2Y2PA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
489
structure length
466
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 157
structure length 466
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2pA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2pA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2pA02
1WYCA 3WS5A 3GQZA 2ZQAA 3NDGA 3V5MA 1L0GA 2WGVA 3BFEA 4QD4A 3FV7A 3ZG7B 2XDMA 4UAAA 3ITBA 4S2NC 2WYXA 1IEMA 5CRFA 3BM6A 2DCFA 4D2OA 2P9VB 2C5WB 2Y2NA 4ZJ2A 4OOMA 3N6IA 4OP5A 4BENA 2WKEA 2FFYA 4EQIA 5GHXA 3DWZA 3TSGA 1RP5A 5HW3A 4P85A 4LENA 4WBGA 1YLZA 3UNWA 4CJNA 1I5QA 1JWZA 2J7VA 4OQGA 3VMAA 4EBNA 5F1GA 3SH9A 3VP4A 5F83A 1C3BA 4Y0OA 5I94A 5FI2A 4IVIA 5JYPA 3MXSA 2Y2IA 1DJAA 4R4SA 5E2FA 1HVBA 5FQIA 5FAOA 4N1HA 1XA1A 4OPRA 4JXSA 2V20A 2XQZA 1DJBA 5L2FA 4OONA 2XD1A 1CI8A 1TVFA 3IXHA 1KDSA 5FI6A 3PAGA 5KMWA 3VFFA 2EFUA 3GV9A 3HLFA 3Q07A 4QU3A 5EVIB 4GKUA 3VP0A 1MWTA 1IKIA 4FCFA 1BTLA 5KSCA 3HREA 1K6SA 4DKIA 3WS2A 1XXMA 3Q82A 5DTKA 2EX9A 1ALQA 2DNSA 4R3BA 4DE1A 2JC7A 4S2MA 5CHMA 4U0XA 4OOYA 1AXBA 4E3OA 3EQVA 2XGNA 3NY4A 4YINA 3S1YA 1ESIA 5FQMA 3VOYA 4BD1A 1U60A 1EROA 1IELA 3ZVWA 3HLBA 1GHIA 1MPLA 3FKVA 3Q1FA 3VP1A 5E43A 1G68A 2A49A 4N92A 4Y0UA 3MKEA 2HP5A 4GD8A 1YLJA 4U0TA 2HP9A 2XEPA 4EBPA 1WE4A 3V50A 2G2WA 3W4OA 4LCLA 3RXXA 4KZBA 2ZQ9A 3W8KA 1RCJA 1S0WA 2Y2GA 2Z2MB 4JPMA 4K0WA 4S2IA 1W8YA 5E2GA 1QMFA 1NZOA 4WEKA 4MBFA 5CTMA 2Y2QA 1Y54A 3MZDA 2PBYA 4DXCA 3GVBA 1PI5A 1SCWA 2WGIA 1L0DA 3ZG0A 3ISGA 1N4OA 4GDBA 1K55A 3B3XA 1PYYA 3GR2A 1KE3A 3IT9A 2WGWA 1TDLA 5HFOA 4OPZA 2XR0A 1Z6FA 2Y59A 1XKZA 4YFMA 3ZG8B 4F94A 2DRWA 3FYZA 3N7WA 1VQQA 3OPLA 2J8YA 5J8XA 4WZ5C 1MXOA 1LI0A 4S2LA 5IHVA 4N9KA 2ZC6B 5DTSA 4RA7A 3HUOA 5EOOA 4QY5A 2RCXA 3O86A 5AQ7A 2C6WB 4PM9A 5JYOA 3ZG5A 1HTZA 3O88A 4RX2A 1WYBA 5KZHA 3AGDA 3V3RA 1XP4A 4OH0A 4X56A 1KVMA 4S2OA 5HAPA 4L0LA 2Y2LA 2WK0A 4JKTA 4ZJ3A 3PBRA 5GLCA 3A3JA 3IQAA 3MZEA 1OMEA 2QZ6A 1KE4A 2Q9NA 1BSGA 1GA0A 4R3JA 3HLDA 1KDWA 2EX2A 3HUNA 4KZ5A 4OQIA 3N4IA 1PWGA 2R9WA 3IHAA 3OPRA 3JYIA 2EFXA 3BYDA 2PU2A 3Q7VA 5DVAA 3C7UA 3PBQA 1LL9A 4R4RA 3ZHHA 4ZDXA 4OPQA 1K4FA 3CG5A 1XGJA 1PW1A 2EX8A 5FSRA 3BLMA 5CGWA 1ZKJA 3FWLA 1NRFA 4JXWA 1TDGA 4KZ3A 3UPOA 4Z9QA 3PBSA 4GD6A 5U47A 4IBXA 4WM9A 2IWCA 2G2UA 4JF5A 2Y2PA 1H8YA 2PU4A 4O7DA 3Q7VB 3IWOA 4GN2A 1ZC2A 3AGEA 3Q7ZA 4ZJ1A 3MXRA 1Q2PA 4DE2A 3SH8A 4DDYA 3BFDA 3QNCA 1K56D 4KQOA 4EUZA 3N8RA 5M19A 1KE0A 2A3UA 3RXWA 3LY3A 3VP2A 4Q8IA 3HL9A 1PW8A 2ZC5B 1CEFA 2WAEA 4C6YA 4OLGA 5CEDA 1GHMA 1NXYA 1K6RA 3PBTA 5FAQA 3UE3A 5F1FA 1MWSA 1NYYA 4DE0A 3UDXA 5HAQA 4X53A 4LCMA 1EWZA 1N9BA 1H8ZA 1JTDA 1LLBA 3IXBA 4Y0TA 5EECA 5FI7A 1MWRA 4WEJA 2WKIA 1NY0A 1ESUA 1YT4A 2JCHA 3DW0A 2EX6A 4WELA 5CXWA 5TFQA 1KGGA 3G30A 1HZOA 1MBLA 4BLMA 5GL9A 3BEBA 4S2JA 3ZNTA 1FSYA 2BLSA 3A3DA 5A92A 5A90A 1YQSA 1RGZA 1O7EA 1BT5A 1SKFA 1MKIA 3BECA 3IXDA 4QY6A 1DJCA 3AGFA 2X01A 4PM5A 3UN7A 1BZAA 2RL3A 4IBRA 5FASA 3MBZA 2JBFA 4KG6A 3HLEA 2Y55A 5EVIA 3UDIA 1YLPA 4BQMA 2WGWB 1MY8A 1W8QA 1ERMA 1PWDA 4QB8A 5DF8A 2HDRA 3UE1A 1ES5A 2Y2JA 4LV0A 4EBLA 4HBTA 3OC2A 3C4OA 3GSGA 4KZ8A 4OVDA 2H0YA 1L2SA 4GB7A 4BJPA 2WZZA 4KZ7A 5FQKA 2V2FF 2J9PA 1KVLA 4R0QA 2HDQA 4E6WA 1LL5A 4JLFA 3E2LA 1FQGA 3LY4A 3A3EA 2Y2KA 4PPRA 2ZQDA 5EE8A 4WMCA 1G6AA 2EXAA 2ZLYA 2Y2OA 3NC8A 1W79A 2XK1A 4ZBEA 4GNUA 1ZG4A 5FQ9A 1ES2A 1K25A 3UPPA 1VM1A 4UA7A 1K57C 3IWIA 4XXRA 3OZHA 3C4PA 1FCMA 1ZG6A 4LV3A 4Y7PA 2VGKA 3UO9A 1SDNA 3VP3A 3M2KA 3PTEA 5A91A 1YMXA 3C7VA 4LV1A 3IWQA 1K56A 1BLCA 2H5SA 5D3OA 3DTMA 2Y2HA 1FCOA 3E2KA 5CERA 5TR7A 4S2KA 5CTNA 3GMWA 2P74A 2XH9A 3CZDA 4C75A 2I72A 3IF6B 5DF7A 4X55A 4S2PA 5FQJA 3NIAA 1BULA 3WS4A 1KGEA 1BLHA 3S4XA 3SH7A 2ZQ7A 1NJ4A 5CHJA 3G2YA 1M6KA 2ZC7A 3BFFA 1XPBA 3GTCA 1XA7A 4MBHA 1SHVA 1YMSA 3IF6A 3G2ZA 1IYQA 3BRMA 2ZD8A 2X71A 2OLVA 2VGJA 3A3IA 4K0XA 4PM6A 5M1AA 2X02A 3M6HA 5KSHA 1NZUA 5F82A 3ZFZA 2J9OA 3HLWA 3OCLA 4ZAMA 2HDSA 1JTGA 3IF5A 4X68A 3O3VA 1CI9A 2P9VA 4OPYA 3G35A 4PM8A 2HDUA 5FDHA 3UY6A 3MFDA 4ID4A 2Y2MA 4HBUA 2ZM0A 1YLTA 3VOZA 3EQUA 4WZ5A 1IYPA 2XLNA 4HESA 4BD0A 2HP6A 4QJGA 5HARA 5DTTA 3PBOA 1FR1A 1GHPA 1YLYA 5TGFA 3P09A 4RYEA 4PMAA 1I2WA 5FQQA 2UWXA 5CEBA 3ZG9B 3IF6C 3PAEA 3WRZA 4DF6A 1ERQA 5BOHA 3WWXA 1IYSA 1XX2A 2WZXA 3IHBA 4FD8A 3V3SA 4WYYA 4KZ6A 2ZQCA 4N9LA 4JF6A 4FH2A 5DF9A 4X6TA 3M2JA 1BLPA 4IEDA 2GDNA 3SS5A 4UA6A 2WUQA 5GLDA 3QHYA 4BL3A 5E2EA 2Z2LB 3WS1A 4E3LA 1M40A 4ZTKA 1E25A 1MWUA 2WKHA 4H8RA 4KZ9A 5E2HA 1EI5A 3W4PA 4NETA 1S6RA 2HPBA 4MNRA 1ES3A 1JWPA 4P6BA 4UA9A 4OQ0A 4E3NA 4B4XA 1BUEA 4NK3A 1Q2QA 4R23A 5HX9A 1K55C 5HAIA 1K54C 2XF3A 4DE3A 4QHCA 4IVKA 3C5AA 3GRJA 4JF4A 1CEGA 3PBNA 3HLCA 2OLUA 3ZCZA 5FAPA 3BLSA 4FH4A 1J9MA 1W5DA 1GCEA 4XUZA 3I7JA 4KG5A 4OKPA 1E4DA 4R1GA 5G18A 3ZVTA 2ZC4B 3HVFA 1PI4A 3LEZA 4U3TA 1YLWA 2JE5A 1TEMA 3G32A 3G4PA 4GDNA 1SDEA 2CC1A 5CECA 2OSUA 2Q9MA 3G31A 4WMCD 1FOFA 1LI9A 1H5XA 4KENB 3ZDJA 4KQRA 1YM1A 3ITAA 4OQHA 2QMIA 2XD5A 4GZBA 4OLDA 3WRTA 5CHUA 1XGIA 1PZOA 4HEFA 2XFSA 1KGFA 4B4ZA 1K57A 4C3QA 1QMEA 2ZM2A 2ZQ8A 2ZJ9A 3Q81A 3TOIA 3O87A 1L0FA 2V1ZA 3OCNA 4DRTA 4A5RA 2OV5A 5A93A 3HBRA 2H10A 2Y4AA 2ZMAA 5EVID 1CK3A 3BFGA 3G34A 4KZ4A 1FR6A 5EVLA 5GLAA 3N8SA 3UE0A 3LO7A 5GLBA 4E3IA 3IH8A 3HLGA 3TG9A 4OP8A 2B5RA 3RJUA 5M18A 1HD8A 4WZ4A 1K38A 3NI9A 3W4QA 1FSWA 1ONGA 1ONHA 4E3MA 1IKGA 1NYMA 5AQBA 4CPKA 5HL1A 3IH9A 4E3KA 3NDEA 3QNBA 3NCKA 3OPHA 4JXGA 1I2SA 2WADA 3IXGA 2Y91A 4FSFA 5EUAA 4K91A 3SOIA 3CMZA 4KG2A 5EVIC 5FATA 1PIOA 4MLLA 2XFTA 1W7FA 4N1XA 5EOEA 3WS0A 4UHUA 1JWVA 1DY6A 1E3UA 2ZC3B 4E3JA 2QPNA 4JBFA 5AQ9A 1O07A 4MBKA 1LHYA 3HUMA 3NBLA 3UDFA 3ZNYA 4E6XA 4EV4A 5CGXA 4P87A 3FKWA 3BFCA 1JVJA 1ES4A 3UPNA 5EPHA 3P98A 1RGYA 1K54A 4RX3A 5FA7A 2E8IA 4P0MA 4S2NA 5GHYA 2EXBA 4M3KA 3N8LA 5GHZA 4EWFA 2IWDA 3SS3A 2BG1A 1PZPA 2H0TA 3MZFA 4PM7A 4LV2A 4XUXA 3V39A 3VFHA 3VSKA 3VSLA 3A3FA 5CGSA 1GA9A 4KZAA 2ZM8A 1K4EA 3FZCA 1FCNA 4MEZA 2FFFB 3M6BA 2IWBA 3CJMA 5AQAA 4KQQA 1PWCA 2WAFA 4B88A 4RVAA 4GOGA 1L0EA 2R9XA 4JXVA 3ZGAB 3LCEA 3S22A 1E3UD 3D4FA 4DXBA 1BLSA 3OPPA 3SS4A 4BL2A 3MKFA 3DWKA 4OOLA 4X69A 1IYOA 4DDSA
chains in the Genus database with same CATH superfamily
4JJNB 2ZQAA 4Y13A 1L0GA 2LY8A 4QD4A 4P6ZS 3FV7A 2VQRA 5CPJD 3H82B 1P3OC 4NXBA 4QLCB 3ITBA 2WYXA 5CRFA 2P9VB 1E6RA 3REID 4RQ9A 4OOMA 3P5JB 2W0NA 2WKEA 2FFYA 4EQIA 2ZMVA 5GHXA 4HGAB 3DWZA 4HHDA 1RP5A 2IO5C 3TSGA 5L09A 4P85A 5F5YA 3AFAA 1YLZA 5FUGA 1YU2A 1OTAA 5CP6C 3KYZA 4WL9A 5JRGB 1C3BA 4Y0OA 1CXWA 4Z66B 2VJWA 2Y2IA 3B33A 5HDCA 4N1HA 4OPRA 2RTSA 1DJBA 2XD1A 3TE8A 3IXHA 3AZND 1OTDA 5KMWA 1W2EA 4DN0A 2DF4C 1P3GA 2DNSA 1HQ3A 4S2MA 3MGRD 3KXBB 4WF0A 4WU9B 3L9KA 3VOYA 1U60A 4R38A 2V0WA 5G4YA 1MPLA 3FKVA 5B40B 5B32B 4NE3A 2A49A 4YWZA 3MGQA 5J7EA 3UB7A 2G2WA 4KUDC 4JPMA 4K0WA 3KWQB 4S2IA 1ID3A 2ZY3A 1BH9A 5B2IA 3NULA 4WEKA 3MZDA 2P04A 3LYXA 3QP6A 1IOUA 3V9RB 2WGIA 1L0DA 3RFBA 4LLOB 3T4KA 3S7NA 5HZHA 3B3XA 3KS8A 5CPKA 5HDSA 2WGWA 2XROA 4XUJA 1LL8A 5E5AB 2Y59A 1XKZA 2NZDA 1LSXA 4NZ3A 5E5AD 3L25A 5J8XA 1FIKA 2ZC6B 5EOOA 2PYPA 2C6WB 5JYOA 3ZG5A 4H9OA 5B2ID 5JRGC 4WJ3C 4UUZB 1XP4A 4OH0A 4XT2A 4L0LA 1E6PA 3PBRA 5GLCA 4H9RB 2QZ6A 1BSGA 4R3JA 3HLDA 2YKHA 3W97A 4DRAA 3A0SA 4OQIA 2R9WA 4HIAA 1P3KB 3REJD 4R4RA 5CGWA 3UPOA 4KZ3A 1ID3C 5B1LB 2A24A 3NOUC 1LT0A 5U47A 1TD5A 1P3GD 2IWCA 2UV0E 2G2UA 4PKYA 2Y2PA 1W1YA 3K3CA 3VH6T 1P34C 3MXRA 4DDYA 3QP1A 3N8RA 1D06A 3LY3A 3UTBA 2QWSA 5FDSA 1GHMA 1NXYA 1K6RA 5FAQA 4JGOA 4Z2MH 3WA9D 4J8VA 4F3LA 4Y0TA 4IHQA 4WEJA 2ZMFA 1YT4A 3U4LP 3NQUB 1EQZA 2EX6A 3KXBA 4IBIA 1HZOA 4S2JA 3ZNTA 2BLSA 3B42A 1YQSA 1MKIA 3BECA 4BBUA 4WUJA 5K5BA 4M6BA 1YU0A 4PM5A 3UN7A 4IBRA 2JBFA 1XFQA 1G5UA 2Y55A 3UDIA 3VE3A 3RELB 1MY8A 3UE1A 1ES5A 1GOIA 2Y2JA 3MVDB 4LV0A 2RVQC 3T4QA 5GXQB 4J8VC 3NOTC 4HBTA 3GSGA 4Y3IA 5B0ZA 2H0YA 2INWA 4G3VA 3MGPB 4JGPA 2V8FA 2RIQA 3X1SB 1Y4OA 3AFAC 3AZHC 4X23B 2ZM5A 1TZYC 3MFXA 3A3EA 4H9QB 2ZLYA 2NQBB 1GSWA 2I9VA 4MN7A 4ZBEA 1ZG4A 1M19A 2BYMA 1K25A 5GSUA 5CPJB 3H0RC 3X1UA 2W27A 1FCMA 2RVQD 3VP3A 3AZKD 3M2KA 4LV1A 1BLCA 2Y2HA 1T1AA 3E2KA 4S2KA 3AZFB 5L10A 3GMWA 3IF6B 3AZEC 2EWWA 4O01A 1KGEA 4EEUA 1NJ4A 3OBFA 3REJA 4LRZE 3BFFA 5B33A 4MBHA 3W96B 3G2ZA 3ZYTA 4PM6A 2X02A 3M6HA 5KSHA 5F82A 4B93A 2BYKB 3HLWA 3MGSD 5J3WA 5L07A 1ZHHB 3IF5A 1JTGA 1M1AD 4EQ1A 4LD9B 3L27A 4GJ4A 4OPYA 5FDHA 1ID3B 4IBKA 3MFDA 1M1AB 4GLQA 3W98A 1ID3D 1IYPA 2HP6A 2AROD 3LR3A 1FR1A 3AZGB 4HMCA 2VV7A 4J8XB 1I2WA 5AV5B 5BOHA 3WWXA 1TF1A 5AV5D 5CPKD 4HP9A 2AROC 4JF6A 4X6TA 2GX5A 3PYPA 2HZ5A 1M19D 3LJAD 5AY8C 3UB6A 2WUQA 5GLDA 4IUHA 3JVUA 4H9PA 4KUKA 3NECA 3WS1A 3NQJA 1E25A 1MWUA 3W4PA 4NETA 2YFVA 2HPBA 3WKJC 3AZKA 1SZVA 1JWPA 4P6BA 4OQ0A 3V67A 4WLAA 3UT9B 1XJ6A 4H9SA 4NK3A 4O0PA 3X1TC 2W1TB 4ARZA 4QLCD 1E6NA 3CHWP 1K54C 3LIEA 3WD0A 2WKPA 3C5AA 4NYUA 3GRJA 5G49B 3PBNA 2OLUA 2FN2A 3ZCZA 3BLSA 3MGRA 1W5DA 1GCEA 3EOIA 4XUZA 5G18A 