQ A;  3REH B;  4EO5 C;  1P3K C;  2CV5 D;  4U3T A;  3GTC A;  5B0Y C;  4WEK A;  5GXQ C;  3W8K A;  3A3F A;  3QNC A;  2FJ7 D;  3LZ1 D;  2RCX A;  3W99 C;  4DRB A;  1LI9 A;  4HBT A;  4EQI A;  2JCH A;  3HLC A;  3AZN B;  5FQ9 A;  3TU4 C;  4WU8 C;  4GZB A;  4OLG A;  5FI6 A;  1K54 C;  1N9B A;  5AV6 C;  3VP4 A;  3VOY A;  4XZQ B;  1P3P A;  5B1L B;  4Z5T B;  4X23 B;  4JJN D;  1FSW A;  4FH4 A;  4UHU A;  1YLJ A;  3WA9 D;  1P3I C;  2ZQC A;  5CGW A;  4R3J A;  3G2Y A;  5DNM B;  4WNN A;  3MVD C;  2EX9 A;  1DY6 A;  1ES3 A;  1QME A;  3IHB A;  2Y55 A;  4KHA A;  4NK3 A;  1NZO A;  3HUM A;  5CPJ B;  4DXB A;  5EPH A;  3C1C C;  1KGE A;  2Y2M A;  1JWZ A;  4UA7 A;  3V3R A;  3HUO A;  4R8P B;  3B6F D;  5CPK B;  4FD8 A;  4R3B A;  3WAA A;  4PM8 A;  3VH6 T;  2HUE C;  4KZA A;  3UTA C;  1B6W A;  2OLU A;  5JRG D;  4ZUX C;  4K91 A;  4J8X D;  1YUE A;  3OCN A;  4LD9 C;  4PM5 A;  2ZQ9 A;  3WS0 A;  3UE1 A;  4Z66 D;  2J8P A;  3OC2 A;  4KZ7 A;  4M6B A;  3WTP E;  5BO0 A;  4DXC A;  1ID3 D;  5M18 A;  1P34 B;  3MXR A;  5JYP A;  3H0R C;  1ZG4 A;  1NRF A;  3BRM A;  2JSS A;  5B40 A;  2H10 A;  1SDN A;  3X1V A;  3Q82 A;  3ZG5 A;  4R0Q A;  5AV8 A;  4U0T A;  2NZD B;  1HTZ A;  1EQZ C;  4KGC D;  1ZLA D;  4MBK A;  4WZ4 A;  5B32 D;  5IHV A;  3A6N D;  2Y2L A;  5GT0 D;  3AZK D;  4KZB A;  1KGF A;  4NZ5 A;  3MKE A;  4K0X A;  5B0Y D;  4OJL A;  5AV9 C;  3AZG A;  2RL3 A;  3W97 A;  1FOF A;  3NI9 A;  3MGS B;  1HQ3 C;  2Q9M A;  3MGR D;  3L2A A;  2ZM5 A;  5FQM A;  1K57 C;  1M40 A;  3A3J A;  2QZ6 A;  3O86 A;  5AY8 A;  4GN2 A;  5CP6 A;  4QLC D;  3KFU G;  1XA7 A;  5FQK A;  3MZF A;  3AYW B;  5AVC D;  1JTG A;  4BJP A;  5GSU D;  5EVI B;  3UT9 A;  4J8U B;  4X68 A;  5FAS A;  1LLB A;  2ZQ7 A;  3FKW A;  2W8S A;  1P3I D;  4UA6 A;  4WJ3 C;  4KZ3 A;  2V20 A;  4NZ3 A;  5F82 A;  5JYO A;  3KXB D;  1P3A D;  5E5A D;  5CGX A;  3WTP C;  3AFA D;  4H9N B;  4JBF A;  3C1C D;  3KUY B;  1VM1 A;  3REH C;  4OP5 A;  2Y2O A;  3MGQ D;  2Y2Q A;  1S32 B;  4OJP A;  2Y4A A;  2XR0 A;  3X1S C;  3G32 A;  3AGD A;  1K55 C;  2Y2K A;  2CV5 B;  5FQI A;  1G6A A;  2X71 A;  2ZC6 B;  4LD9 D;  4H9R A;  4B4Z A;  3P09 A;  3LZ1 B;  3LJA C;  5FQJ A;  3AV1 A;  1M18 D;  1YMS A;  5FI7 A;  