3X1UD 3UTBC 5GT3A 3AYWA 1V9ZA 2ZC4B 1PI4A 3REIB 1J7MA 3G32A 5CECA 3REKA 3A1IA 1PNEA 3F1PB 5CPJA 4QNLA 4ZUXA 1H5XA 4KQRA 2PD8A 3AZNB 3H0MC 5CP6A 5CHUA 1N9LA 1GSVA 3DTKA 2XFSA 1KGFA 3W2ZA 3S7OA 1OT6A 5B0ZD 5AV6A 5DJTA 5B0ZB 3F1PA 5F99D 4JJNC 2ZMAA 1A0KA 3N8SA 1ODVA 5DNMC 4E3IA 1ZTUA 3B6GB 2DMWA 2QYBA 5M18A 4NE5A 1ONGA 4E3MA 3MNNB 1WWSA 1BFMA 3MGRB 1CF0A 5HL1A 3IH9A 3WD4A 3NCKA 1I2SA 4J8VD 3AYWB 3LICA 5IU1A 1PIOA 5AY8B 2CV5C 2D02A 1P3MC 4R8PC 4GHLA 4Q0HA 1EQZB 1U35C 5G4ZA 4E3JA 5HDDA 3KWQD 5B33C 2PYOC 1O07A 2E8JA 1P3BB 1S4SA 1LHYA 4MBKA 1P3KC 2YFVB 3QP8A 2B02A 3B6FB 2FJ7B 4Y15A 2F8NA 4S2NA 3N8LA 1X0OA 2H0TA 3V39A 4WU8C 4KGCB 5B40C 3UB5P 4ESPA 5E5AA 1K4EA 2PYOD 5FEFA 4J8XC 2O0YA 1AWIA 4XZQC 1PFLA 2FFFB 3FG8A 2YFWB 1OTEA 3LJAA 1S66L 3CJMA 4R8PD 2P08A 2R9XA 1PZRA 3D4FA 3QP4A 4LRXC 5HL6A 4BL2A 4JGRA 1IYOA 3GDIA 3GQZA 3WS5A 3V5MA 1JFIB 2ZL1A 5DNMB 3AV1B 3AN2D 3GECA 4OJ5A 5DNMD 2DQNC 2XDMA 4UAAA 1S32C 2M7VA 3BM6A 4E04A 4D2OA 2C5WB 3W98D 4ZJ2A 5AVEA 3X1VA 3MXQA 4G92B 3AN2A 4UUZA 3CUEC 4IUKA 4WN5A 3UNWA 4CJNA 2IO5B 1I5QA 1JWZA 4HJ3A 4OQGA 4OJPA 4EBNA 1P3MA 1EW0A 3VP4A 1ED7A 5F83A 4ETZA 5I94A 4IVIA 3LZ0D 5JYPA 5FQIA 5FAOA 5AVCA 3REJB 2LB9A 3REHA 2FJ7C 1XA1A 2V20A 3LZ0B 3KUYC 4KGCA 4KQDA 4OONA 1KDSA 5FI6A 2PYOA 2PDRA 5B1MD 5DNND 3GV9A 1P97A 5BS7C 5EVIB 1TZYB 4GKUA 1R4VA 4FCFA 1F66A 1BTLA 1P3MB 4DKIA 3UTAD 1W1VA 1S4RA 1XXMA 5E5AC 1OTBA 2EX9A 4R3BA 2JKTI 4DE1A 5CHMA 4U0XA 4OOYA 1AXBA 5AV8C 2JN7A 5AY8A 3NY4A 1N1JB 1ESIA 3RELC 2EWVA 4Z5TC 4YS3D 2PR6A 3ZVWA 3Q1FA 3WKJD 3RH8B 4J8WB 3BY8A 5E43A 1G68A 3AZGD 1HQ3D 4J8UB 4GD8A 3KSIA 5GSUB 4U0TA 4CAYA 3WTPC 2XEPA 5B1MC 5DNNC 3ZQ5A 1S0WA 2Z2MB 2Y2GA 2A2LA 3W99B 5MC7A 4IBFA 5E2GA 1QMFA 4HP4A 3L7HA 1M19B 3GVBA 2JKFA 3TU4D 3ISGA 4GS9B 3TU4B 2G7UA 3TRCA 3T1XA 3LI9A 1OGBA 4OPZA 2F8NH 1P3LC 3AZJC 4Y17A 4F94A 2DRWA 4JGQA 3REIA 3OPLA 2J8PA 2J8YA 4M4XA 4WZ5C 1KU5A 5GT3B 1MXOA 4S2LA 5JRGA 3X1TB 4PM9A 1O6IA 3REKC 3AGDA 3V3RA 2IOUA 4L9EA 4X56A 2W1TA 4ARZB 2QHKA 5HAPA 4JKTA 4Z2JA 5AV5C 4EEPA 3A3JA 3IQAA 3MZEA 4X23C 3NQUA 2K31A 4QLCA 3KSYA 1KE4A 2B95A 1GA0A 1KDWA 3WA9A 2EX2A 3IP4C 4KZ5A 3OPRA 3IHAA 3JYIA 3Q7VA 3AZFD 4ZDXA 3C7UA 3ZHHA 1K4FA 3CG5A 5FSRA 2EX8A 3PR6A 1NRFA 3PXPA 1XFNA 3B0BA 1UWPX 4J8WC 4JF5A 1H8YA 2PU4A 3T50A 4IBEA 4O7DA 1P3KA 1YSQA 5AVCD 3AGEA 2CV5D 4ZJ1A 1Q2PA 3BFDA 3QNCA 4EUZA 4Z5TD 2YKFA 5CEDA 3HL9A 2ZC5B 1CEFA 2WAEA 4OLGA 5F68A 3PBTA 4CAYB 4DE0A 3UDXA 1Y28A 5CPIB 4LCMA 1N9BA 1KOUA 1MC0A 2VA0A 2WKIA 4G91B 1ESUA 4WELA 5CXWA 1P3BD 1TS6A 4XZQA 3HONA 3EEHA 5DJUA 5BS7A 1SKFA 1BT5A 4UEYA 3IXDA 4QY6A 2X01A 1BZAA 3SZTA 5EVIA 1YLPA 3OOVA 1AOIC 1ERMA 1PWDA 5DF8A 3UMDA 4XUJD 3F1NB 3FPVA 2VLGA 4OVDA 4DMZA 4MB4A 5TBMB 4XUJB 5AV9C 2WZZA 5FQKA 2J9PA 4R0QA 4NE6A 3T1RA 4Z2KA 4E6WA 3S7QA 1FQGA 3KXBC 4X1LA 2V1BA 4PPRA 2ZQDA 4WMCA 3NC8A 2Y2OA 2XK1A 2AVXA 5B2JA 1ES2A 5HPFA 5B24B 3MGQB 1VM1A 1V9YA 5B32A 3C30A 4H9SC 5BNXA 1AOIA 2D01A 2ZL1B 3UO9A 4AWLB 1YMXA 2CWEA 5D3OA 3C8CA 5CERA 5CTNA 3LJAC 2P74A 3EPKA 3L2AA 4Z5TA 4X55A 1T1BA 1BULA 3REJC 1P3KD 5BPVA 3BW6A 3S4XA 1P3GB 4Z66D 5GXQA 2ZQ7A 4NYYA 5CHJA 3O62A 1PRQA 3WA9C 1M6KA 4GHIB 4HJ4A 1T3UA 1XA7A 3HJIA 3IF6A 1IYQA 4K0XA 1TS8A 3A1KA 5HWTA 5C3IB 5J4EA 3C1CD 3OCLA 3C1BC 1P9WA 2PYRA 3UY6A 2P9VA 4PM8A 3G35A 3LELC 1KX3A 2HDUA 3AYWD 2XA7S 2ZM0A 4H9NA 4WU9D 3LIFA 2XLNA 2EA9A 4HESA 1M18C 1P34B 3MNNA 4J8VB 5HARA 1YLYA 4J8WA 4RYEA 1P3PD 4PMAA 2UWXA 3WRZA 2OAP1 3PAEA 4DF6A 5BO0B 4HY8A 3WAAC 4HNBA 3UTBD 4KZ6A 2ZQCA 4HGAC 1P3AB 2GNXA 2O99A 5DF9A 3CAXA 1GSXA 4IEDA 5B2IC 4BBTA 3IS2B 5CP6B 2KDKA 3LELA 1KX3C 3QHYA 4R8PB 3MQLA 4QLCC 1HQ3C 3NJAA 3DAVA 2PYOB 4E3LA 3REKB 1M18A 5F69A 1S6RA 1K0KA 3KYQA 3F1OA 5AV8D 3C38A 3EPJA 3FKEA 2VV6A 4NZ5A 4R23A 4R70A 1K55C 5HX9A 3M7PA 3C1BD 3AV2A 1L6JA 1CEGA 3WKJA 3A6NA 4UPKA 3KUYB 5FAPA 4KUDB 3I7JA 4KG5A 4R1GA 3KUYD 3ZVTA 1AOIB 3HVFA 5CPKC 1TS0A 3WD1A 4U3TA 4LG2A 1VETB 1PDCA 3G4PA 3LIBA 4GDNA 3MMHA 1SDEA 2NZDB 3LI8A 1P3IA 5AVBC 2Q9MA 3G31A 3UTAA 1FOFA 1LI9A 4IBCA 2BASA 3ZDJA 4OQHA 3B0DC 2QMIA 4WU9C 2FH5A 5B1MB 5DNNB 1MZUA 3FC7A 1K57A 1QMEA 4I3IA 4HH3A 1L0FA 4IJGA 2KX6A 3AV1C 2OV5A 3D9YA 5EVID 1CK3A 3BFGA 2HJ9C 4ZBJC 4Z2HA 4G3KA 1P3LD 1ZLAA 4DJ2A 2ZY5A 3IH8A 3HLGA 4J8XA 3AZLD 4OP8A 1HD8A 1K38A 1IKGA 1NYMA 4CLCE 3X1VD 4CPKA 4XZQD 4E3KA 4XT2B 3WA9B 3CITA 1VETA 4NXGA 2XSSA 4FSFA 5EUAA 3CMZA 3MJQA 5EVIC 4MLLA 2XFTA 4KUDA 1W7FA 4UHUA 1HQ3B 2QPNA 3HUMA 1UGUA 3H0LC 3ZNYA 4EV4A 1ES4A 5EPHA 2HIOD 3B6FC 3T4TA 4WU8A 1U35D 5GHYA 2EXBA 4M3KA 4ETXA 4EWFA 5HSQA 3SS3A 5CX7A 2BG1A 3KYEA 4XUXA 3RELD 3EG5B 2FZ0A 5L8MA 4KZAA 1YU3A 3IX3A 3M6BA 5FEGA 4NXFA 1YAXA 1KX5A 3LELB 5AQAA 4RVAA 3LCEA 3S22A 1E3UD 4DJ3A 1GPFA 4BWIA 1BLSA 2XRNA 5HWWA 5CEBA 3DTEA 4CQHA 2WGVA 5B40A 2O9BA 4JJND 2DCFA 4JJNA 2Y2NA 5TJJA 2BYMB 5DKLA 2Z6DA 3N6IA 5G49A 3R7WB 4FUWA 5KDMB 5LBRA 4H9QA 3CWFA 4X23A 2J7VA 1KX5B 5EFWA 5B31G 5F1GA 3SH9A 3X1TA 5FI2A 5IS1A 3MXSA 1OJGA 1J3WA 1DJAA 2JKTM 4GHIA 4LRYC 4R4SA 1HLUP 3AZEA 2XQZA 3FPWA 1NRJA 1CI8A 1TVFA 2EFUA 5F6AA 4L9FA 2NUTC 4QU3A 2G5HC 4Z5TB 5GT3C 4WZSB 1IKIA 1MWTA 3VP0A 3HREA 3B6GD 5AVCB 3X1VC 5B0YA 2JC7A 1NLZA 2VV8A 3W97D 3KSGA 2XGNA 1UWNX 5B40D 4OUIA 2ZY4A 1TAFB 1P34D 3HLBA 1GHIA 1M19C 2NZDC 1VEUA 4PHTA 3LZ1B 4Y0UA 4F3LB 2HP5A 4DRBA 5B24A 3T1QB 3EPLA 5AY8D 1WE4A 3V50A 3W4OA 2JSSA 4IBBA 3AZNC 2ZQ9A 3KWQC 1H0MA 3W8KA 4Z66C 3K3DA 1P3AD 4HH2A 1JNUA 4LD9A 4MBFA 5CTMA 2Y2QA 1Y54A 3K2NA 5AVBD 4WNNA 2PBYA 3CPTB 1PI5A 4DXCA 4G92C 4GHAA 3ZG0A 1N4OA 1K55A 3GR2A 1PYYA 4MB3A 3FDDA 4KGCD 5EM0A 3LJAB 3IT9A 1TZYA 3WTPA 3C2WA 4I3AA 3JVVA 4HMDA 1P3IB 3F1NA 4YFMA 3ZG8B 3AZJD 4HOIA 1IFQA 1P3ID 1A7WA 4NKPA 2ZBBA 5IHVA 3VV4A 3HUOA 4QY5A 2RCXA 3O86A 5AQ7A 1P9RA 3KUYA 4ZUXC 1XJ3A 3B6FA 5I5LA 3AV2B 5B0YC 4RX2A 4Z1WA 1WYBA 1OT9A 5AV9B 2XA7M 1KVMA 3EWKA 4S2OA 2V9AA 2OOLA 4ZJ3A 5KIZA 2CMNA 4NG2A 1P3LA 1ZLAD 1OMEA 4Z2IA 2Q9NA 3AZIB 4CLCA 3WTPD 4Y5FA 3X1UC 1PWGA 4XUJC 3MS6A 2EFXA 2PU2A 3WTPB 5DVAA 3PBQA 1LL9A 1SKOB 1PW1A 1WWIA 3BLMA 1ZKJA 3QP2A 3FWLA 4JXWA 1TDGA 3UB9A 4Z9QA 3IX8A 3PBSA 3AZKC 4IBXA 4WM9A 3X1SA 4AWLC 1W1PA 2ZOHA 3UTAB 3Q7VB 4FOFA 3IWOA 1ZC2A 3C1CB 3SH8A 5M19A 1K56D 2F8NK 4KQOA 1S32D 1YU1A 2V8CA 2A3UA 3RXWA 1PW8A 1S32B 3UE3A 3AFAD 1MWSA 3MGRC 5HAQA 3REHC 2FJ7A 4Z2MG 1H8ZA 1JTDA 3IXBA 3NHQA 5EECA 1MWRA 1NY0A 1WA9A 2JKGA 4J8UD 3DW0A 4I5SA 3AZMC 5GT0B 2HJEA 3VH5W 1KX3B 5TFQA 3T4JA 3G30A 3JPUA 5GT0D 4BLMA 5GL9A 3BEBA 2PHYA 1FSYA 5GSUD 1P3PB 3W98C 3BJNA 2RL3A 3MBZA 4KG6A 3HLEA 2L4RA 3MQOA 3T12B 3DTIA 4QB8A 2HDRA 3F6TA 1B6WA 4EBLA 3AZEB 4YM6B 3L28A 3C1CA 1Q9CA 2L5AA 3NQJB 5CPJC 1L2SA 4GB7A 3IX4A 3MVDD 4BJPA 3MQ0A 4NFTA 4KZ7A 5GXQD 4Z66A 1UR8A 1KS0A 4X23D 5B31A 4B9OA 4IBDA 1LL5A 2V5OA 3E2LA 5B1LA 2VGLM 5BO0A 5AV8B 5FUGB 3LY4A 4GS9A 4UQIM 5EE8A 3REKD 1G6AA 3LZ1C 3R7WA 3A0RA 5BNVB 4J8UA 1P3FD 4UA7A 3IWIA 3W99A 4EU0A 4MN5A 4WU8D 4GW9A 1ZG6A 4LV3A 3AV1D 2VGKA 5F99C 2QJ5A 3R45B 1YSPA 3IWQA 1K56A 5AV9A 2H5SA 3MSHA 4CSRB 5B0ZC 3DTMA 1D7EA 1FCOA 4X1MA 1AOID 1HTAA 2BTFP 3CZDA 4C75A 2I72A 3TU4C 5DF7A 2M7UA 4S2PA 3UT9A 3MQQA 4GH9A 3VOLA 4TX8A 1BLHA 5B2JD 1H8MA 3SH7A 4HI4A 3REHB 4Z2GA 2HUEB 2O9CA 4OJ6A 1XPBA 3REHD 3GTCA 1SHVA 3UMEA 3AZMB 3ULFA 2F2AC 1DRMA 2ZD8A 2OLVA 3A3IA 1TZYD 5M1AA 3NOPC 3BWLA 5B32G 5CPID 2P7JA 1F98A 4YS3C 3DBAA 3V9RA 1YPRA 3X1SC 1OGGA 3O3VA 3AZLB 4LD9C 4ID4A 4MDZA 2Y2MA 4HBUA 2W3GA 1YLTA 3W96C 5B32D 4EO5C 3VOZA 3EQUA 3WAAB 2AROB 5DNMA 4HQAA 4QWOA 5DTTA 3LZ1A 1KX5C 3ZG9B 3IF6C 1ERQA 3AV1A 2V1AA 3IHBA 1XX2A 4FD8A 2F8NG 4DQYB 3V3SA 4N9LA 2NQBA 2HIOB 2W1RA 1BLPA 1H0IA 5AV8A 5AVBA 1W1TA 5AVFA 4MN6A 1M18D 5E2EA 3MGPA 3AZJB 3CI6A 4ZTKA 5FL3A 1YKDA 2WKHA 4H8RA 4KZ9A 1H0GA 1EI5A 3IBJA 5E2HA 3MVDA 3AYWC 1N9OA 3LELD 5B24D 2K2NA 1ES3A 3VH6W 1TS7A 2PT7A 1Q2QA 3AV2C 3HSHA 2XF3A 3MGSC 3MGQD 4DE3A 1P0ZA 2B18A 4IVKA 4CSRA 4JF4A 3HLCA 2KOIA 4FH4A 3AZID 4IJFA 1E4DA 5GT0A 2W3HA 2JE5A 1TEMA 3X1UB 1VB6A 4NY2A 2L1MA 2ZOIA 4EW7A 4UQIS 2VGLS 4G3WA 5AV6B 1YM1A 3B47A 3ITAA 5B1LD 2XD5A 1LSWA 4OLDA 5JRGD 3N3FA 5AV6D 1XGIA 4NEED 4BMWA 4HEFA 1LSVA 1DP6A 4B4ZA 4EO5B 3REIC 4QPRA 2ZM2A 2HGVA 2ZJ9A 3TOIA 5B31B 4IBGA 5A8BA 2V1ZA 4A5RA 5B24C 4OJOA 2H10A 5EVLA 1FR6A 2L0WA 3LO7A 5GLBA 3T4OA 2CV5B 5F99B 3MR0A 3TG9A 3RELA 3B6GC 3RJUA 2VK3A 1KX4C 4H6JB 2G5IC 1OJ5A 3W97B 3UTAC 3QNBA 3OPHA 3KXBD 3AZIA 4CLCB 2W8SA 1DP8A 3H9WA 4K91A 3SOIA 4H9RA 4KG2A 3WX7A 4CLCD 4N1XA 1F66C 4YS3A 1DY6A 1E3UA 4R3AA 4JBFA 5AQ9A 2FJ7D 3NBLA 3LZ0C 5CGXA 4P87A 3UPNA 1JVJA 1F1EA 3P98A 1RGYA 4RX3A 2E8IA 3H7WB 1CK7A 1BH8A 3P01A 4PKYG 1S32A 2IWDA 1P3OA 3UTBB 1PZPA 4PM7A 5B32C 5HD5A 3VSKA 5CGSA 1GA9A 3X1SD 2HIOA 3AZJA 3BQAA 4MEZA 1G6OA 4HJ6A 1GXDA 4H9PB 2IWBA 1F66D 4KQQA 2J80A 4GOGA 1L0EA 4L9GA 2JKRI 4DXBA 3SS4A 1S67L 3MKFA 3DWKA 3AZGA 4WV4B 2W3DA 1AIWA 1BH9B 5B2IB 1WYCA 3IBRA 3NDGA 2OAQ1 3BFEA 3ZG7B 5B2JC 3EEAA 3WAAA 4NZ4A 2R78A 4S2NC 1IEMA 3RTYA 2H28A 4MMNA 