4OJ6 A;  3C1B C;  4XUZ A;  4P6B A;  3HLW A;  5F99 B;  1M19 D;  2A49 A;  5B1L C;  3DWZ A;  1Z2C B;  2ARO B;  3W98 C;  3NQU A;  4E3M A;  5AQ7 A;  3UPN A;  1U35 B;  2Y91 A;  4QJG A;  1M1A D;  1K4E A;  4JJN B;  3V9R A;  3FWL A;  1KX4 A;  1BH9 A;  2PYO B;  5CPJ C;  2WGW B;  3AV2 B;  4YIN A;  5G18 A;  4WU9 C;  1KX5 A;  3WS5 A;  4MBF A;  3FKV A;  5AV5 A;  1L0E A;  1E3U A;  1P3F B;  3NDE A;  5CPI A;  2HDS A;  3KWQ C;  3SH8 A;  1IYO A;  2HIO C;  4NE5 A;  3L28 A;  3GQZ A;  5AV9 D;  1P3B C;  1E4D A;  5B24 D;  4IBI A;  3VH5 W;  3REK D;  4OH0 A;  1BTL A;  3BFE A;  3MXS A;  3W99 A;  3UDF A;  3A3E A;  5HFO A;  3IXD A;  3N4I A;  2HDQ A;  1WWI A;  1RGZ A;  3AZM C;  4G91 B;  4EBN A;  3TU4 A;  4E3O A;  1MY8 A;  3H0L C;  1FR1 A;  3X1T C;  2XEP A;  3ZG9 B;  4H9O A;  3HLF A;  1P3L D;  4Z66 B;  1AOI D;  3AZF B;  1F1E A;  4FH2 A;  5B0Z A;  1ID3 B;  4X53 A;  3W96 C;  1DJC A;  2NZD C;  4WZS B;  4EWF A;  3AZE A;  4DRA A;  4JLF A;  3C7V A;  1N4O A;  4Y7P A;  3IF6 B;  4BD1 A;  1NZU A;  2IOU A;  4KGC B;  4IBC A;  1ZLA B;  1KE0 A;  5B32 B;  4X56 A;  3B0B A;  4H8R A;  5JA4 B;  2Y2J A;  3A6N B;  1WWS A;  5B1M A;  4Z2M G;  5BS7 C;  3AZK B;  5AVB D;  3X1S D;  4WZ5 A;  1P3K B;  2ZMA A;  4NET A;  3UTA A;  3O87 A;  2NQB A;  5B0Y B;  3ISG A;  5GXQ B;  3O62 D;  1MWS A;  3DTM A;  4Q8I A;  4CSR B;  4BD0 A;  4BL2 A;  3REJ C;  1MKI A;  1Q2P A;  4KUD A;  1XKZ A;  4IBE A;  1FCO A;  4NYU A;  3WKJ C;  1L0G A;  3AYW C;  4E3K A;  3G34 A;  3AZH A;  5CER A;  4J8U C;  5AV6 B;  3HBR A;  2XFT A;  3UE3 A;  2VGK A;  4WEJ A;  5HAQ A;  1JWP A;  4IBF A;  3P5J B;  5B2I A;  2BG1 A;  1P3I B;  4GB7 A;  1N1J B;  4S2J A;  1IEM A;  4WU9 D;  3MVD B;  4J8W A;  4H9Q B;  1P3A B;  1IKG A;  1GHM A;  2VGJ A;  4S2I A;  4DE1 A;  3C1C B;  4XUJ D;  3MGQ B;  1FCN A;  5C3I B;  4OQH A;  5B31 A;  5KDM A;  3AN2 A;  3C7U A;  2HUE B;  2FJ7 C;  1OME A;  3LZ1 C;  4ZUX B;  1H8Y A;  3B6G A;  2YFW A;  4OP8 A;  5CTN A;  4WM9 A;  3QHY A;  4LD9 B;  5DNN D;  4F94 A;  2X01 A;  1P3G A;  1M18 B;  2BLS A;  3REI A;  3OPP A;  3GR2 A;  4OQI A;  3N8L A;  3HRE A;  4E45 A;  4R1G A;  3LEL D;  3CG5 A;  5FSR A;  3RXX A;  5EUA A;  1K56 A;  4WMC A;  3WA9 C;  1XPB A;  4ZAM A;  3D4F A;  5B33 A;  2WKH A;  1PW1 A;  4OOL A;  3CJM A;  2ZC3 B;  1P3P D;  3B3X A;  3WTP A;  3UTB A;  2JBF A;  3UPO A;  3N3F A;  4N1X A;  4E6W A;  5M19 A;  3ZCZ A;  1WYB A;  5FA7 A;  4LV1 A;  2Q9N A;  3TOI A;  3B6F C;  1CK3 A;  2ZM2 A;  2Y2P A;  4GHL A;  3S1Y A;  5AV9 B;  5B24 B;  1MWR A;  4X69 A;  5JRG C;  3AZN A;  3REJ D;  3REK B;  4J8X C;  2J8Y A;  1ES4 A;  1HQ3 B;  2JE5 A;  5I94 A;  3WAA D;  4NZ1 A;  4PM9 A;  3GMW A;  1ESU A;  3MBZ A;  1PW8 A;  4XZQ A;  3IXB A;  1F66 C;  4QD4 A;  5B1L A;  4Z5T A;  1ID3 C;  4X23 A;  1MWT A;  1P3L B;  1SDE A;  1MBL A;  2ZJ9 A;  4CAY B;  3R45 B;  2P9V B;  5DNM A;  4E3L A;  5CPJ A;  1ZLA C;  1YM1 A;  2HP6 A;  1TZY D;  3LZ0 C;  4R8P A;  2HP5 A;  3MNN C;  5BNV B;  3X1V D;  3A6N C;  5CPK A;  3PBQ A;  5F1F A;  2IWB A;  5AV8 D;  5GT0 C;  3AZK C;  4PMA A;  3LCE A;  1FCM A;  5CHJ A;  5A92 A;  1Z6F A;  3AZI D;  4UPK A;  4ZJ2 A;  3ITA A;  1KDW A;  4HEF A;  3X1U D;  5AVB B;  3ZHH A;  3ZG7 B;  3X1S B;  4J8V C;  3NIA A;  1YU1 A;  1A7W A;  1CI8 A;  3MGR C;  1ONG A;  2EX6 A;  1S0W A;  1ZG6 A;  3LJA B;  4C6Y A;  1PZR A;  3L29 A;  1P34 A;  3AZL C;  4H9P B;  3MKF A;  3C1B B;  4QLC C;  5DF8 A;  5EVL A;  5AVC C;  3A3D A;  3NC8 A;  5GSU C;  3W98 B;  1ZC2 A;  3VH6 W;  3N7W A;  2XQZ A;  2F8N K;  1YLY A;  2DCF A;  2NZD A;  4YS3 D;  1SHV A;  4IBR A;  3ZVW A;  3PTE A;  3KXB C;  3SH9 A;  1P3A C;  3OPL A;  5E5A C;  1I5Q A;  3UT9 D;  3AFA C;  4WU9 B;  3Q7V B;  1HTA A;  3MGQ C;  5C3I C;  3KWQ B;  1JWV A;  3IWQ A;  2HIO B;  1PYY A;  3ZGA B;  1K4F A;  2BYK B;  5F1G A;  1P3B B;  3MGS A;  2BYM B;  1CI9 A;  3SS5 A;  4H9S C;  5E2E A;  3KS8 A;  2Y2H A;  4XUX A;  3A3I A;  4HGA C;  3OCL A;  3EPJ A;  1L0D A;  4LV3 A;  1HD8 A;  1MWU A;  1M18 C;  3AZM B;  3WS2 A;  4P0M A;  1F66 D;  4FCF A;  2WAE A;  3X1T B;  5DNN B;  2CWE A;  5EVI A;  2IWC A;  1M19 C;  2P74 A;  4R4S A;  1TDL A;  3AV1 D;  1M1A C;  1LI0 A;  3LEL B;  3W96 B;  3B0D C;  2R9W A;  1ESI A;  1YU2 A;  3BEB A;  4H9N A;  3REL C;  3KUY A;  3HSH A;  3NCK A;  3LZ0 D;  2WGI A;  2Z2M B;  4K0W A;  2XGN A;  1YU0 A;  3MNN D;  4UAA A;  1S32 A;  4A5R A;  4ZJ3 A;  2ZQD A;  2CV5 A;  5FDH A;  5B24 C;  5AV5 D;  4J8V D;  3REK C;  2Y2G A;  