4IJEA 5HD3A 4OP5A 4BENA 2HIOC 2BYKA 3W98B 3T4LA 5HW3A 4EETB 4LENA 4WBGA 1OTIA 2LB5A 3MGSA 1XJ2A 3VMAA 3KO6A 3AZFC 3BY9A 4ZRRA 3W96A 1S1ZA 3QP5A 4FTXA 5E2FA 5B0YB 1HVBA 5B33D 4JXSA 3LZ0A 1T19A 5L2FA 3E4OA 5B0YD 3PAGA 1P3MD 4MB5A 2VKSA 3VFFA 3HLFA 3Q07A 1F5MA 1QO6A 2GJ3A 4R8PA 5KSCA 3CUEA 3MGSB 1K6SA 3WS2A 5DTKA 3Q82A 3OLOA 1NWZA 1ALQA 3MGQC 1P3AA 3X1VB 4XZQB 4E3OA 3EQVA 1H3QA 3AZHB 3KSHA 3R45A 5BT1D 1Z09A 4YINA 3S1YA 4I38A 5FQMA 3AZFA 4BD1A 1EROA 2NQBC 1E6ZA 4II7A 1IELA 1MKMA 3TW8A 3VP1A 4OJLA 2OWHA 4N92A 3MKEA 1YLJA 2D49A 1P34A 2HP9A 4ZBJB 1CJFA 3BQ8A 1OPXA 3MGPC 3W99D 1E8BA 4EBPA 2CV5A 1TAFA 4LCLA 4KZBA 3RXXA 4H9NB 5JA4A 3B0DB 1RCJA 1W8YA 3AZIC 4NXEA 4Q0IA 1NZOA 5AJGA 2Y79A 3AZED 1SCWA 4KHAA 1T1CA 3KSFA 4X25A 3D3OA 4J8UC 1S1YA 4GDBA 4I39A 5EVEA 3B0CT 2F8ND 2GZAA 3AZNA 1KE3A 2V0UA 1P3OB 1KX4B 4YM6D 3P7NA 4ZUXB 1ULYA 1BH8B 1TDLA 2NUPC 5HFOA 2F8NB 5HPIA 3E4QA 2XR0A 3W97C 1Z6FA 1Z2CB 4G91C 1P3PA 3MNNC 3FYZA 2OWJA 3KX0X 3O62C 1VQQA 3N7WA 3X1TD 3TJZC 3O62D 1LI0A 3O5YA 4N9KA 5DTSA 4RA7A 3WD2A 4Z2LA 5GT3D 4YM6C 1HTZA 3O88A 5CPIC 1P3FB 2PR5A 5KZHA 2ZY2A 2Y2LA 2WK0A 3UB8A 3KS4A 3VH5A 5F99A 3B0CW 4KUDD 1KX5D 3AZKB 4KUOA 3HUNA 2VEAA 4LPZA 3A0VA 3N4IA 4YNRA 2K7SA 3BYDA 3E98A 3LR0A 5B2JB 4E44A 4OPQA 1KX4A 5DFXA 5DFYA 1XGJA 3WTPE 3TU4A 4Q0JA 5C5KA 4GD6A 1UR9A 3CLOA 3PHYA 1H8PA 3LUQA 1F2KA 4GN2A 1CQAA 1T18A 3EGDC 3Q7ZA 4CLCC 4DE2A 2JHEA 5B1MA 5DNNA 3C1CC 5JA4B 1KE0A 2J3TD 3VP2A 5AV5A 4Q8IA 4C6YA 5F1FA 1NYYA 2O9AA 4X53A 1EWZA 3HJKA 1LLBA 2AROA 3L29A 5FI7A 3LZ1D 2JCHA 2HF6A 3WD3A 4E45A 4J8XD 3AZLA 2Z6CA 3AZHA 1KGGA 2MJ6A 2HV1A 1MBLA 3B6FD 1EQZC 5A92A 1P3GC 3A3DA 5A90A 1RGZA 1O7EA 1DJCA 3AGFA 3T4SA 3KFUG 5CPIA 5FASA 3AZMA 4BQMA 2WGWB 5HWVA 1W8QA 2J3WA 3F1OB 5AVBB 2PRFA 3OC2A 3C4OA 3S7PA 4KZ8A 1P3FC 5GSUC 2V2FF 3CPTA 1KVLA 2HDQA 1YUEA 4HMEA 1H3OB 2M1CA 4JLFA 3ICYA 3E0YA 3MF0A 3AZLC 2Y2KA 3UT9D 2EXAA 1W79A 4GNUA 4WNNB 5GXQC 5FQ9A 1NLYA 4YOFA 3AV2D 3UPPA 2PAVP 4IBJA 1K57C 5AV9D 4XXRA 3OZHA 3C4PA 4Y7PA 4R6LA 3VE4A 1JFIA 5BNVA 1SDNA 3LIAA 3PTEA 3C1BA 5A91A 3C7VA 5TR7A 1F9IA 5GT0C 1XJ4A 2XH9A 4EESA 4WU9A 4AFIA 5FQJA 3A6NC 3NIAA 5B33B 3WS4A 1P3BC 1YU4A 4LGWA 5B31D 4PAUA 3G2YA 4Y2FA 3EGXC 2Y8HA 3LGOA 2ZC7A 3LFVA 3H7WA 1ZLAC 1YMSA 3E4PA 3T1SA 3BRMA 2X71A 2VGJA 5DKKA 1NZUA 3ZFZA 2J9OA 3LEQA 3MNND 4ZAMA 3SW1A 2HDSA 4X68A 4YS3B 1CI9A 2KLIA 3VH6A 4J8WD 3AFAB 3AL0C 5EM1A 1KX3D 3H82A 4WZ5A 1G28A 1B67A 4BD0A 4QJGA 3PBOA 3R4KA 1GHPA 5TGFA 5BNXB 3P09A 5AV6C 5FQQA 3D72A 1EQZD 5B1LC 1EAKA 1N1JA 3W99C 1IYSA 2WZXA 2VX8A 4WYYA 3L26A 3VH5T 4I3JA 4FH2A 5CP6D 3M2JA 1P3AC 2GDNA 3MGPD 4YM6A 3U2AA 4ZUXD 3SS5A 4UA6A 4EERA 5IT5A 1F66B 1H3OA 4BL3A 1W63M 1L3LA 2Z2LB 5BT1C 2QKPA 1P3IC 1M40A 2J3TC 5EV0A 3O62B 2NQBD 1U35A 4D60A 4P6ZM 1STZA 4MNRA 2HUEC 4UA9A 4E3NA 1M1AC 4B4XA 4WU8B 4KGCC 1BUEA 3LR5A 5HAIA 4QHCA 4H9OB 3AN2B 1D1JA 3C1BB 1J9MA 4LFUA 4OKPA 2W3FA 2QJ7A 3MVDC 3LEZA 1ACFA 1YLWA 1ZLAB 4EUVA 5B31C 3G6OA 2CC1A 2OSUA 1E88A 4WMCD 2NZDD 4KENB 3AZGC 4GZBA 2A24B 3WRTA 2PD7A 4NZ1A 1PZOA 1E15A 4C3QA 2ZQ8A 2PBDP 2YFWA 1SKOA 3LIDA 3Q81A 3O87A 2IA2A 3OCNA 4DRTA 5TBMA 5A93A 3HBRA 2Y4AA 5GLAA 1FILA 3G34A 3W96D 4KZ4A 3AZMD 3UE0A 4LD9D 1BYWA 2B5RA 4MCWA 5CHLB 1P3LB 4WZ4A 3NI9A 3W4QA 1FSWA 1ONHA 3HCYA 1N9NA 5AQBA 4GCZA 3WKJB 1VEUB 3NDEA 3AZHD 4EXOA 4JXGA 2WADA 1P3BA 3IXGA 3UT9C 2JKRM 2Y91A 1M1AA 3A6ND 5FATA 3WS0A 3WAAD 5EOEA 1JWVA 3A6NB 2ZC3B 1P3FA 1P3PC 3UDFA 4E6XA 3FKWA 3BFCA 4BBVA 2WKRA 4H6JA 3LR4A 1K54A 5FA7A 4P0MA 5GHZA 3EPHA 5CPKB 3B6GA 1VHMA 4O8GA 3MZFA 4LV2A 3VFHA 1U35B 4K08A 3VSLA 3A3FA 4ME4A 3IS2A 1M18B 2ZM8A 2WKQA 3FZCA 5C3IC 3AN2C 1FCNA 2Q0OA 2VZWA 1P3OD 1KX4D 2ACGA 1PWCA 2WAFA 3KWQA 3ZGAB 4JXVA 4B88A 1DP9A 3UE6A 5KDMA 1W63Q 3OPPA 4KHAB 4OOLA 4X69A 4DDSA 5AVCC 2W3EA
chains in the Genus database with same CATH topology
4JJNB 2ZQAA 1L0GA 2LY8A 4QD4A 3FV7A 2VQRA 5CPJD 1P3OC 4QLCB 3ITBA 2WYXA 5CRFA 2P9VB 3REID 4OOMA 3P5JB 2WKEA 2FFYA 4EQIA 5GHXA 4HGAB 3DWZA 3TSGA 1RP5A 2IO5C 4P85A 3AFAA 1YLZA 5FUGA 1YU2A 5CP6C 5JRGB 1C3BA 4Y0OA 4Z66B 2Y2IA 4N1HA 4OPRA 1DJBA 2XD1A 3IXHA 3AZND 5KMWA 1W2EA 2DF4C 1P3GA 2DNSA 1HQ3A 4S2MA 3MGRD 3KXBB 4WU9B 3VOYA 1U60A 1MPLA 3FKVA 5B40B 5B32B 4NE3A 2A49A 3MGQA 2G2WA 4KUDC 4JPMA 4K0WA 3KWQB 4S2IA 1ID3A 2ZY3A 1BH9A 5B2IA 4WEKA 3MZDA 3V9RB 2WGIA 1L0DA 3B3XA 3KS8A 5CPKA 2WGWA 4XUJA 5E5AB 2Y59A 1XKZA 2NZDA 4NZ3A 5E5AD 3L25A 5J8XA 2ZC6B 5EOOA 2C6WB 5JYOA 3ZG5A 4H9OA 5B2ID 5JRGC 4WJ3C 4UUZB 1XP4A 4OH0A 4L0LA 3PBRA 5GLCA 4H9RB 2QZ6A 1BSGA 4R3JA 3HLDA 3W97A 4DRAA 4OQIA 2R9WA 1P3KB 3REJD 4R4RA 5CGWA 3UPOA 4KZ3A 1ID3C 5B1LB 5U47A 1P3GD 2IWCA 2G2UA 2Y2PA 3VH6T 1P34C 3MXRA 4DDYA 3N8RA 3LY3A 3UTBA 1GHMA 1NXYA 1K6RA 5FAQA 4Z2MH 3WA9D 4J8VA 4Y0TA 4WEJA 1YT4A 3NQUB 1EQZA 2EX6A 3KXBA 4IBIA 1HZOA 4S2JA 3ZNTA 2BLSA 1YQSA 1MKIA 3BECA 4M6BA 1YU0A 4PM5A 3UN7A 4IBRA 2JBFA 2Y55A 3UDIA 3RELB 1MY8A 3UE1A 1ES5A 4LV0A 2Y2JA 3MVDB 2RVQC 5GXQB 4J8VC 4HBTA 3GSGA 5B0ZA 2H0YA 3MGPB 2RIQA 3X1SB 3AFAC 3AZHC 4X23B 2ZM5A 1TZYC 3A3EA 4H9QB 2ZLYA 2NQBB 4ZBEA 1ZG4A 1M19A 2BYMA 1K25A 5GSUA 5CPJB 3H0RC 3X1UA 1FCMA 2RVQD 3VP3A 3AZKD 3M2KA 4LV1A 1BLCA 2Y2HA 3E2KA 4S2KA 3AZFB 3GMWA 3IF6B 3AZEC 1KGEA 1NJ4A 3REJA 3BFFA 5B33A 4MBHA 3W96B 3G2ZA 4PM6A 2X02A 3M6HA 5KSHA 5F82A 2BYKB 3HLWA 3MGSD 3IF5A 1JTGA 1M1AD 4LD9B 3L27A 4OPYA 5FDHA 1ID3B 4IBKA 3MFDA 1M1AB 3W98A 1ID3D 1IYPA 2HP6A 2AROD 1FR1A 3AZGB 4J8XB 1I2WA 5AV5B 5BOHA 3WWXA 5AV5D 5CPKD 2AROC 4JF6A 4X6TA 1M19D 3LJAD 5AY8C 2WUQA 5GLDA 4H9PA 3WS1A 3NQJA 1E25A 1MWUA 3W4PA 4NETA 2YFVA 3WKJC 2HPBA 3AZKA 1JWPA 4P6BA 4OQ0A 3UT9B 4H9SA 4NK3A 3X1TC 4QLCD 1K54C 3C5AA 4NYUA 3GRJA 5G49B 3PBNA 2OLUA 3ZCZA 3BLSA 3MGRA 1W5DA 1GCEA 4XUZA 5G18A 3X1UD 3UTBC 5GT3A 3AYWA 2ZC4B 1PI4A 3REIB 3G32A 5CECA 3REKA 3A1IA 5CPJA 4QNLA 4ZUXA 1H5XA 4KQRA 3AZNB 3H0MC 5CP6A 5CHUA 2XFSA 1KGFA 5B0ZD 5AV6A 5B0ZB 5F99D 4JJNC 2ZMAA 3N8SA 5DNMC 4E3IA 3B6GB 5M18A 4NE5A 1ONGA 4E3MA 3MNNB 1WWSA 1BFMA 3MGRB 5HL1A 3IH9A 3NCKA 1I2SA 4J8VD 3AYWB 1PIOA 5AY8B 2CV5C 1P3MC 4R8PC 4GHLA 1EQZB 1U35C 4E3JA 3KWQD 5B33C 2PYOC 1O07A 4MBKA 1P3BB 1LHYA 1P3KC 2YFVB 3B6FB 2FJ7B 2F8NA 4S2NA 3N8LA 2H0TA 3V39A 4WU8C 4KGCB 5B40C 5E5AA 1K4EA 2PYOD 4J8XC 4XZQC 2FFFB 2YFWB 3CJMA 3LJAA 4R8PD 2R9XA 1PZRA 3D4FA 4BL2A 1IYOA 3WS5A 3GQZA 3V5MA 1JFIB 5DNMB 3AV1B 3AN2D 4OJ5A 5DNMD 2DQNC 2XDMA 4UAAA 1S32C 3BM6A 4D2OA 2C5WB 3W98D 4ZJ2A 3X1VA 4G92B 3AN2A 4UUZA 3UNWA 4CJNA 2IO5B 1I5QA 1JWZA 4OQGA 4EBNA 4OJPA 1P3MA 3VP4A 5F83A 5I94A 4IVIA 3LZ0D 5JYPA 5FQIA 5FAOA 5AVCA 3REJB 3REHA 2FJ7C 1XA1A 2V20A 3LZ0B 3KUYC 4KGCA 4OONA 1KDSA 5FI6A 2PYOA 5B1MD 5DNND 3GV9A 5BS7C 5EVIB 1TZYB 4GKUA 1R4VA 4FCFA 1F66A 1BTLA 1P3MB 4DKIA 3UTAD 1XXMA 5E5AC 2EX9A 4R3BA 4DE1A 5CHMA 4U0XA 4OOYA 1AXBA 5AV8C 5AY8A 3NY4A 1N1JB 1ESIA 3RELC 4Z5TC 4YS3D 3ZVWA 3Q1FA 3WKJD 4J8WB 5E43A 1G68A 3AZGD 1HQ3D 4J8UB 4GD8A 5GSUB 4U0TA 4CAYA 3WTPC 2XEPA 5B1MC 5DNNC 1S0WA 2Z2MB 2Y2GA 3W99B 4IBFA 5E2GA 1QMFA 1M19B 3GVBA 3TU4D 3ISGA 3TU4B 4OPZA 2F8NH 1P3LC 3AZJC 4F94A 2DRWA 3REIA 3OPLA 2J8PA 2J8YA 4WZ5C 1KU5A 5GT3B 1MXOA 4S2LA 5JRGA 3X1TB 4PM9A 3REKC 3AGDA 3V3RA 2IOUA 4X56A 5HAPA 4JKTA 5AV5C 3A3JA 3IQAA 3MZEA 4X23C 3NQUA 4QLCA 3KSYA 1KE4A 1GA0A 1KDWA 3WA9A 2EX2A 3IP4C 4KZ5A 3OPRA 3IHAA 3JYIA 3Q7VA 3AZFD 4ZDXA 3C7UA 3ZHHA 1K4FA 3CG5A 5FSRA 2EX8A 1NRFA 3B0BA 4J8WC 4JF5A 1H8YA 2PU4A 4IBEA 4O7DA 1P3KA 5AVCD 3AGEA 2CV5D 4ZJ1A 1Q2PA 3BFDA 3QNCA 4EUZA 4Z5TD 5CEDA 3HL9A 2ZC5B 1CEFA 2WAEA 4OLGA 3PBTA 4CAYB 4DE0A 3UDXA 5CPIB 4LCMA 1N9BA 2WKIA 4G91B 1ESUA 4WELA 5CXWA 1P3BD 4XZQA 3HONA 5BS7A 1SKFA 1BT5A 3IXDA 4QY6A 2X01A 1BZAA 5EVIA 1YLPA 1AOIC 1ERMA 1PWDA 5DF8A 4XUJD 4OVDA 4XUJB 5AV9C 2WZZA 5FQKA 2J9PA 4R0QA 4NE6A 4E6WA 1FQGA 3KXBC 4PPRA 2ZQDA 4WMCA 3NC8A 2Y2OA 2XK1A 5B2JA 1ES2A 5B24B 3MGQB 1VM1A 5B32A 4H9SC 5BNXA 1AOIA 3UO9A 4AWLB 1YMXA 2CWEA 5D3OA 5CERA 5CTNA 3LJAC 2P74A 3EPKA 3L2AA 4Z5TA 4X55A 1BULA 3REJC 1P3KD 5BPVA 3S4XA 1P3GB 4Z66D 5GXQA 2ZQ7A 4NYYA 5CHJA 3O62A 3WA9C 1M6KA 1T3UA 1XA7A 3IF6A 1IYQA 4K0XA 3A1KA 5C3IB 3C1CD 3OCLA 3C1BC 3UY6A 2P9VA 4PM8A 3G35A 3LELC 1KX3A 2HDUA 3AYWD 2ZM0A 4H9NA 4WU9D 2XLNA 4HESA 1M18C 1P34B 3MNNA 4J8VB 5HARA 1YLYA 4J8WA 4RYEA 1P3PD 4PMAA 2UWXA 3WRZA 3PAEA 4DF6A 5BO0B 3WAAC 3UTBD 4KZ6A 2ZQCA 4HGAC 1P3AB 5DF9A 4IEDA 5B2IC 5CP6B 3LELA 1KX3C 3QHYA 4R8PB 4QLCC 1HQ3C 2PYOB 4E3LA 3REKB 1M18A 1S6RA 5AV8D 3EPJA 3FKEA 4NZ5A 4R23A 5HX9A 1K55C 3C1BD 3AV2A 1CEGA 3WKJA 3A6NA 4UPKA 3KUYB 5FAPA 4KUDB 3I7JA 4KG5A 4R1GA 3KUYD 3ZVTA 1AOIB 3HVFA 5CPKC 4U3TA 4LG2A 3G4PA 4GDNA 1SDEA 2NZDB 1P3IA 5AVBC 2Q9MA 3G31A 3UTAA 1FOFA 1LI9A 4IBCA 3ZDJA 4OQHA 3B0DC 2QMIA 4WU9C 5B1MB 5DNNB 1K57A 1QMEA 1L0FA 3AV1C 2OV5A 5EVID 1CK3A 3BFGA 4ZBJC 1P3LD 1ZLAA 2ZY5A 3IH8A 3HLGA 4J8XA 3AZLD 4OP8A 1HD8A 1K38A 1IKGA 1NYMA 4CPKA 3X1VD 4XZQD 4E3KA 3WA9B 4FSFA 5EUAA 3CMZA 5EVIC 4MLLA 2XFTA 4KUDA 1W7FA 4UHUA 1HQ3B 