1E3U D;  1RCJ A;  3BLM A;  5KZH A;  3LZ1 A;  2G2U A;  4GDB A;  1AXB A;  3IWO A;  3WRZ A;  1K6R A;  5GHY A;  1ZKJ A;  3REJ B;  5F99 A;  3AZL D;  2ARO A;  1P3L C;  1AOI C;  3WKJ B;  1U35 A;  4ZBE A;  1KX3 D;  3HLD A;  2PU2 A;  1M6K A;  1P3M D;  4JJN A;  5GLB A;  1KVL A;  5DTT A;  4X55 A;  1I2S A;  1BT5 A;  2WK0 A;  3PBO A;  3UNW A;  2PYO A;  2DRW A;  1S6R A;  5GHX A;  2WGW A;  3AV2 A;  2RVQ D;  1EI5 A;  1R4V A;  3A1I A;  3NBL A;  1ULY A;  5B0Z D;  3VFF A;  3MGP D;  1JFI B;  1P3F A;  3LY3 A;  3IXH A;  3AZE D;  2PBY A;  1TZY B;  1FR6 A;  1I2W A;  2F8N B;  5E2G A;  4BEN A;  5GT3 C;  4YFM A;  2XD5 A;  2OLV A;  1ES5 A;  5AVB C;  1BLH A;  3AGE A;  3VP2 A;  1BH8 B;  3AZI B;  1XX2 A;  4E6X A;  2C5W B;  3O62 C;  5GLD A;  3VSK A;  3X1U B;  2FJ7 B;  3CMZ A;  3OPH A;  5E2H A;  4Z66 A;  3IF5 A;  3MFD A;  2NQB D;  4KQO A;  3RJU A;  2YFV B;  3AZF A;  2DQN C;  3VH6 A;  3AZJ A;  5B2J D;  5AQ9 A;  1ERQ A;  4RX3 A;  1WE4 A;  5CRF A;  4IBB A;  3C5A A;  2E8I A;  2WKI A;  5B31 G;  3IF6 A;  4S2K A;  3REL D;  3WA9 B;  4YS3 B;  4DKI A;  4D2O A;  1ERO A;  1XP4 A;  4KGC A;  2ZLY A;  5B32 A;  1E25 A;  5JA4 A;  2V2F F;  3UT9 B;  3A6N A;  3LEZ A;  2ZQ8 A;  4YM6 D;  5BOH A;  2XF3 A;  1FSY A;  1P3K A;  3B0C W;  4XUJ C;  1BLC A;  1PWG A;  1PZO A;  1YLW A;  3B6F B;  4Y0T A;  5B0Y A;  5GXQ A;  1P3O C;  4CSR A;  3N8S A;  1O07 A;  5G49 B;  4DF6 A;  5JRG B;  1G68 A;  4OPR A;  4WV4 B;  4GDN A;  4J8X B;  3BM6 A;  5B31 D;  4WU8 A;  1YT4 A;  5DNN C;  3HLG A;  3S22 A;  1K54 A;  5AV6 A;  1F66 B;  3N6I A;  2ZY5 A;  3FDD A;  3B6G D;  3ZNT A;  3NQJ B;  3LEL C;  1Y54 A;  3BFC A;  1P3G D;  1P3I A;  1N1J A;  3REI D;  3FZC A;  5GLA A;  5EEC A;  3MVD A;  4X6T A;  4H9Q A;  1EWZ A;  1GCE A;  1P3A A;  4JF5 A;  4JF6 A;  3PBT A;  3O88 A;  1P3P C;  5GHZ A;  3EQV A;  3C1C A;  1K56 D;  3VH5 T;  3LZ0 B;  3PBN A;  4WMC D;  4AWL C;  2IWD A;  3O3V A;  3MGQ A;  3MNN B;  5GT3 D;  5GT0 B;  4E3N A;  1K38 A;  1CEF A;  1TAF B;  4JXV A;  1W2E A;  3VMA A;  1BH9 B;  1YMX A;  4HES A;  3ZVT A;  4ZUX A;  3JYI A;  1IYP A;  5AV5 B;  3F6T A;  4J8V B;  4LD9 A;  5A90 A;  4DE3 A;  4UA9 A;  2ZM8 A;  2H0T A;  3MGR B;  3WAA C;  2UWX A;  3FV7 A;  4ZBJ B;  3AZN D;  2G5I C;  3AZL B;  2Y59 A;  4UUZ B;  4QLC B;  4LV0 A;  5AVC B;  1KE4 A;  5TFQ A;  1KX3 B;  5GSU B;  4OJO A;  4XZQ D;  1P3M B;  5FQQ A;  4BQM A;  5HAI A;  4Z5T D;  4P85 A;  1ERM A;  4X23 D;  1EQZ A;  4N9L A;  2ZD8 A;  2G5H C;  3L26 A;  4WYY A;  3KXB B;  3IT9 A;  3KSY A;  5E5A B;  4DRT A;  5B40 C;  4KG2 A;  1TZY C;  5DNM D;  3C4P A;  3AGF A;  5B0Z B;  3AFA B;  3X1V C;  3PBS A;  3MGP B;  3Q07 A;  5AV8 C;  4KG5 A;  5BNX B;  1RP5 A;  4B88 A;  1B67 A;  2GDN A;  3NDG A;  3AZI C;  5AV9 A;  1P3O D;  5B24 A;  1YU3 A;  5DF7 A;  4R8P D;  4LCL A;  3REK A;  4IED A;  3X1U C;  1HQ3 A;  3LO7 A;  2JC7 A;  3ZDJ A;  3GSG A;  1IYQ A;  2CC1 A;  3WWX A;  4HGA B;  4N1H A;  1K57 A;  4FSF A;  3AZG C;  4KZ6 A;  3ZG8 B;  3W97 C;  4IVK A;  2WAF A;  2QPN A;  1P3L A;  2XFS A;  3P98 A;  2EXB A;  4CAY A;  3R45 A;  3TSG A;  3VP1 A;  1M19 B;  1ALQ A;  2P9V A;  3M2J A;  5B2J B;  5A91 A;  3Q7Z A;  3W4O A;  2WUQ A;  4KZ4 A;  4GNU A;  4OQG A;  4YS3 C;  1M1A B;  5CP6 C;  5E43 A;  5HAP A;  1NYY A;  3B0D B;  1WYC A;  5BNV A;  3UT9 C;  3REL B;  1YLP A;  5FUG B;  1BLP A;  1BUE A;  3HLE A;  3REH A;  2ZC4 B;  1XA1 A;  1C3B A;  4YM6 B;  1YLT A;  5DVA A;  3DW0 A;  1H8Z A;  5AVB A;  3I7J A;  3X1S A;  3SS3 A;  1LHY A;  1K55 A;  1ONH A;  3WX7 A;  1KU5 A;  3LJA A;  1NY0 A;  2H5S A;  1W8Y A;  5HX9 A;  4E3I A;  3M6H A;  4H9P A;  1RGY A;  3WRT A;  3UE0 A;  3MGS D;  3C1B A;  2HDU A;  5TGF A;  4ID4 A;  1KE3 A;  5KDM B;  3W98 A;  4JXS A;  3EPL A;  1AOI B;  2OSU A;  3AV1 C;  4MNR A;  4QU3 A;  5FAT A;  3B6G B;  4RVA A;  1DJA A;  3HVF A;  5EVI D;  4IJE A;  1P3G B;  4KEN B;  2IO5 C;  4E44 A;  1H3O B;  3REI B;  5AQA A;  5B40 D;  4WU9 A;  1J9M A;  3Q7V A;  4MEZ A;  3A1K A;  5HL1 A;  3IQA A;  1KDS A;  4R4R A;  3KWQ A;  2HIO A;  4QY5 A;  3GVB A;  2BYK A;  2F2A C;  1P3B A;  3KUY D;  4MBH A;  2BYM A;  3BYD A;  5GT3 B;  4C3Q A;  4JPM A;  4LEN A;  5AV5 C;  1IYS A;  4Y0O A;  2Y2I A;  4KQR A;  3AZM A;  4WEL A;  3O62 B;  3EPK A;  2WYX A;  3G31 A;  3AZG D;  3H0M C;  3X1T A;  5DNN A;  4NFT A;  4ZBJ C;  3W97 D;  4BLM A;  4OLD A;  3GV9 A;  3ZFZ A;  2B5R A;  2F8N H;  1KX3 C;  1ES2 A;  5U47 A;  5BT1 D;  3LEL A;  1P3M C;  3W96 A;  5GLC