2QPNA 3HUMA 3H0LC 3ZNYA 4EV4A 1ES4A 5EPHA 2HIOD 3B6FC 4WU8A 1U35D 5GHYA 2EXBA 4M3KA 4EWFA 3SS3A 2BG1A 4XUXA 3RELD 3EG5B 4KZAA 1YU3A 3M6BA 1KX5A 3LELB 5AQAA 4RVAA 3LCEA 3S22A 1E3UD 1BLSA 5CEBA 2WGVA 5B40A 4JJND 2DCFA 4JJNA 2Y2NA 2BYMB 3N6IA 5G49A 5KDMB 4H9QA 4X23A 2J7VA 1KX5B 5B31G 5F1GA 3SH9A 3X1TA 5FI2A 3MXSA 1DJAA 4R4SA 3AZEA 2XQZA 1CI8A 1TVFA 2EFUA 4QU3A 2G5HC 4Z5TB 5GT3C 4WZSB 1IKIA 1MWTA 3VP0A 3HREA 3B6GD 5AVCB 3X1VC 5B0YA 2JC7A 3W97D 2XGNA 5B40D 4OUIA 2ZY4A 1TAFB 1P34D 3HLBA 1GHIA 1M19C 2NZDC 3LZ1B 4Y0UA 2HP5A 4DRBA 5B24A 3EPLA 5AY8D 1WE4A 3V50A 3W4OA 2JSSA 4IBBA 3AZNC 2ZQ9A 3KWQC 3W8KA 4Z66C 1P3AD 4LD9A 4MBFA 5CTMA 2Y2QA 1Y54A 5AVBD 4WNNA 2PBYA 4DXCA 1PI5A 4G92C 4GHAA 3ZG0A 1N4OA 1K55A 3GR2A 1PYYA 3FDDA 4KGCD 3LJAB 3IT9A 1TZYA 3WTPA 1P3IB 4YFMA 3ZG8B 3AZJD 1P3ID 1A7WA 5IHVA 3HUOA 4QY5A 2RCXA 3O86A 5AQ7A 3KUYA 4ZUXC 3B6FA 3AV2B 5B0YC 4RX2A 1WYBA 5AV9B 1KVMA 4S2OA 4ZJ3A 1P3LA 1ZLAD 1OMEA 2Q9NA 3AZIB 3WTPD 3X1UC 1PWGA 4XUJC 2EFXA 2PU2A 3WTPB 5DVAA 3PBQA 1LL9A 1PW1A 1WWIA 3BLMA 1ZKJA 3FWLA 4JXWA 1TDGA 4Z9QA 3PBSA 3AZKC 4IBXA 4WM9A 3X1SA 4AWLC 3UTAB 3Q7VB 3IWOA 1ZC2A 3C1CB 3SH8A 5M19A 4KQOA 1K56D 2F8NK 1S32D 1YU1A 2A3UA 3RXWA 1PW8A 1S32B 3UE3A 3AFAD 1MWSA 3MGRC 5HAQA 3REHC 2FJ7A 4Z2MG 1H8ZA 1JTDA 3IXBA 5EECA 1MWRA 1NY0A 4J8UD 3DW0A 3AZMC 5GT0B 3VH5W 1KX3B 5TFQA 3G30A 5GT0D 4BLMA 5GL9A 3BEBA 1FSYA 5GSUD 1P3PB 3W98C 2RL3A 3MBZA 4KG6A 3HLEA 4QB8A 2HDRA 3F6TA 1B6WA 4EBLA 3AZEB 4YM6B 3L28A 3C1CA 1Q9CA 2L5AA 3NQJB 5CPJC 1L2SA 4GB7A 4BJPA 3MVDD 4KZ7A 4NFTA 5GXQD 4Z66A 4X23D 5B31A 4IBDA 1LL5A 3E2LA 5B1LA 3LY4A 5BO0A 5AV8B 5FUGB 5EE8A 3REKD 1G6AA 3LZ1C 5BNVB 4J8UA 1P3FD 4UA7A 3IWIA 3W99A 4WU8D 1ZG6A 4LV3A 3AV1D 2VGKA 5F99C 3R45B 3IWQA 1K56A 5AV9A 2H5SA 4CSRB 5B0ZC 3DTMA 1FCOA 1AOID 1HTAA 3CZDA 4C75A 2I72A 3TU4C 5DF7A 4S2PA 3UT9A 4GH9A 1BLHA 5B2JD 3SH7A 3REHB 2HUEB 4OJ6A 1XPBA 3REHD 3GTCA 1SHVA 3AZMB 2F2AC 2ZD8A 2OLVA 3A3IA 1TZYD 5M1AA 5B32G 5CPID 4YS3C 3V9RA 3X1SC 3O3VA 3AZLB 4LD9C 4ID4A 2Y2MA 4HBUA 1YLTA 3W96C 5B32D 4EO5C 3VOZA 3EQUA 3WAAB 2AROB 5DNMA 5DTTA 3LZ1A 1KX5C 3ZG9B 3IF6C 1ERQA 3AV1A 3IHBA 1XX2A 4FD8A 2F8NG 4DQYB 3V3SA 4N9LA 2NQBA 2HIOB 1BLPA 5AV8A 5AVBA 1M18D 5E2EA 3MGPA 3AZJB 4ZTKA 2WKHA 4H8RA 4KZ9A 5E2HA 1EI5A 3MVDA 3AYWC 3LELD 5B24D 1ES3A 3VH6W 1Q2QA 3AV2C 3HSHA 2XF3A 3MGSC 3MGQD 4DE3A 4IVKA 4CSRA 4JF4A 3HLCA 4FH4A 3AZID 4IJFA 1E4DA 5GT0A 2JE5A 1TEMA 3X1UB 4NY2A 5AV6B 1YM1A 3ITAA 5B1LD 2XD5A 4OLDA 5JRGD 3N3FA 5AV6D 1XGIA 4HEFA 4B4ZA 4EO5B 3REIC 2ZM2A 2ZJ9A 3TOIA 5B31B 4IBGA 2V1ZA 4A5RA 5B24C 4OJOA 2H10A 5EVLA 1FR6A 3LO7A 5GLBA 2CV5B 5F99B 3TG9A 3RELA 3B6GC 3RJUA 1KX4C 2G5IC 3W97B 3UTAC 3QNBA 3OPHA 3KXBD 3AZIA 2W8SA 4K91A 3SOIA 4H9RA 4KG2A 3WX7A 4N1XA 1F66C 4YS3A 1DY6A 1E3UA 4JBFA 5AQ9A 2FJ7D 3NBLA 3LZ0C 5CGXA 4P87A 3UPNA 1JVJA 1F1EA 3P98A 1RGYA 4RX3A 2E8IA 1BH8A 1S32A 1P3OA 2IWDA 3UTBB 1PZPA 4PM7A 5B32C 3VSKA 5CGSA 1GA9A 3X1SD 2HIOA 3AZJA 4MEZA 4H9PB 2IWBA 1F66D 4KQQA 4GOGA 1L0EA 4DXBA 3SS4A 3MKFA 3DWKA 3AZGA 4WV4B 1BH9B 5B2IB 1WYCA 3NDGA 3BFEA 3ZG7B 5B2JC 3WAAA 4NZ4A 4S2NC 1IEMA 4IJEA 4OP5A 4BENA 2HIOC 2BYKA 3W98B 5HW3A 4LENA 4WBGA 3MGSA 3VMAA 3AZFC 3W96A 5E2FA 5B0YB 1HVBA 5B33D 4JXSA 3LZ0A 5L2FA 5B0YD 3PAGA 1P3MD 3VFFA 3HLFA 3Q07A 4R8PA 5KSCA 3MGSB 1K6SA 3WS2A 5DTKA 3Q82A 1ALQA 3MGQC 1P3AA 3X1VB 4XZQB 4E3OA 3EQVA 3AZHB 3R45A 5BT1D 4YINA 3S1YA 5FQMA 3AZFA 4BD1A 1EROA 2NQBC 1IELA 3VP1A 4OJLA 4N92A 3MKEA 1YLJA 1P34A 2HP9A 4ZBJB 3MGPC 3W99D 4EBPA 2CV5A 1TAFA 4LCLA 4KZBA 3RXXA 4H9NB 5JA4A 3B0DB 1RCJA 1W8YA 3AZIC 1NZOA 3AZED 1SCWA 4KHAA 4J8UC 4GDBA 3B0CT 2F8ND 3AZNA 1KE3A 1P3OB 1KX4B 4YM6D 4ZUXB 1ULYA 1BH8B 1TDLA 5HFOA 2F8NB 2XR0A 3W97C 1Z6FA 1Z2CB 4G91C 1P3PA 3MNNC 3FYZA 3O62C 1VQQA 3N7WA 3X1TD 3O62D 1LI0A 4N9KA 5DTSA 4RA7A 5GT3D 4YM6C 1HTZA 3O88A 5CPIC 1P3FB 5KZHA 2ZY2A 2Y2LA 2WK0A 3KS4A 3VH5A 5F99A 3B0CW 4KUDD 1KX5D 3AZKB 3HUNA 3N4IA 3BYDA 5B2JB 4E44A 4OPQA 1KX4A 1XGJA 3WTPE 3TU4A 4GD6A 4GN2A 3Q7ZA 4DE2A 5B1MA 5DNNA 3C1CC 5JA4B 1KE0A 3VP2A 5AV5A 4Q8IA 4C6YA 5F1FA 1NYYA 4X53A 1EWZA 1LLBA 2AROA 3L29A 5FI7A 3LZ1D 2JCHA 4E45A 4J8XD 3AZLA 3AZHA 1KGGA 1MBLA 3B6FD 1EQZC 5A92A 1P3GC 3A3DA 5A90A 1RGZA 1O7EA 1DJCA 3AGFA 3KFUG 5CPIA 5FASA 3AZMA 4BQMA 2WGWB 1W8QA 5AVBB 3OC2A 3C4OA 4KZ8A 1P3FC 5GSUC 2V2FF 1KVLA 2HDQA 1YUEA 1H3OB 4JLFA 3AZLC 2Y2KA 3UT9D 2EXAA 1W79A 4GNUA 4WNNB 5GXQC 5FQ9A 3AV2D 3UPPA 4IBJA 1K57C 5AV9D 4XXRA 3OZHA 3C4PA 4Y7PA 1JFIA 5BNVA 1SDNA 3PTEA 3C1BA 5A91A 3C7VA 5TR7A 5GT0C 2XH9A 4WU9A 5FQJA 3A6NC 3NIAA 5B33B 3WS4A 1P3BC 1YU4A 5B31D 3G2YA 2ZC7A 1ZLAC 1YMSA 3BRMA 2X71A 2VGJA 1NZUA 3ZFZA 2J9OA 3MNND 4ZAMA 2HDSA 4X68A 4YS3B 1CI9A 3VH6A 4J8WD 3AFAB 3AL0C 1KX3D 4WZ5A 1B67A 4BD0A 4QJGA 3PBOA 1GHPA 5TGFA 5BNXB 3P09A 5AV6C 5FQQA 1EQZD 5B1LC 1N1JA 3W99C 1IYSA 2WZXA 4WYYA 3L26A 3VH5T 4FH2A 5CP6D 3M2JA 1P3AC 2GDNA 3MGPD 4YM6A 4ZUXD 3SS5A 4UA6A 1F66B 1H3OA 4BL3A 2Z2LB 5BT1C 1P3IC 1M40A 3O62B 2NQBD 1U35A 4MNRA 2HUEC 4UA9A 4E3NA 1M1AC 4B4XA 4WU8B 4KGCC 1BUEA 5HAIA 4QHCA 4H9OB 3AN2B 3C1BB 1J9MA 4OKPA 3MVDC 3LEZA 1YLWA 1ZLAB 5B31C 2CC1A 2OSUA 4WMCD 2NZDD 4KENB 3AZGC 4GZBA 3WRTA 4NZ1A 1PZOA 4C3QA 2ZQ8A 2YFWA 3Q81A 3O87A 3OCNA 4DRTA 5A93A 3HBRA 2Y4AA 5GLAA 3G34A 3W96D 4KZ4A 3AZMD 3UE0A 4LD9D 2B5RA 5CHLB 1P3LB 4WZ4A 3NI9A 3W4QA 1FSWA 1ONHA 5AQBA 3WKJB 3NDEA 3AZHD 4JXGA 2WADA 1P3BA 3IXGA 3UT9C 2Y91A 1M1AA 3A6ND 5FATA 3WS0A 3WAAD 5EOEA 1JWVA 3A6NB 2ZC3B 1P3FA 1P3PC 3UDFA 4E6XA 3FKWA 3BFCA 1K54A 5FA7A 4P0MA 5GHZA 3EPHA 5CPKB 3B6GA 3MZFA 4LV2A 3VFHA 1U35B 3VSLA 3A3FA 1M18B 2ZM8A 3FZCA 5C3IC 3AN2C 1FCNA 1P3OD 1KX4D 1PWCA 2WAFA 3KWQA 3ZGAB 4JXVA 4B88A 5KDMA 3OPPA 4KHAB 4OOLA 4X69A 4DDSA 5AVCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYC A;  3WS5 A;  3GQZ A;  2ZQA A;  3NDG A;  3V5M A;  1L0G A;  2WGV A;  3BFE A;  4QD4 A;  3FV7 A;  3ZG7 B;  2XDM A;  4UAA A;  3ITB A;  4S2N C;  2WYX A;  1IEM A;  5CRF A;  3BM6 A;  2DCF A;  4D2O A;  2P9V B;  2C5W B;  2Y2N A;  4ZJ2 A;  4OOM A;  3N6I A;  4OP5 A;  4BEN A;  2WKE A;  2FFY A;  4EQI A;  5GHX A;  3DWZ A;  3TSG A;  1RP5 A;  5HW3 A;  4P85 A;  4LEN A;  4WBG A;  1YLZ A;  3UNW A;  4CJN A;  1I5Q A;  1JWZ A;  2J7V A;  4OQG A;  3VMA A;  4EBN A;  5F1G A;  3SH9 A;  3VP4 A;  5F83 A;  1C3B A;  4Y0O A;  5I94 A;  5FI2 A;  4IVI A;  5JYP A;  3MXS A;  2Y2I A;  1DJA A;  4R4S A;  5E2F A;  1HVB A;  5FQI A;  5FAO A;  4N1H A;  1XA1 A;  4OPR A;  4JXS A;  2V20 A;  2XQZ A;  1DJB A;  5L2F A;  4OON A;  2XD1 A;  1CI8 A;  1TVF A;  3IXH A;  1KDS A;  5FI6 A;  3PAG A;  5KMW A;  3VFF A;  2EFU A;  3GV9 A;  3HLF A;  3Q07 A;  4QU3 A;  5EVI B;  4GKU A;  3VP0 A;  1MWT A;  1IKI A;  4FCF A;  1BTL A;  5KSC A;  3HRE A;  1K6S A;  4DKI A;  3WS2 A;  1XXM A;  3Q82 A;  5DTK A;  2EX9 A;  1ALQ A;  2DNS A;  4R3B A;  4DE1 A;  2JC7 A;  4S2M A;  5CHM A;  4U0X A;  4OOY A;  1AXB A;  4E3O A;  3EQV A;  2XGN A;  3NY4 A;  4YIN A;  3S1Y A;  1ESI A;  5FQM A;  3VOY A;  4BD1 A;  1U60 A;  1ERO A;  1IEL A;  3ZVW A;  3HLB A;  1GHI A;  1MPL A;  3FKV A;  3Q1F A;  3VP1 A;  5E43 A;  1G68 A;  2A49 A;  4N92 A;  4Y0U A;  3MKE A;  2HP5 A;  4GD8 A;  1YLJ A;  4U0T A;  2HP9 A;  2XEP A;  4EBP A;  1WE4 A;  3V50 A;  2G2W A;  3W4O A;  4LCL A;  3RXX A;  4KZB A;  2ZQ9 A;  3W8K A;  1RCJ A;  1S0W A;  2Y2G A;  2Z2M B;  4JPM A;  4K0W A;  4S2I A;  1W8Y A;  5E2G A;  1QMF A;  1NZO A;  4WEK A;  4MBF A;  5CTM A;  2Y2Q A;  1Y54 A;  3MZD A;  2PBY A;  4DXC A;  3GVB A;  1PI5 A;  1SCW A;  2WGI A;  1L0D A;  3ZG0 A;  3ISG A;  1N4O A;  4GDB A;  1K55 A;  3B3X A;  1PYY A;  3GR2 A;  1KE3 A;  3IT9 A;  2WGW A;  1TDL A;  5HFO A;  4OPZ A;  2XR0 A;  1Z6F A;  2Y59 A;  1XKZ A;  4YFM A;  3ZG8 B;  4F94 A;  2DRW A;  3FYZ A;  3N7W A;  1VQQ A;  3OPL A;  2J8Y A;  5J8X A;  4WZ5 C;  1MXO A;  1LI0 A;  4S2L A;  5IHV A;  4N9K A;  2ZC6 B;  5DTS A;  4RA7 A;  3HUO A;  5EOO A;  4QY5 A;  2RCX A;  3O86 A;  5AQ7 A;  2C6W B;  4PM9 A;  5JYO A;  3ZG5 A;  1HTZ A;  3O88 A;  4RX2 A;  1WYB A;  5KZH A;  3AGD A;  3V3R A;  1XP4 A;  4OH0 A;  4X56 A;  1KVM A;  4S2O A;  5HAP A;  4L0L A;  2Y2L A;  2WK0 A;  4JKT A;  4ZJ3 A;  3PBR A;  5GLC A;  3A3J A;  3IQA A;  3MZE A;  1OME A;  2QZ6 A;  1KE4 A;  2Q9N A;  1BSG A;  1GA0 A;  4R3J A;  3HLD A;  1KDW A;  2EX2 A;  3HUN A;  4KZ5 A;  4OQI A;  3N4I A;  1PWG A;  2R9W A;  3IHA A;  3OPR A;  3JYI A;  2EFX A;  3BYD A;  2PU2 A;  3Q7V A;  5DVA A;  3C7U A;  3PBQ A;  1LL9 A;  4R4R A;  3ZHH A;  4ZDX A;  4OPQ A;  1K4F A;  3CG5 A;  1XGJ A;  1PW1 A;  2EX8 A;  5FSR A;  3BLM A;  5CGW A;  1ZKJ A;  3FWL A;  1NRF A;  4JXW A;  1TDG A;  4KZ3 A;  3UPO A;  4Z9Q A;  3PBS A;  4GD6 A;  5U47 A;  4IBX A;  4WM9 A;  2IWC A;  2G2U A;  4JF5 A;  2Y2P A;  1H8Y A;  2PU4 A;  4O7D A;  3Q7V B;  3IWO A;  4GN2 A;  1ZC2 A;  3AGE A;  3Q7Z A;  4ZJ1 A;  3MXR A;  1Q2P A;  4DE2 A;  3SH8 A;  4DDY A;  3BFD A;  3QNC A;  1K56 D;  4KQO A;  4EUZ A;  3N8R