A;  5F99 D;  5AY8 D;  3NY4 A;  2ARO D;  5CP6 D;  2HDR A;  4S2M A;  2OV5 A;  1JTD A;  1U35 D;  2XH9 A;  2RVQ C;  4B4X A;  4Y0U A;  3BLS A;  2XK1 A;  5B0Z C;  3E2K A;  3MGP C;  2VQR A;  5FAO A;  4O7D A;  4IBK A;  1W8Q A;  4IBG A;  3AZE C;  2PYO D;  1BLS A;  3AV2 D;  5BS7 A;  2Y2N A;  1XXM A;  4Z9Q A;  1P3F D;  2FFY A;  4XUJ B;  4U0X A;  4E3J A;  4PM7 A;  1P3O B;  4OKP A;  4OOY A;  3VFH A;  5CED A;  5BPV A;  3REJ A;  5B1M C;  2ZY2 A;  3QNB A;  5AQB A;  1H5X A;  4WZ5 C;  2WAD A;  3BFG A;  3WKJ A;  1YU4 A;  3AYW A;  2NQB C;  2EX8 A;  3PBR A;  4OON A;  5B32 G;  4J8U A;  1IEL A;  5B2J C;  1VQQ A;  4RYE A;  2A3U A;  4KUD C;  4LCM A;  4ZDX A;  2EXA A;  3UO9 A;  3AZF D;  4EV4 A;  1BZA A;  3AZJ D;  1JFI A;  3AZH C;  2HPB A;  1DJB A;  4KZ8 A;  4RA7 A;  4S2O A;  3W4P A;  3PAG A;  1TZY A;  1P3P B;  2F8N A;  4GD8 A;  3KS4 A;  4YM6 C;  1U60 A;  1Q2Q A;  3UDI A;  1KX4 D;  4AWL B;  3M2K A;  5B2I C;  1BH8 A;  3AZI A;  4WNN B;  1KX5 D;  2R9X A;  4J8W C;  4QNL A;  2LY8 A;  4KHA B;  2WZZ A;  3X1U A;  2FJ7 A;  4S2L A;  5CPI D;  1IKI A;  1L2S A;  1P3K D;  4OPZ A;  1LL5 A;  5F83 A;  2ZM0 A;  5E2F A;  2YFV A;  1JVJ A;  4QY6 A;  4P87 A;  5B31 C;  5GXQ D;  5HAR A;  3WAA B;  2WZX A;  3AN2 C;  1GHP A;  1KGG A;  3W99 D;  4G92 B;  2DNS A;  4KG6 A;  3B6G C;  3TU4 D;  4WU8 D;  1LL9 A;  3WA9 A;  4XXR A;  1P3G C;  4YS3 A;  5AV6 D;  2ZQA A;  4IBX A;  3REI C;  3FYZ A;  5BO0 B;  1O7E A;  2H0Y A;  4M3K A;  5D3O A;  4C75 A;  4RX2 A;  5B40 B;  5CGS A;  3C4O A;  4ZJ1 A;  3AL0 C;  1Q9C A;  1W5D A;  3X1V B;  5B33 C;  3MVD D;  3B6F A;  5AV8 B;  3UTB C;  2ZY4 A;  5G49 A;  3EG5 B;  5JRG A;  4CPK A;  1SKF A;  4J8X A;  2ZY3 A;  3G35 A;  5B1M D;  4IVI A;  4S2N C;  1GA9 A;  3LY4 A;  3UTA D;  4GKU A;  3M6B A;  1F66 A;  3L27 A;  4ZUX D;  3AZG B;  4DDY A;  1ID3 A;  2HP9 A;  3AZN C;  3W97 B;  3NQJ A;  2V1Z A;  1T3U A;  4KUD D;  5DF9 A;  3UY6 A;  4NE3 A;  5DTS A;  4XZQ C;  3MZE A;  4DE2 A;  3AZH D;  4GOG A;  1W7F A;  1TEM A;  4Z5T C;  5AY8 B;  4X23 C;  5CP6 B;  4OOM A;  1ZLA A;  2Z2L B;  3WS1 A;  1GHI A;  5CTM A;  3LZ0 A;  3VP3 A;  4HBU A;  3MNN A;  4N92 A;  5DNM C;  4DQY B;  3V39 A;  1BFM A;  5GT0 A;  3AZK A;  5B2I D;  1EQZ D;  1PZP A;  1TAF A;  2ZC5 B;  3Q1F A;  4J8W D;  4PPR A;  3IH8 A;  3ZNY A;  4R8P C;  3IH9 A;  5CEC A;  4J8V A;  2J7V A;  5CPK C;  3MGR A;  1XGJ A;  4PM6 A;  3V50 A;  1MXO A;  4IJF A;  3AN2 D;  3OPR A;  3AZL A;  4UUZ A;  3HL9 A;  1HQ3 D;  4QLC A;  5AVC A;  3GRJ A;  1KX3 A;  5GSU A;  3N8R A;  2J9P A;  1P3M A;  4H9R B;  5KSC A;  3RXW A;  3AV1 B;  1TDG A;  3SOI A;  1P34 C;  1FQG A;  3UDX A;  4JF4 A;  3KXB A;  2PU4 A;  5E5A A;  1NJ4 A;  3B0C T;  3BEC A;  5L2F A;  3AZJ B;  2IO5 B;  3AFA A;  3NQU B;  3MGP A;  3BFF A;  5BNX A;  5B33 D;  3IP4 C;  3MZD A;  1SCW A;  2I72 A;  3V9R B;  2FFF B;  3WTP D;  3UTB D;  1KX4 B;  3REH D;  1L0F A;  1KX5 B;  4H9S A;  2XD1 A;  4OPY A;  4JXW A;  1YLZ A;  5CPI B;  1BSG A;  3BFD A;  1M18 A;  4EO5 B;  4G92 C;  3PAE A;  4EBL A;  3MGS C;  1M19 A;  5KMW A;  5CEB A;  5B2J A;  4JXG A;  3LJA D;  3ITB A;  3W99 B;  2G2W A;  2C6W B;  2EX2 A;  1M1A A;  3C1B D;  3TU4 B;  4WU8 B;  5B1L D;  3FKE A;  4OJ5 A;  3W98 D;  5EVI C;  4WBG A;  5EOO A;  3SH7 A;  4H9O B;  3REL A;  1BUL A;  5FUG A;  3L25 A;  2QMI A;  4OPQ A;  1HVB A;  4S2P A;  5CXW A;  3VP0 A;  4YM6 A;  5FI2 A;  1KVM A;  4NZ4 A;  4IBD A;  2WGV A;  4MLL A;  3S4X A;  4JKT A;  3AZE B;  5CPJ D;  3V3S A;  3KUY C;  5CHL B;  3UPP A;  5CPK D;  3OZH A;  1S32 C;  2L5A A;  2XDM A;  3KWQ D;  4N9K A;  3IHA A;  2HIO D;  4Z2M H;  5DTK A;  3VOZ A;  1P3B D;  5M1A A;  4R23 A;  1PWC A;  3G2Z A;  5B1M B;  2CV5 C;  3HON A;  1K25 A;  4GD6 A;  4GH9 A;  5CHU A;  3UTA B;  1AOI A;  2NQB B;  3UN7 A;  2RIQ A;  1PI5 A;  3EQU A;  4ZTK A;  3AZM D;  2WKE A;  3EPH A;  3WS4 A;  4OQ0 A;  5BT1 C;  3X1T D;  4EBP A;  5F99 C;  1P34 D;  4KUD B;  5AY8 C;  2ARO C;  5FAQ A;  1H3O A;  2ZC7 A;  3HUN A;  1U35 C;  3ZG0 A;  4OUI A;  4OVD A;  3AZH B;  3SS4 A;  3V5M A;  1CEG A;  3W96 D;  4JJN C;  2NZD D;  3E2L A;  2J9O A;  3G30 A;  4IBJ A;  2PYO C;  4NE6 A;  2EFU A;  4CJN A;  1HZO A;  3AV2 C;  5GT3 A;  5KSH A;  5GL9 A;  5B2I B;  1QMF A;  1EQZ B;  1P3F C;  4J8W B;  4GHA A;  4LV2 A;  4NYY A;  1PIO A;  3VSL A;  3O62 A;  4KZ9 A;  5FAP A;  4QHC A;  5HW3 A;  5J8X A;  4KZ5 A;  3TG9 A;  3VH5 A;  4S2N A;  2DF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...