A;  5M19 A;  1KE0 A;  2A3U A;  3RXW A;  3LY3 A;  3VP2 A;  4Q8I A;  3HL9 A;  1PW8 A;  2ZC5 B;  1CEF A;  2WAE A;  4C6Y A;  4OLG A;  5CED A;  1GHM A;  1NXY A;  1K6R A;  3PBT A;  5FAQ A;  3UE3 A;  5F1F A;  1MWS A;  1NYY A;  4DE0 A;  3UDX A;  5HAQ A;  4X53 A;  4LCM A;  1EWZ A;  1N9B A;  1H8Z A;  1JTD A;  1LLB A;  3IXB A;  4Y0T A;  5EEC A;  5FI7 A;  1MWR A;  4WEJ A;  2WKI A;  1NY0 A;  1ESU A;  1YT4 A;  2JCH A;  3DW0 A;  2EX6 A;  4WEL A;  5CXW A;  5TFQ A;  1KGG A;  3G30 A;  1HZO A;  1MBL A;  4BLM A;  5GL9 A;  3BEB A;  4S2J A;  3ZNT A;  1FSY A;  2BLS A;  3A3D A;  5A92 A;  5A90 A;  1YQS A;  1RGZ A;  1O7E A;  1BT5 A;  1SKF A;  1MKI A;  3BEC A;  3IXD A;  4QY6 A;  1DJC A;  3AGF A;  2X01 A;  4PM5 A;  3UN7 A;  1BZA A;  2RL3 A;  4IBR A;  5FAS A;  3MBZ A;  2JBF A;  4KG6 A;  3HLE A;  2Y55 A;  5EVI A;  3UDI A;  1YLP A;  4BQM A;  2WGW B;  1MY8 A;  1W8Q A;  1ERM A;  1PWD A;  4QB8 A;  5DF8 A;  2HDR A;  3UE1 A;  1ES5 A;  2Y2J A;  4LV0 A;  4EBL A;  4HBT A;  3OC2 A;  3C4O A;  3GSG A;  4KZ8 A;  4OVD A;  2H0Y A;  1L2S A;  4GB7 A;  4BJP A;  2WZZ A;  4KZ7 A;  5FQK A;  2V2F F;  2J9P A;  1KVL A;  4R0Q A;  2HDQ A;  4E6W A;  1LL5 A;  4JLF A;  3E2L A;  1FQG A;  3LY4 A;  3A3E A;  2Y2K A;  4PPR A;  2ZQD A;  5EE8 A;  4WMC A;  1G6A A;  2EXA A;  2ZLY A;  2Y2O A;  3NC8 A;  1W79 A;  2XK1 A;  4ZBE A;  4GNU A;  1ZG4 A;  5FQ9 A;  1ES2 A;  1K25 A;  3UPP A;  1VM1 A;  4UA7 A;  1K57 C;  3IWI A;  4XXR A;  3OZH A;  3C4P A;  1FCM A;  1ZG6 A;  4LV3 A;  4Y7P A;  2VGK A;  3UO9 A;  1SDN A;  3VP3 A;  3M2K A;  3PTE A;  5A91 A;  1YMX A;  3C7V A;  4LV1 A;  3IWQ A;  1K56 A;  1BLC A;  2H5S A;  5D3O A;  3DTM A;  2Y2H A;  1FCO A;  3E2K A;  5CER A;  5TR7 A;  4S2K A;  5CTN A;  3GMW A;  2P74 A;  2XH9 A;  3CZD A;  4C75 A;  2I72 A;  3IF6 B;  5DF7 A;  4X55 A;  4S2P A;  5FQJ A;  3NIA A;  1BUL A;  3WS4 A;  1KGE A;  1BLH A;  3S4X A;  3SH7 A;  2ZQ7 A;  1NJ4 A;  5CHJ A;  3G2Y A;  1M6K A;  2ZC7 A;  3BFF A;  1XPB A;  3GTC A;  1XA7 A;  4MBH A;  1SHV A;  1YMS A;  3IF6 A;  3G2Z A;  1IYQ A;  3BRM A;  2ZD8 A;  2X71 A;  2OLV A;  2VGJ A;  3A3I A;  4K0X A;  4PM6 A;  5M1A A;  2X02 A;  3M6H A;  5KSH A;  1NZU A;  5F82 A;  3ZFZ A;  2J9O A;  3HLW A;  3OCL A;  4ZAM A;  2HDS A;  1JTG A;  3IF5 A;  4X68 A;  3O3V A;  1CI9 A;  2P9V A;  4OPY A;  3G35 A;  4PM8 A;  2HDU A;  5FDH A;  3UY6 A;  3MFD A;  4ID4 A;  2Y2M A;  4HBU A;  2ZM0 A;  1YLT A;  3VOZ A;  3EQU A;  4WZ5 A;  1IYP A;  2XLN A;  4HES A;  4BD0 A;  2HP6 A;  4QJG A;  5HAR A;  5DTT A;  3PBO A;  1FR1 A;  1GHP A;  1YLY A;  5TGF A;  3P09 A;  4RYE A;  4PMA A;  1I2W A;  5FQQ A;  2UWX A;  5CEB A;  3ZG9 B;  3IF6 C;  3PAE A;  3WRZ A;  4DF6 A;  1ERQ A;  5BOH A;  3WWX A;  1IYS A;  1XX2 A;  2WZX A;  3IHB A;  4FD8 A;  3V3S A;  4WYY A;  4KZ6 A;  2ZQC A;  4N9L A;  4JF6 A;  4FH2 A;  5DF9 A;  4X6T A;  3M2J A;  1BLP A;  4IED A;  2GDN A;  3SS5 A;  4UA6 A;  2WUQ A;  5GLD A;  3QHY A;  4BL3 A;  5E2E A;  2Z2L B;  3WS1 A;  4E3L A;  1M40 A;  4ZTK A;  1E25 A;  1MWU A;  2WKH A;  4H8R A;  4KZ9 A;  5E2H A;  1EI5 A;  3W4P A;  4NET A;  1S6R A;  2HPB A;  4MNR A;  1ES3 A;  1JWP A;  4P6B A;  4UA9 A;  4OQ0 A;  4E3N A;  4B4X A;  1BUE A;  4NK3 A;  1Q2Q A;  4R23 A;  5HX9 A;  1K55 C;  5HAI A;  1K54 C;  2XF3 A;  4DE3 A;  4QHC A;  4IVK A;  3C5A A;  3GRJ A;  4JF4 A;  1CEG A;  3PBN A;  3HLC A;  2OLU A;  3ZCZ A;  5FAP A;  3BLS A;  4FH4 A;  1J9M A;  1W5D A;  1GCE A;  4XUZ A;  3I7J A;  4KG5 A;  4OKP A;  1E4D A;  4R1G A;  5G18 A;  3ZVT A;  2ZC4 B;  3HVF A;  1PI4 A;  3LEZ A;  4U3T A;  1YLW A;  2JE5 A;  1TEM A;  3G32 A;  3G4P A;  4GDN A;  1SDE A;  2CC1 A;  5CEC A;  2OSU A;  2Q9M A;  3G31 A;  4WMC D;  1FOF A;  1LI9 A;  1H5X A;  4KEN B;  3ZDJ A;  4KQR A;  1YM1 A;  3ITA A;  4OQH A;  2QMI A;  2XD5 A;  4GZB A;  4OLD A;  3WRT A;  5CHU A;  1XGI A;  1PZO A;  4HEF A;  2XFS A;  1KGF A;  4B4Z A;  1K57 A;  4C3Q A;  1QME A;  2ZM2 A;  2ZQ8 A;  2ZJ9 A;  3Q81 A;  3TOI A;  3O87 A;  1L0F A;  2V1Z A;  3OCN A;  4DRT A;  4A5R A;  2OV5 A;  5A93 A;  3HBR A;  2H10 A;  2Y4A A;  2ZMA A;  5EVI D;  1CK3 A;  3BFG A;  3G34 A;  4KZ4 A;  1FR6 A;  5EVL A;  5GLA A;  3N8S A;  3UE0 A;  3LO7 A;  5GLB A;  4E3I A;  3IH8 A;  3HLG A;  3TG9 A;  4OP8 A;  2B5R A;  3RJU A;  5M18 A;  1HD8 A;  4WZ4 A;  1K38 A;  3NI9 A;  3W4Q A;  1FSW A;  1ONG A;  1ONH A;  4E3M A;  1IKG A;  1NYM A;  5AQB A;  4CPK A;  5HL1 A;  3IH9 A;  4E3K A;  3NDE A;  3QNB A;  3NCK A;  3OPH A;  4JXG A;  1I2S A;  2WAD A;  3IXG A;  2Y91 A;  4FSF A;  5EUA A;  4K91 A;  3SOI A;  3CMZ A;  4KG2 A;  5EVI C;  5FAT A;  1PIO A;  4MLL A;  2XFT A;  1W7F A;  4N1X A;  5EOE A;  3WS0 A;  4UHU A;  1JWV A;  1DY6 A;  1E3U A;  2ZC3 B;  4E3J A;  2QPN A;  4JBF A;  5AQ9 A;  1O07 A;  4MBK A;  1LHY A;  3HUM A;  3NBL A;  3UDF A;  3ZNY A;  4E6X A;  4EV4 A;  5CGX A;  4P87 A;  3FKW A;  3BFC A;  1JVJ A;  1ES4 A;  3UPN A;  5EPH A;  3P98 A;  1RGY A;  1K54 A;  4RX3 A;  5FA7 A;  2E8I A;  4P0M A;  4S2N A;  5GHY A;  2EXB A;  4M3K A;  3N8L A;  5GHZ A;  4EWF A;  2IWD A;  3SS3 A;  2BG1 A;  1PZP A;  2H0T A;  3MZF A;  4PM7 A;  4LV2 A;  4XUX A;  3V39 A;  3VFH A;  3VSK A;  3VSL A;  3A3F A;  5CGS A;  1GA9 A;  4KZA A;  2ZM8 A;  1K4E A;  3FZC A;  1FCN A;  4MEZ A;  2FFF B;  3M6B A;  2IWB A;  3CJM A;  5AQA A;  4KQQ A;  1PWC A;  2WAF A;  4B88 A;  4RVA A;  4GOG A;  1L0E A;  2R9X A;  4JXV A;  3ZGA B;  3LCE A;  3S22 A;  1E3U D;  3D4F A;  4DXB A;  1BLS A;  3OPP A;  3SS4 A;  4BL2 A;  3MKF A;  3DWK A;  4OOL A;  4X69 A;  1IYO A;  4DDS A; 
#chains in the Genus database with same CATH topology
 4JJN B;  2ZQA A;  4Y13 A;  1L0G A;  2LY8 A;  4QD4 A;  4P6Z S;  3FV7 A;  2VQR A;  5CPJ D;  3H82 B;  1P3O C;  4NXB A;  4QLC B;  3ITB A;  2WYX A;  5CRF A;  2P9V B;  1E6R A;  3REI D;  4RQ9 A;  4OOM A;  3P5J B;  2W0N A;  2WKE A;  2FFY A;  4EQI A;  2ZMV A;  5GHX A;  4HGA B;  3DWZ A;  4HHD A;  1RP5 A;  2IO5 C;  3TSG A;  5L09 A;  4P85 A;  5F5Y A;  3AFA A;  1YLZ A;  5FUG A;  1YU2 A;  1OTA A;  5CP6 C;  3KYZ A;  4WL9 A;  5JRG B;  1C3B A;  4Y0O A;  1CXW A;  4Z66 B;  2VJW A;  2Y2I A;  3B33 A;  5HDC A;  4N1H A;  4OPR A;  2RTS A;  1DJB A;  2XD1 A;  3TE8 A;  3IXH A;  3AZN D;  1OTD A;  5KMW A;  1W2E A;  4DN0 A;  2DF4 C;  1P3G A;  2DNS A;  1HQ3 A;  4S2M A;  3MGR D;  3KXB B;  4WF0 A;  4WU9 B;  3L9K A;  3VOY A;  1U60 A;  4R38 A;  2V0W A;  5G4Y A;  1MPL A;  3FKV A;  5B40 B;  5B32 B;  4NE3 A;  2A49 A;  4YWZ A;  3MGQ A;  5J7E A;  3UB7 A;  2G2W A;  4KUD C;  4JPM A;  4K0W A;  3KWQ B;  4S2I A;  1ID3 A;  2ZY3 A;  1BH9 A;  5B2I A;  3NUL A;  4WEK A;  3MZD A;  2P04 A;  3LYX A;  3QP6 A;  1IOU A;  3V9R B;  2WGI A;  1L0D A;  3RFB A;  4LLO B;  3T4K A;  3S7N A;  5HZH A;  3B3X A;  3KS8 A;  5CPK A;  5HDS A;  2WGW A;  2XRO A;  4XUJ A;  1LL8 A;  5E5A B;  2Y59 A;  1XKZ A;  2NZD A;  1LSX A;  4NZ3 A;  5E5A D;  3L25 A;  5J8X A;  1FIK A;  2ZC6 B;  5EOO A;  2PYP A;  2C6W B;  5JYO A;  3ZG5 A;  4H9O A;  5B2I D;  5JRG C;  4WJ3 C;  4UUZ B;  1XP4 A;  4OH0 A;  4XT2 A;  4L0L A;  1E6P A;  3PBR A;  5GLC A;  4H9R B;  2QZ6 A;  1BSG A;  4R3J A;  3HLD A;  2YKH A;  3W97 A;  4DRA A;  3A0S A;  4OQI A;  2R9W A;  4HIA A;  1P3K B;  3REJ D;  4R4R A;  5CGW A;  3UPO A;  4KZ3 A;  1ID3 C;  5B1L B;  2A24 A;  3NOU C;  1LT0 A;  5U47 A;  1TD5 A;  1P3G D;  2IWC A;  2UV0 E;  2G2U A;  4PKY A;  2Y2P A;  1W1Y A;  3K3C A;  3VH6 T;  1P34 C;  3MXR A;  4DDY A;  3QP1 A;  3N8R A;  1D06 A;  3LY3 A;  3UTB A;  2QWS A;  5FDS A;  1GHM A;  1NXY A;  1K6R A;  5FAQ A;  4JGO A;  4Z2M H;  3WA9 D;  4J8V A;  4F3L A;  4Y0T A;  4IHQ A;  4WEJ A;  2ZMF A;  1YT4 A;  3U4L P;  3NQU B;  1EQZ A;  2EX6 A;  3KXB A;  4IBI A;  1HZO A;  4S2J A;  3ZNT A;  2BLS A;  3B42 A;  1YQS A;  1MKI A;  3BEC A;  4BBU A;  4WUJ A;  5K5B A;  4M6B A;  1YU0 A;  4PM5 A;  3UN7 A;  4IBR A;  2JBF A;  1XFQ A;  1G5U A;  2Y55 A;  3UDI A;  3VE3 A;  3REL B;  1MY8 A;  3UE1 A;  1ES5 A;  1GOI A;  2Y2J A;  3MVD B;  4LV0 A;  2RVQ C;  3T4Q A;  5GXQ B;  4J8V C;  3NOT C;  4HBT A;  3GSG A;  4Y3I A;  5B0Z A;  2H0Y A;  2INW A;  4G3V A;  3MGP B;  4JGP A;  2V8F A;  2RIQ A;  3X1S B;  1Y4O A;  3AFA C;  3AZH C;  4X23 B;  2ZM5 A;  1TZY C;  3MFX A;  3A3E A;  4H9Q B;  2ZLY A;  2NQB B;  1GSW A;  2I9V A;  4MN7 A;  4ZBE A;  1ZG4 A;  1M19 A;  2BYM A;  1K25 A;  5GSU A;  5CPJ B;  3H0R C;  3X1U A;  2W27 A;  1FCM A;  2RVQ D;  3VP3 A;  3AZK D;  3M2K A;  4LV1 A;  1BLC A;  2Y2H A;  1T1A A;  3E2K A;  4S2K A;  3AZF B;  5L10 A;  3GMW A;  3IF6 B;  3AZE C;  2EWW A;  4O01 A;  1KGE A;  4EEU A;  1NJ4 A;  3OBF A;  3REJ A;  4LRZ E;  3BFF A;  5B33 A;  4MBH A;  3W96 B;  3G2Z A;  3ZYT A;  4PM6 A;  2X02 A;  3M6H A;  5KSH A;  5F82 A;  4B93 A;  2BYK B;  3HLW A;  3MGS D;  5J3W A;  5L07 A;  1ZHH B;  3IF5 A;  1JTG A;  1M1A D;  4EQ1 A;  4LD9 B;  3L27 A;  4GJ4 A;  4OPY A;  5FDH A;  1ID3 B;  4IBK A;  3MFD A;  1M1A B;  4GLQ A;  3W98 A;  1ID3 D;  1IYP A;  2HP6 A;  2ARO D;  3LR3 A;  1FR1 A;  3AZG B;  4HMC A;  2VV7 A;  4J8X B;  1I2W A;  5AV5 B;  5BOH A;  3WWX A;  1TF1 A;  5AV5 D;  5CPK D;  4HP9 A;  2ARO C;  4JF6 A;  4X6T A;  2GX5 A;  3PYP A;  2HZ5 A;  1M19 D;  3LJA D;  5AY8 C;  3UB6 A;  2WUQ A;  5GLD A;  4IUH A;  3JVU A;  4H9P A;  4KUK A;  3NEC A;  3WS1 A;  3NQJ A;  1E25 A;  1MWU A;  3W4P A;  4NET A;  2YFV A;  2HPB A;  3WKJ C;  3AZK A;  1SZV A;  1JWP A;  4P6B A;  4OQ0 A;  3V67 A;  4WLA A;  3UT9 B;  1XJ6 A;  4H9S A;  4NK3 A;  4O0P A;  3X1T C;  2W1T B;  4ARZ A;  4QLC D;  1E6N A;  3CHW P;  1K54 C;  3LIE A;  3WD0 A;  2WKP A;  3C5A A;  4NYU A;  3GRJ A;  5G49 B;  3PBN A;  2OLU A;  2FN2 A;  3ZCZ A;  3BLS A;  3MGR A;  1W5D A;  1GCE A;  3EOI A;  4XUZ A;  5G18 A;  3X1U D;  3UTB C;  5GT3 A;  3AYW A;  1V9Z A;  2ZC4 B;  1PI4 A;  3REI B;  1J7M A;  3G32 A;  5CEC A;  3REK A;  3A1I A;  1PNE A;  3F1P B;  5CPJ A;  4QNL A;  4ZUX A;  1H5X A;  4KQR A;  2PD8 A;  3AZN B;  3H0M C;  5CP6 A;  5CHU A;  1N9L A;  1GSV A;  3DTK A;  2XFS A;  1KGF A;  3W2Z A;  3S7O A;  1OT6 A;  5B0Z D;  5AV6 A;  5DJT A;  5B0Z B;  3F1P A;  5F99 D;  4JJN C;  2ZMA A;  1A0K A;  3N8S A;  1ODV A;  5DNM C;  4E3I A;  1ZTU A;  3B6G B;  2DMW A;  2QYB A;  5M18 A;  4NE5 A;  1ONG A;  4E3M A;  3MNN B;  1WWS A;  1BFM A;  3MGR B;  1CF0 A;  5HL1 A;  3IH9 A;  3WD4 A;  3NCK A;  1I2S A;  4J8V D;  3AYW B;  3LIC A;  5IU1 A;  1PIO A;  5AY8 B;  2CV5 C;  2D02 A;  1P3M C;  4R8P C;  4GHL A;  4Q0H A;  1EQZ B;  1U35 C;  5G4Z A;  4E3J A;  5HDD A;  3KWQ D;  5B33 C;  2PYO C;  1O07 A;  2E8J A;  1P3B B;  1S4S A;  1LHY A;  4MBK A;  1P3K C;  2YFV B;  3QP8 A;  2B02 A;  3B6F B;  2FJ7 B;  4Y15 A;  2F8N A;  4S2N A;  3N8L A;  1X0O A;  2H0T A;  3V39 A;  4WU8 C;  4KGC B;  5B40 C;  3UB5 P;  4ESP A;  5E5A A;  1K4E A;  2PYO D;  5FEF A;  4J8X C;  2O0Y A;  1AWI A;  4XZQ C;  1PFL A;  2FFF B;  3FG8 A;  2YFW B;  1OTE A;  3LJA A;  1S66 L;  3CJM A;  4R8P D;  2P08 A;  2R9X A;  1PZR A;  3D4F A;  3QP4 A;  4LRX C;  5HL6 A;  4BL2 A;  4JGR A;  1IYO A;  3GDI A;  3GQZ A;  3WS5 A;  3V5M A;  1JFI B;  2ZL1 A;  5DNM B;  3AV1 B;  3AN2 D;  3GEC A;  4OJ5 A;  5DNM D;  2DQN C;  2XDM A;  4UAA A;  1S32 C;  2M7V A;  3BM6 A;  4E04 A;  4D2O A;  2C5W B;  3W98 D;  4ZJ2 A;  5AVE A;  3X1V A;  3MXQ A;  4G92 B;  3AN2 A;  4UUZ A;  3CUE C;  4IUK A;  4WN5 A;  3UNW A;  4CJN A;  2IO5 B;  1I5Q A;  1JWZ A;  4HJ3 A;  4OQG A;  4OJP A;  4EBN A;  1P3M A;  1EW0 A;  3VP4 A;  1ED7 A;  5F83 A;  4ETZ A;  5I94 A;  4IVI A;  3LZ0 D;  5JYP A;  5FQI A;  5FAO A;  5AVC A;  3REJ B;  2LB9 A;  3REH A;  2FJ7 C;  1XA1 A;  2V20 A;  3LZ0 B;  3KUY C;  4KGC A;  4KQD A;  4OON A;  1KDS A;  5FI6 A;  2PYO A;  2PDR A;  5B1M D;  5DNN D;  3GV9 A;  1P97 A;  5BS7 C;  5EVI B;  1TZY B;  4GKU A;  1R4V A;  4FCF A;  1F66 A;  1BTL A;  1P3M B;  4DKI A;  3UTA D;  1W1V A;  1S4R A;  1XXM A;  5E5A C;  1OTB A;  2EX9 A;  4R3B A;  2JKT I;  4DE1 A;  5CHM A;  4U0X A;  4OOY A;  1AXB A;  5AV8 C;  2JN7 A;  5AY8 A;  3NY4 A;  1N1J B;  1ESI A;  3REL C;  2EWV A;  4Z5T C;  4YS3 D;  2PR6 A;  3ZVW A;  3Q1F A;  3WKJ D;  3RH8 B;  4J8W B;  3BY8 A;  5E43 A;  1G68 A;  3AZG D;  1HQ3 D;  4J8U B;  4GD8 A;  3KSI A;  5GSU B;  4U0T A;  4CAY A;  3WTP C;  2XEP A;  5B1M C;  5DNN C;  3ZQ5 A;  1S0W A;  2Z2M B;  2Y2G A;  2A2L A;  3W99 B;  5MC7 A;  4IBF A;  5E2G A;  1QMF A;  4HP4 A;  3L7H A;  1M19 B;  3GVB A;  2JKF A;  3TU4 D;  3ISG A;  4GS9 B;  3TU4 B;  2G7U A;  3TRC A;  3T1X A;  3LI9 A;  1OGB A;  4OPZ A;  2F8N H;  1P3L C;  3AZJ C;  4Y17 A;  4F94 A;  2DRW A;  4JGQ A;  3REI A;  3OPL A;  2J8P A;  2J8Y A;  4M4X A;  4WZ5 C;  1KU5 A;  5GT3 B;  1MXO A;  4S2L A;  5JRG A;  3X1T B;  4PM9 A;  1O6I A;  3REK C;  3AGD A;  3V3R A;  2IOU A;  4L9E A;  4X56 A;  2W1T A;  4ARZ B;  2QHK A;  5HAP A;  4JKT A;  4Z2J A;  5AV5 C;  4EEP A;  3A3J A;  3IQA A;  3MZE A;  4X23 C;  3NQU A;  2K31 A;  4QLC A;  3KSY A;  1KE4 A;  2B95 A;  1GA0 A;  1KDW A;  3WA9 A;  2EX2 A;  3IP4 C;  4KZ5 A;  3OPR A;  3IHA A;  3JYI A;  3Q7V A;  3AZF D;  4ZDX A;  3C7U A;  3ZHH A;  1K4F A;  3CG5 A;  5FSR A;  2EX8 A;  3PR6 A;  1NRF A;  3PXP A;  1XFN A;  3B0B A;  1UWP X;  4J8W C;  4JF5 A;  1H8Y A;  2PU4 A;  3T50 A;  4IBE A;  4O7D A;  1P3K A;  1YSQ A;  5AVC D;  3AGE A;  2CV5 D;  4ZJ1 A;  1Q2P A;  3BFD A;  3QNC A;  4EUZ A;  4Z5T D;  2YKF A;  5CED A;  3HL9 A;  2ZC5 B;  1CEF A;  2WAE A;  4OLG A;  5F68 A;  3PBT A;  4CAY B;  4DE0 A;  3UDX A;  1Y28 A;  5CPI B;  4LCM A;  1N9B A;  1KOU A;  1MC0 A;  2VA0 A;  2WKI A;  4G91 B;  1ESU A;  4WEL A;  5CXW A;  1P3B D;  1TS6 A;  4XZQ A;  3HON A;  3EEH A;  5DJU A;  5BS7 A;  1SKF A;  1BT5 A;  4UEY A;  3IXD A;  4QY6 A;  2X01 A;  1BZA A;  3SZT A;  5EVI A;  1YLP A;  3OOV A;  1AOI C;  1ERM A;  1PWD A;  5DF8 A;  3UMD A;  4XUJ D;  3F1N B;  3FPV A;  2VLG A;  4OVD A;  4DMZ A;  4MB4 A;  5TBM B;  4XUJ B;  5AV9 C;  2WZZ A;  5FQK A;  2J9P A;  4R0Q A;  4NE6 A;  3T1R A;  4Z2K A;  4E6W A;  3S7Q A;  1FQG A;  3KXB C;  4X1L A;  2V1B A;  4PPR A;  2ZQD A;  4WMC A;  3NC8 A;  2Y2O A;  2XK1 A;  2AVX A;  5B2J A;  1ES2 A;  5HPF A;  5B24 B;  3MGQ B;  1VM1 A;  1V9Y A;  5B32 A;  3C30 A;  4H9S C;  5BNX A;  1AOI A;  2D01 A;  2ZL1 B;  3UO9 A;  4AWL B;  1YMX A;  2CWE A;  5D3O A;  3C8C A;  5CER A;  5CTN A;  3LJA C;  2P74 A;  3EPK A;  3L2A A;  4Z5T A;  4X55 A;  1T1B A;  1BUL A;  3REJ C;  1P3K D;  5BPV A;  3BW6 A;  3S4X A;  1P3G B;  4Z66 D;  5GXQ A;  2ZQ7 A;  4NYY A;  5CHJ A;  3O62 A;  1PRQ A;  3WA9 C;  1M6K A;  4GHI B;  4HJ4 A;  1T3U A;  1XA7 A;  3HJI A;  3IF6 A;  1IYQ A;  4K0X A;  1TS8 A;  3A1K A;  5HWT A;  5C3I B;  5J4E A;  3C1C D;  3OCL A;  3C1B C;  1P9W A;  2PYR A;  3UY6 A;  2P9V A;  4PM8 A;  3G35 A;  3LEL C;  1KX3 A;  2HDU A;  3AYW D;  2XA7 S;  2ZM0 A;  4H9N A;  4WU9 D;  3LIF A;  2XLN A;  2EA9 A;  4HES A;  1M18 C;  1P34 B;  3MNN A;  4J8V B;  5HAR A;  1YLY A;  4J8W A;  4RYE A;  1P3P D;  4PMA A;  2UWX A;  3WRZ A;  2OAP 1;  3PAE A;  4DF6 A;  5BO0 B;  4HY8 A;  3WAA C;  4HNB A;  3UTB D;  4KZ6 A;  2ZQC A;  4HGA C;  1P3A B;  2GNX A;  2O99 A;  5DF9 A;  3CAX A;  1GSX A;  4IED A;  5B2I C;  4BBT A;  3IS2 B;  5CP6 B;  2KDK A;  3LEL A;  1KX3 C;  3QHY A;  4R8P B;  3MQL A;  4QLC C;  1HQ3 C;  3NJA A;  3DAV A;  2PYO B;  4E3L A;  3REK B;  1M18 A;  5F69 A;  1S6R A;  1K0K A;  3KYQ A;  3F1O A;  5AV8 D;  3C38 A;  3EPJ A;  3FKE A;  2VV6 A;  4NZ5 A;  4R23 A;  4R70 A;  1K55 C;  5HX9 A;  3M7P A;  3C1B D;  3AV2 A;  1L6J A;  1CEG A;  3WKJ A;  3A6N A;  4UPK A;  3KUY B;  5FAP A;  4KUD B;  3I7J A;  4KG5 A;  4R1G A;  3KUY D;  3ZVT A;  1AOI B;  3HVF A;  5CPK C;  1TS0 A;  3WD1 A;  4U3T A;  4LG2 A;  1VET B;  1PDC A;  3G4P A;  3LIB A;  4GDN A;  3MMH A;  1SDE A;  2NZD B;  3LI8 A;  1P3I A;  5AVB C;  2Q9M A;  3G31 A;  3UTA A;  1FOF A;  1LI9 A;  4IBC A;  2BAS A;  3ZDJ A;  4OQH A;  3B0D C;  2QMI A;  4WU9 C;  2FH5 A;  5B1M B;  5DNN B;  1MZU A;  3FC7 A;  1K57 A;  1QME A;  4I3I A;  4HH3 A;  1L0F A;  4IJG A;  2KX6 A;  3AV1 C;  2OV5 A;  3D9Y A;  5EVI D;  1CK3 A;  3BFG A;  2HJ9 C;  4ZBJ C;  4Z2H A;  4G3K A;  1P3L D;  1ZLA A;  4DJ2 A;  2ZY5 A;  3IH8 A;  3HLG A;  4J8X A;  3AZL D;  4OP8 A;  1HD8 A;  1K38 A;  1IKG A;  1NYM A;  4CLC E;  3X1V D;  4CPK A;  4XZQ D;  4E3K A;  4XT2 B;  3WA9 B;  3CIT A;  1VET A;  4NXG A;  2XSS A;  4FSF A;  5EUA A;  3CMZ A;  3MJQ A;  5EVI C;  4MLL A;  2XFT A;  4KUD A;  1W7F A;  4UHU A;  1HQ3 B;  2QPN A;  3HUM A;  1UGU A;  3H0L C;  3ZNY A;  4EV4 A;  1ES4 A;  5EPH A;  2HIO D;  3B6F C;  3T4T A;  4WU8 A;  1U35 D;  5GHY A;  2EXB A;  4M3K A;  4ETX A;  4EWF A;  5HSQ A;  3SS3 A;  5CX7 A;  2BG1 A;  3KYE A;  4XUX A;  3REL D;  3EG5 B;  2FZ0 A;  5L8M A;  4KZA A;  1YU3 A;  3IX3 A;  3M6B A;  5FEG A;  4NXF A;  1YAX A;  1KX5 A;  3LEL B;  5AQA A;  4RVA A;  3LCE A;  3S22 A;  1E3U D;  4DJ3 A;  1GPF A;  4BWI A;  1BLS A;  2XRN A;  5HWW A;  5CEB A;  3DTE A;  4CQH A;  2WGV A;  5B40 A;  2O9B A;  4JJN D;  2DCF A;  4JJN A;  2Y2N A;  5TJJ A;  2BYM B;  5DKL A;  2Z6D A;  3N6I A;  5G49 A;  3R7W B;  4FUW A;  5KDM B;  5LBR A;  4H9Q A;  3CWF A;  4X23 A;  2J7V A;  1KX5 B;  5EFW A;  5B31 G;  5F1G A;  3SH9 A;  3X1T A;  5FI2 A;  5IS1 A;  3MXS A;  1OJG A;  1J3W A;  1DJA A;  2JKT M;  4GHI A;  4LRY C;  4R4S A;  1HLU P;  3AZE A;  2XQZ A;  3FPW A;  1NRJ A;  1CI8 A;  1TVF A;  2EFU A;  5F6A A;  4L9F A;  2NUT C;  4QU3 A;  2G5H C;  4Z5T B;  5GT3 C;  4WZS B;  1IKI A;  1MWT A;  3VP0 A;  3HRE A;  3B6G D;  5AVC B;  3X1V C;  5B0Y A;  2JC7 A;  1NLZ A;  2VV8 A;  3W97 D;  3KSG A;  2XGN A;  1UWN X;  5B40 D;  4OUI A;  2ZY4 A;  1TAF B;  1P34 D;  3HLB A;  1GHI A;  1M19 C;  2NZD C;  1VEU A;  4PHT A;  3LZ1 B;  4Y0U A;  4F3L B;  2HP5 A;  4DRB A;  5B24 A;  3T1Q B;  3EPL A;  5AY8 D;  1WE4 A;  3V50 A;  3W4O A;  2JSS A;  4IBB A;  3AZN C;  2ZQ9 A;  3KWQ C;  1H0M A;  3W8K A;  4Z66 C;  3K3D A;  1P3A D;  4HH2 A;  1JNU A;  4LD9 A;  4MBF A;  5CTM A;  2Y2Q A;  1Y54 A;  3K2N A;  5AVB D;  4WNN A;  2PBY A;  3CPT B;  1PI5 A;  4DXC A;  4G92 C;  4GHA A;  3ZG0 A;  1N4O A;  1K55 A;  3GR2 A;  1PYY A;  4MB3 A;  3FDD A;  4KGC D;  5EM0 A;  3LJA B;  3IT9 A;  1TZY A;  3WTP A;  3C2W A;  4I3A A;  3JVV A;  4HMD A;  1P3I B;  3F1N A;  4YFM A;  3ZG8 B;  3AZJ D;  4HOI A;  1IFQ A;  1P3I D;  1A7W A;  4NKP A;  2ZBB A;  5IHV A;  3VV4 A;  3HUO A;  4QY5 A;  2RCX A;  3O86 A;  5AQ7 A;  1P9R A;  3KUY A;  4ZUX C;  1XJ3 A;  3B6F A;  5I5L A;  3AV2 B;  5B0Y C;  4RX2 A;  4Z1W A;  1WYB A;  1OT9 A;  5AV9 B;  2XA7 M;  1KVM A;  3EWK A;  4S2O A;  2V9A A;  2OOL A;  4ZJ3 A;  5KIZ A;  2CMN A;  4NG2 A;  1P3L A;  1ZLA D;  1OME A;  4Z2I A;  2Q9N A;  3AZI B;  4CLC A;  3WTP D;  4Y5F A;  3X1U C;  1PWG A;  4XUJ C;  3MS6 A;  2EFX A;  2PU2 A;  3WTP B;  5DVA A;  3PBQ A;  1LL9 A;  1SKO B;  1PW1 A;  1WWI A;  3BLM A;  1ZKJ A;  3QP2 A;  3FWL A;  4JXW A;  1TDG A;  3UB9 A;  4Z9Q A;  3IX8 A;  3PBS A;  3AZK C;  4IBX A;  4WM9 A;  3X1S A;  4AWL C;  1W1P A;  2ZOH A;  3UTA B;  3Q7V B;  4FOF A;  3IWO A;  1ZC2 A;  3C1C B;  3SH8 A;  5M19 A;  1K56 D;  2F8N K;  4KQO A;  1S32 D;  1YU1 A;  2V8C A;  2A3U A;  3RXW A;  1PW8 A;  1S32 B;  3UE3 A;  3AFA D;  1MWS A;  3MGR C;  5HAQ A;  3REH C;  2FJ7 A;  4Z2M G;  1H8Z A;  1JTD A;  3IXB A;  3NHQ A;  5EEC A;  1MWR A;  1NY0 A;  1WA9 A;  2JKG A;  4J8U D;  3DW0 A;  4I5S A;  3AZM C;  5GT0 B;  2HJE A;  3VH5 W;  1KX3 B;  5TFQ A;  3T4J A;  3G30 A;  3JPU A;  5GT0 D;  4BLM A;  5GL9 A;  3BEB A;  2PHY A;  1FSY A;  5GSU D;  1P3P B;  3W98 C;  3BJN A;  2RL3 A;  3MBZ A;  4KG6 A;  3HLE A;  2L4R A;  3MQO A;  3T12 B;  3DTI A;  4QB8 A;  2HDR A;  3F6T A;  1B6W A;  4EBL A;  3AZE B;  4YM6 B;  3L28 A;  3C1C A;  1Q9C A;  2L5A A;  3NQJ B;  5CPJ C;  1L2S A;  4GB7 A;  3IX4 A;  3MVD D;  4BJP A;  3MQ0 A;  4NFT A;  4KZ7 A;  5GXQ D;  4Z66 A;  1UR8 A;  1KS0 A;  4X23 D;  5B31 A;  4B9O A;  4IBD A;  1LL5 A;  2V5O A;  3E2L A;  5B1L A;  2VGL M;  5BO0 A;  5AV8 B;  5FUG B;  3LY4 A;  4GS9 A;  4UQI M;  5EE8 A;  3REK D;  1G6A A;  3LZ1 C;  3R7W A;  3A0R A;  5BNV B;  4J8U A;  1P3F D;  4UA7 A;  3IWI A;  3W99 A;  4EU0 A;  4MN5 A;  4WU8 D;  4GW9 A;  1ZG6 A;  4LV3 A;  3AV1 D;  2VGK A;  5F99 C;  2QJ5 A;  3R45 B;  1YSP A;  3IWQ A;  1K56 A;  5AV9 A;  2H5S A;  3MSH A;  4CSR B;  5B0Z C;  3DTM A;  1D7E A;  1FCO A;  4X1M A;  1AOI D;  1HTA A;  2BTF P;  3CZD A;  4C75 A;  2I72 A;  3TU4 C;  5DF7 A;  2M7U A;  4S2P A;  3UT9 A;  3MQQ A;  4GH9 A;  3VOL A;  4TX8 A;  1BLH A;  5B2J D;  1H8M A;  3SH7 A;  4HI4 A;  3REH B;  4Z2G A;  2HUE B;  2O9C A;  4OJ6 A;  1XPB A;  3REH D;  3GTC A;  1SHV A;  3UME A;  3AZM B;  3ULF A;  2F2A C;  1DRM A;  2ZD8 A;  2OLV A;  3A3I A;  1TZY D;  5M1A A;  3NOP C;  3BWL A;  5B32 G;  5CPI D;  2P7J A;  1F98 A;  4YS3 C;  3DBA A;  3V9R A;  1YPR A;  3X1S C;  1OGG A;  3O3V A;  3AZL B;  4LD9 C;  4ID4 A;  4MDZ A;  2Y2M A;  4HBU A;  2W3G A;  1YLT A;  3W96 C;  5B32 D;  4EO5 C;  3VOZ A;  3EQU A;  3WAA B;  2ARO B;  5DNM A;  4HQA A;  4QWO A;  5DTT A;  3LZ1 A;  1KX5 C;  3ZG9 B;  3IF6 C;  1ERQ A;  3AV1 A;  2V1A A;  3IHB A;  1XX2 A;  4FD8 A;  2F8N G;  4DQY B;  3V3S A;  4N9L A;  2NQB A;  2HIO B;  2W1R A;  1BLP A;  1H0I A;  5AV8 A;  5AVB A;  1W1T A;  5AVF A;  4MN6 A;  1M18 D;  5E2E A;  3MGP A;  3AZJ B;  3CI6 A;  4ZTK A;  5FL3 A;  1YKD A;  2WKH A;  4H8R A;  4KZ9 A;  1H0G A;  1EI5 A;  3IBJ A;  5E2H A;  3MVD A;  3AYW C;  1N9O A;  3LEL D;  5B24 D;  2K2N A;  1ES3 A;  3VH6 W;  1TS7 A;  2PT7 A;  1Q2Q A;  3AV2 C;  3HSH A;  2XF3 A;  3MGS C;  3MGQ D;  4DE3 A;  1P0Z A;  2B18 A;  4IVK A;  4CSR A;  4JF4 A;  3HLC A;  2KOI A;  4FH4 A;  3AZI D;  4IJF A;  1E4D A;  5GT0 A;  2W3H A;  2JE5 A;  1TEM A;  3X1U B;  1VB6 A;  4NY2 A;  2L1M A;  2ZOI A;  4EW7 A;  4UQI S;  2VGL S;  4G3W A;  5AV6 B;  1YM1 A;  3B47 A;  3ITA A;  5B1L D;  2XD5 A;  1LSW A;  4OLD A;  5JRG D;  3N3F A;  5AV6 D;  1XGI A;  4NEE D;  4BMW A;  4HEF A;  1LSV A;  1DP6 A;  4B4Z A;  4EO5 B;  3REI C;  4QPR A;  2ZM2 A;  2HGV A;  2ZJ9 A;  3TOI A;  5B31 B;  4IBG A;  5A8B A;  2V1Z A;  4A5R A;  5B24 C;  4OJO A;  2H10 A;  5EVL A;  1FR6 A;  2L0W A;  3LO7 A;  5GLB A;  3T4O A;  2CV5 B;  5F99 B;  3MR0 A;  3TG9 A;  3REL A;  3B6G C;  3RJU A;  2VK3 A;  1KX4 C;  4H6J B;  2G5I C;  1OJ5 A;  3W97 B;  3UTA C;  3QNB A;  3OPH A;  3KXB D;  3AZI A;  4CLC B;  2W8S A;  1DP8 A;  3H9W A;  4K91 A;  3SOI A;  4H9R A;  4KG2 A;  3WX7 A;  4CLC D;  4N1X A;  1F66 C;  4YS3 A;  1DY6 A;  1E3U A;  4R3A A;  4JBF A;  5AQ9 A;  2FJ7 D;  3NBL A;  3LZ0 C;  5CGX A;  4P87 A;  3UPN A;  1JVJ A;  1F1E A;  3P98 A;  1RGY A;  4RX3 A;  2E8I A;  3H7W B;  1CK7 A;  1BH8 A;  3P01 A;  4PKY G;  1S32 A;  2IWD A;  1P3O A;  3UTB B;  1PZP A;  4PM7 A;  5B32 C;  5HD5 A;  3VSK A;  5CGS A;  1GA9 A;  3X1S D;  2HIO A;  3AZJ A;  3BQA A;  4MEZ A;  1G6O A;  4HJ6 A;  1GXD A;  4H9P B;  2IWB A;  1F66 D;  4KQQ A;  2J80 A;  4GOG A;  1L0E A;  4L9G A;  2JKR I;  4DXB A;  3SS4 A;  1S67 L;  3MKF A;  3DWK A;  3AZG A;  4WV4 B;  2W3D A;  1AIW A;  1BH9 B;  5B2I B;  1WYC A;  3IBR A;  3NDG A;  2OAQ 1;  3BFE A;  3ZG7 B;  5B2J C;  3EEA A;  3WAA A;  4NZ4 A;  2R78 A;  4S2N C;  1IEM A;  3RTY A;  2H28 A;  4MMN A;  4IJE A;  5HD3 A;  4OP5 A;  4BEN A;  2HIO C;  2BYK A;  3W98 B;  3T4L A;  5HW3 A;  4EET B;  4LEN A;  4WBG A;  1OTI A;  2LB5 A;  3MGS A;  1XJ2 A;  3VMA A;  3KO6 A;  3AZF C;  3BY9 A;  4ZRR A;  3W96 A;  1S1Z A;  3QP5 A;  4FTX A;  5E2F A;  5B0Y B;  1HVB A;  5B33 D;  4JXS A;  3LZ0 A;  1T19 A;  5L2F A;  3E4O A;  5B0Y D;  3PAG A;  1P3M D;  4MB5 A;  2VKS A;  3VFF A;  3HLF A;  3Q07 A;  1F5M A;  1QO6 A;  2GJ3 A;  4R8P A;  5KSC A;  3CUE A;  3MGS B;  1K6S A;  3WS2 A;  5DTK A;  3Q82 A;  3OLO A;  1NWZ A;  1ALQ A;  3MGQ C;  1P3A A;  3X1V B;  4XZQ B;  4E3O A;  3EQV A;  1H3Q A;  3AZH B;  3KSH A;  3R45 A;  5BT1 D;  1Z09 A;  4YIN A;  3S1Y A;  4I38 A;  5FQM A;  3AZF A;  4BD1 A;  1ERO A;  2NQB C;  1E6Z A;  4II7 A;  1IEL A;  1MKM A;  3TW8 A;  3VP1 A;  4OJL A;  2OWH A;  4N92 A;  3MKE A;  1YLJ A;  2D49 A;  1P34 A;  2HP9 A;  4ZBJ B;  1CJF A;  3BQ8 A;  1OPX A;  3MGP C;  3W99 D;  1E8B A;  4EBP A;  2CV5 A;  1TAF A;  4LCL A;  4KZB A;  3RXX A;  4H9N B;  5JA4 A;  3B0D B;  1RCJ A;  1W8Y A;  3AZI C;  4NXE A;  4Q0I A;  1NZO A;  5AJG A;  2Y79 A;  3AZE D;  1SCW A;  4KHA A;  1T1C A;  3KSF A;  4X25 A;  3D3O A;  4J8U C;  1S1Y A;  4GDB A;  4I39 A;  5EVE A;  3B0C T;  2F8N D;  2GZA A;  3AZN A;  1KE3 A;  2V0U A;  1P3O B;  1KX4 B;  4YM6 D;  3P7N A;  4ZUX B;  1ULY A;  1BH8 B;  1TDL A;  2NUP C;  5HFO A;  2F8N B;  5HPI A;  3E4Q A;  2XR0 A;  3W97 C;  1Z6F A;  1Z2C B;  4G91 C;  1P3P A;  3MNN C;  3FYZ A;  2OWJ A;  3KX0 X;  3O62 C;  1VQQ A;  3N7W A;  3X1T D;  3TJZ C;  3O62 D;  1LI0 A;  3O5Y A;  4N9K A;  5DTS A;  4RA7 A;  3WD2 A;  4Z2L A;  5GT3 D;  4YM6 C;  1HTZ A;  3O88 A;  5CPI C;  1P3F B;  2PR5 A;  5KZH A;  2ZY2 A;  2Y2L A;  2WK0 A;  3UB8 A;  3KS4 A;  3VH5 A;  5F99 A;  3B0C W;  4KUD D;  1KX5 D;  3AZK B;  4KUO A;  3HUN A;  2VEA A;  4LPZ A;  3A0V A;  3N4I A;  4YNR A;  2K7S A;  3BYD A;  3E98 A;  3LR0 A;  5B2J B;  4E44 A;  4OPQ A;  1KX4 A;  5DFX A;  5DFY A;  1XGJ A;  3WTP E;  3TU4 A;  4Q0J A;  5C5K A;  4GD6 A;  1UR9 A;  3CLO A;  3PHY A;  1H8P A;  3LUQ A;  1F2K A;  4GN2 A;  1CQA A;  1T18 A;  3EGD C;  3Q7Z A;  4CLC C;  4DE2 A;  2JHE A;  5B1M A;  5DNN A;  3C1C C;  5JA4 B;  1KE0 A;  2J3T D;  3VP2 A;  5AV5 A;  4Q8I A;  4C6Y A;  5F1F A;  1NYY A;  2O9A A;  4X53 A;  1EWZ A;  3HJK A;  1LLB A;  2ARO A;  3L29 A;  5FI7 A;  3LZ1 D;  2JCH A;  2HF6 A;  3WD3 A;  4E45 A;  4J8X D;  3AZL A;  2Z6C A;  3AZH A;  1KGG A;  2MJ6 A;  2HV1 A;  1MBL A;  3B6F D;  1EQZ C;  5A92 A;  1P3G C;  3A3D A;  5A90 A;  1RGZ A;  1O7E A;  1DJC A;  3AGF A;  3T4S A;  3KFU G;  5CPI A;  5FAS A;  3AZM A;  4BQM A;  2WGW B;  5HWV A;  1W8Q A;  2J3W A;  3F1O B;  5AVB B;  2PRF A;  3OC2 A;  3C4O A;  3S7P A;  4KZ8 A;  1P3F C;  5GSU C;  2V2F F;  3CPT A;  1KVL A;  2HDQ A;  1YUE A;  4HME A;  1H3O B;  2M1C A;  4JLF A;  3ICY A;  3E0Y A;  3MF0 A;  3AZL C;  2Y2K A;  3UT9 D;  2EXA A;  1W79 A;  4GNU A;  4WNN B;  5GXQ C;  5FQ9 A;  1NLY A;  4YOF A;  3AV2 D;  3UPP A;  2PAV P;  4IBJ A;  1K57 C;  5AV9 D;  4XXR A;  3OZH A;  3C4P A;  4Y7P A;  4R6L A;  3VE4 A;  1JFI A;  5BNV A;  1SDN A;  3LIA A;  3PTE A;  3C1B A;  5A91 A;  3C7V A;  5TR7 A;  1F9I A;  5GT0 C;  1XJ4 A;  2XH9 A;  4EES A;  4WU9 A;  4AFI A;  5FQJ A;  3A6N C;  3NIA A;  5B33 B;  3WS4 A;  1P3B C;  1YU4 A;  4LGW A;  5B31 D;  4PAU A;  3G2Y A;  4Y2F A;  3EGX C;  2Y8H A;  3LGO A;  2ZC7 A;  3LFV A;  3H7W A;  1ZLA C;  1YMS A;  3E4P A;  3T1S A;  3BRM A;  2X71 A;  2VGJ A;  5DKK A;  1NZU A;  3ZFZ A;  2J9O A;  3LEQ A;  3MNN D;  4ZAM A;  3SW1 A;  2HDS A;  4X68 A;  4YS3 B;  1CI9 A;  2KLI A;  3VH6 A;  4J8W D;  3AFA B;  3AL0 C;  5EM1 A;  1KX3 D;  3H82 A;  4WZ5 A;  1G28 A;  1B67 A;  4BD0 A;  4QJG A;  3PBO A;  3R4K A;  1GHP A;  5TGF A;  5BNX B;  3P09 A;  5AV6 C;  5FQQ A;  3D72 A;  1EQZ D;  5B1L C;  1EAK A;  1N1J A;  3W99 C;  1IYS A;  2WZX A;  2VX8 A;  4WYY A;  3L26 A;  3VH5 T;  4I3J A;  4FH2 A;  5CP6 D;  3M2J A;  1P3A C;  2GDN A;  3MGP D;  4YM6 A;  3U2A A;  4ZUX D;  3SS5 A;  4UA6 A;  4EER A;  5IT5 A;  1F66 B;  1H3O A;  4BL3 A;  1W63 M;  1L3L A;  2Z2L B;  5BT1 C;  2QKP A;  1P3I C;  1M40 A;  2J3T C;  5EV0 A;  3O62 B;  2NQB D;  1U35 A;  4D60 A;  4P6Z M;  1STZ A;  4MNR A;  2HUE C;  4UA9 A;  4E3N A;  1M1A C;  4B4X A;  4WU8 B;  4KGC C;  1BUE A;  3LR5 A;  5HAI A;  4QHC A;  4H9O B;  3AN2 B;  1D1J A;  3C1B B;  1J9M A;  4LFU A;  4OKP A;  2W3F A;  2QJ7 A;  3MVD C;  3LEZ A;  1ACF A;  1YLW A;  1ZLA B;  4EUV A;  5B31 C;  3G6O A;  2CC1 A;  2OSU A;  1E88 A;  4WMC D;  2NZD D;  4KEN B;  3AZG C;  4GZB A;  2A24 B;  3WRT A;  2PD7 A;  4NZ1 A;  1PZO A;  1E15 A;  4C3Q A;  2ZQ8 A;  2PBD P;  2YFW A;  1SKO A;  3LID A;  3Q81 A;  3O87 A;  2IA2 A;  3OCN A;  4DRT A;  5TBM A;  5A93 A;  3HBR A;  2Y4A A;  5GLA A;  1FIL A;  3G34 A;  3W96 D;  4KZ4 A;  3AZM D;  3UE0 A;  4LD9 D;  1BYW A;  2B5R A;  4MCW A;  5CHL B;  1P3L B;  4WZ4 A;  3NI9 A;  3W4Q A;  1FSW A;  1ONH A;  3HCY A;  1N9N A;  5AQB A;  4GCZ A;  3WKJ B;  1VEU B;  3NDE A;  3AZH D;  4EXO A;  4JXG A;  2WAD A;  1P3B A;  3IXG A;  3UT9 C;  2JKR M;  2Y91 A;  1M1A A;  3A6N D;  5FAT A;  3WS0 A;  3WAA D;  5EOE A;  1JWV A;  3A6N B;  2ZC3 B;  1P3F A;  1P3P C;  3UDF A;  4E6X A;  3FKW A;  3BFC A;  4BBV A;  2WKR A;  4H6J A;  3LR4 A;  1K54 A;  5FA7 A;  4P0M A;  5GHZ A;  3EPH A;  5CPK B;  3B6G A;  1VHM A;  4O8G A;  3MZF A;  4LV2 A;  3VFH A;  1U35 B;  4K08 A;  3VSL A;  3A3F A;  4ME4 A;  3IS2 A;  1M18 B;  2ZM8 A;  2WKQ A;  3FZC A;  5C3I C;  3AN2 C;  1FCN A;  2Q0O A;  2VZW A;  1P3O D;  1KX4 D;  2ACG A;  1PWC A;  2WAF A;  3KWQ A;  3ZGA B;  4JXV A;  4B88 A;  1DP9 A;  3UE6 A;  5KDM A;  1W63 Q;  3OPP A;  4KHA B;  4OOL A;  4X69 A;  4DDS A;  5AVC C;  2W3E A; 
#chains in the Genus database with same CATH homology
 4JJN B;  2ZQA A;  1L0G A;  2LY8 A;  4QD4 A;  3FV7 A;  2VQR A;  5CPJ D;  1P3O C;  4QLC B;  3ITB A;  2WYX A;  5CRF A;  2P9V B;  3REI D;  4OOM A;  3P5J B;  2WKE A;  2FFY A;  4EQI A;  5GHX A;  4HGA B;  3DWZ A;  3TSG A;  1RP5 A;  2IO5 C;  4P85 A;  3AFA A;  1YLZ A;  5FUG A;  1YU2 A;  5CP6 C;  5JRG B;  1C3B A;  4Y0O A;  4Z66 B;  2Y2I A;  4N1H A;  4OPR A;  1DJB A;  2XD1 A;  3IXH A;  3AZN D;  5KMW A;  1W2E A;  2DF4 C;  1P3G A;  2DNS A;  1HQ3 A;  4S2M A;  3MGR D;  3KXB B;  4WU9 B;  3VOY A;  1U60 A;  1MPL A;  3FKV A;  5B40 B;  5B32 B;  4NE3 A;  2A49 A;  3MGQ A;  2G2W A;  4KUD C;  4JPM A;  4K0W A;  3KWQ B;  4S2I A;  1ID3 A;  2ZY3 A;  1BH9 A;  5B2I A;  4WEK A;  3MZD A;  3V9R B;  2WGI A;  1L0D A;  3B3X A;  3KS8 A;  5CPK A;  2WGW A;  4XUJ A;  5E5A B;  2Y59 A;  1XKZ A;  2NZD A;  4NZ3 A;  5E5A D;  3L25 A;  5J8X A;  2ZC6 B;  5EOO A;  2C6W B;  5JYO A;  3ZG5 A;  4H9O A;  5B2I D;  5JRG C;  4WJ3 C;  4UUZ B;  1XP4 A;  4OH0 A;  4L0L A;  3PBR A;  5GLC A;  4H9R B;  2QZ6 A;  1BSG A;  4R3J A;  3HLD A;  3W97 A;  4DRA A;  4OQI A;  2R9W A;  1P3K B;  3REJ D;  4R4R A;  5CGW A;  3UPO A;  4KZ3 A;  1ID3 C;  5B1L B;  5U47 A;  1P3G D;  2IWC A;  2G2U A;  2Y2P A;  3VH6 T;  1P34 C;  3MXR A;  4DDY A;  3N8R A;  3LY3 A;  3UTB A;  1GHM A;  1NXY A;  1K6R A;  5FAQ A;  4Z2M H;  3WA9 D;  4J8V A;  4Y0T A;  4WEJ A;  1YT4 A;  3NQU B;  1EQZ A;  2EX6 A;  3KXB A;  4IBI A;  1HZO A;  4S2J A;  3ZNT A;  2BLS A;  1YQS A;  1MKI A;  3BEC A;  4M6B A;  1YU0 A;  4PM5 A;  3UN7 A;  4IBR A;  2JBF A;  2Y55 A;  3UDI A;  3REL B;  1MY8 A;  3UE1 A;  1ES5 A;  4LV0 A;  2Y2J A;  3MVD B;  2RVQ C;  5GXQ B;  4J8V C;  4HBT A;  3GSG A;  5B0Z A;  2H0Y A;  3MGP B;  2RIQ A;  3X1S B;  3AFA C;  3AZH C;  4X23 B;  2ZM5 A;  1TZY C;  3A3E A;  4H9Q B;  2ZLY A;  2NQB B;  4ZBE A;  1ZG4 A;  1M19 A;  2BYM A;  1K25 A;  5GSU A;  5CPJ B;  3H0R C;  3X1U A;  1FCM A;  2RVQ D;  3VP3 A;  3AZK D;  3M2K A;  4LV1 A;  1BLC A;  2Y2H A;  3E2K A;  4S2K A;  3AZF B;  3GMW A;  3IF6 B;  3AZE C;  1KGE A;  1NJ4 A;  3REJ A;  3BFF A;  5B33 A;  4MBH A;  3W96 B;  3G2Z A;  4PM6 A;  2X02 A;  3M6H A;  5KSH A;  5F82 A;  2BYK B;  3HLW A;  3MGS D;  3IF5 A;  1JTG A;  1M1A D;  4LD9 B;  3L27 A;  4OPY A;  5FDH A;  1ID3 B;  4IBK A;  3MFD A;  1M1A B;  3W98 A;  1ID3 D;  1IYP A;  2HP6 A;  2ARO D;  1FR1 A;  3AZG B;  4J8X B;  1I2W A;  5AV5 B;  5BOH A;  3WWX A;  5AV5 D;  5CPK D;  2ARO C;  4JF6 A;  4X6T A;  1M19 D;  3LJA D;  5AY8 C;  2WUQ A;  5GLD A;  4H9P A;  3WS1 A;  3NQJ A;  1E25 A;  1MWU A;  3W4P A;  4NET A;  2YFV A;  3WKJ C;  2HPB A;  3AZK A;  1JWP A;  4P6B A;  4OQ0 A;  3UT9 B;  4H9S A;  4NK3 A;  3X1T C;  4QLC D;  1K54 C;  3C5A A;  4NYU A;  3GRJ A;  5G49 B;  3PBN A;  2OLU A;  3ZCZ A;  3BLS A;  3MGR A;  1W5D A;  1GCE A;  4XUZ A;  5G18 A;  3X1U D;  3UTB C;  5GT3 A;  3AYW A;  2ZC4 B;  1PI4 A;  3REI B;  3G32 A;  5CEC A;  3REK A;  3A1I A;  5CPJ A;  4QNL A;  4ZUX A;  1H5X A;  4KQR A;  3AZN B;  3H0M C;  5CP6 A;  5CHU A;  2XFS A;  1KGF A;  5B0Z D;  5AV6 A;  5B0Z B;  5F99 D;  4JJN C;  2ZMA A;  3N8S A;  5DNM C;  4E3I A;  3B6G B;  5M18 A;  4NE5 A;  1ONG A;  4E3M A;  3MNN B;  1WWS A;  1BFM A;  3MGR B;  5HL1 A;  3IH9 A;  3NCK A;  1I2S A;  4J8V D;  3AYW B;  1PIO A;  5AY8 B;  2CV5 C;  1P3M C;  4R8P C;  4GHL A;  1EQZ B;  1U35 C;  4E3J A;  3KWQ D;  5B33 C;  2PYO C;  1O07 A;  4MBK A;  1P3B B;  1LHY A;  1P3K C;  2YFV B;  3B6F B;  2FJ7 B;  2F8N A;  4S2N A;  3N8L A;  2H0T A;  3V39 A;  4WU8 C;  4KGC B;  5B40 C;  5E5A A;  1K4E A;  2PYO D;  4J8X C;  4XZQ C;  2FFF B;  2YFW B;  3CJM A;  3LJA A;  4R8P D;  2R9X A;  1PZR A;  3D4F A;  4BL2 A;  1IYO A;  3WS5 A;  3GQZ A;  3V5M A;  1JFI B;  5DNM B;  3AV1 B;  3AN2 D;  4OJ5 A;  5DNM D;  2DQN C;  2XDM A;  4UAA A;  1S32 C;  3BM6 A;  4D2O A;  2C5W B;  3W98 D;  4ZJ2 A;  3X1V A;  4G92 B;  3AN2 A;  4UUZ A;  3UNW A;  4CJN A;  2IO5 B;  1I5Q A;  1JWZ A;  4OQG A;  4EBN A;  4OJP A;  1P3M A;  3VP4 A;  5F83 A;  5I94 A;  4IVI A;  3LZ0 D;  5JYP A;  5FQI A;  5FAO A;  5AVC A;  3REJ B;  3REH A;  2FJ7 C;  1XA1 A;  2V20 A;  3LZ0 B;  3KUY C;  4KGC A;  4OON A;  1KDS A;  5FI6 A;  2PYO A;  5B1M D;  5DNN D;  3GV9 A;  5BS7 C;  5EVI B;  1TZY B;  4GKU A;  1R4V A;  4FCF A;  1F66 A;  1BTL A;  1P3M B;  4DKI A;  3UTA D;  1XXM A;  5E5A C;  2EX9 A;  4R3B A;  4DE1 A;  5CHM A;  4U0X A;  4OOY A;  1AXB A;  5AV8 C;  5AY8 A;  3NY4 A;  1N1J B;  1ESI A;  3REL C;  4Z5T C;  4YS3 D;  3ZVW A;  3Q1F A;  3WKJ D;  4J8W B;  5E43 A;  1G68 A;  3AZG D;  1HQ3 D;  4J8U B;  4GD8 A;  5GSU B;  4U0T A;  4CAY A;  3WTP C;  2XEP A;  5B1M C;  5DNN C;  1S0W A;  2Z2M B;  2Y2G A;  3W99 B;  4IBF A;  5E2G A;  1QMF A;  1M19 B;  3GVB A;  3TU4 D;  3ISG A;  3TU4 B;  4OPZ A;  2F8N H;  1P3L C;  3AZJ C;  4F94 A;  2DRW A;  3REI A;  3OPL A;  2J8P A;  2J8Y A;  4WZ5 C;  1KU5 A;  5GT3 B;  1MXO A;  4S2L A;  5JRG A;  3X1T B;  4PM9 A;  3REK C;  3AGD A;  3V3R A;  2IOU A;  4X56 A;  5HAP A;  4JKT A;  5AV5 C;  3A3J A;  3IQA A;  3MZE A;  4X23 C;  3NQU A;  4QLC A;  3KSY A;  1KE4 A;  1GA0 A;  1KDW A;  3WA9 A;  2EX2 A;  3IP4 C;  4KZ5 A;  3OPR A;  3IHA A;  3JYI A;  3Q7V A;  3AZF D;  4ZDX A;  3C7U A;  3ZHH A;  1K4F A;  3CG5 A;  5FSR A;  2EX8 A;  1NRF A;  3B0B A;  4J8W C;  4JF5 A;  1H8Y A;  2PU4 A;  4IBE A;  4O7D A;  1P3K A;  5AVC D;  3AGE A;  2CV5 D;  4ZJ1 A;  1Q2P A;  3BFD A;  3QNC A;  4EUZ A;  4Z5T D;  5CED A;  3HL9 A;  2ZC5 B;  1CEF A;  2WAE A;  4OLG A;  3PBT A;  4CAY B;  4DE0 A;  3UDX A;  5CPI B;  4LCM A;  1N9B A;  2WKI A;  4G91 B;  1ESU A;  4WEL A;  5CXW A;  1P3B D;  4XZQ A;  3HON A;  5BS7 A;  1SKF A;  1BT5 A;  3IXD A;  4QY6 A;  2X01 A;  1BZA A;  5EVI A;  1YLP A;  1AOI C;  1ERM A;  1PWD A;  5DF8 A;  4XUJ D;  4OVD A;  4XUJ B;  5AV9 C;  2WZZ A;  5FQK A;  2J9P A;  4R0Q A;  4NE6 A;  4E6W A;  1FQG A;  3KXB C;  4PPR A;  2ZQD A;  4WMC A;  3NC8 A;  2Y2O A;  2XK1 A;  5B2J A;  1ES2 A;  5B24 B;  3MGQ B;  1VM1 A;  5B32 A;  4H9S C;  5BNX A;  1AOI A;  3UO9 A;  4AWL B;  1YMX A;  2CWE A;  5D3O A;  5CER A;  5CTN A;  3LJA C;  2P74 A;  3EPK A;  3L2A A;  4Z5T A;  4X55 A;  1BUL A;  3REJ C;  1P3K D;  5BPV A;  3S4X A;  1P3G B;  4Z66 D;  5GXQ A;  2ZQ7 A;  4NYY A;  5CHJ A;  3O62 A;  3WA9 C;  1M6K A;  1T3U A;  1XA7 A;  3IF6 A;  1IYQ A;  4K0X A;  3A1K A;  5C3I B;  3C1C D;  3OCL A;  3C1B C;  3UY6 A;  2P9V A;  4PM8 A;  3G35 A;  3LEL C;  1KX3 A;  2HDU A;  3AYW D;  2ZM0 A;  4H9N A;  4WU9 D;  2XLN A;  4HES A;  1M18 C;  1P34 B;  3MNN A;  4J8V B;  5HAR A;  1YLY A;  4J8W A;  4RYE A;  1P3P D;  4PMA A;  2UWX A;  3WRZ A;  3PAE A;  4DF6 A;  5BO0 B;  3WAA C;  3UTB D;  4KZ6 A;  2ZQC A;  4HGA C;  1P3A B;  5DF9 A;  4IED A;  5B2I C;  5CP6 B;  3LEL A;  1KX3 C;  3QHY A;  4R8P B;  4QLC C;  1HQ3 C;  2PYO B;  4E3L A;  3REK B;  1M18 A;  1S6R A;  5AV8 D;  3EPJ A;  3FKE A;  4NZ5 A;  4R23 A;  5HX9 A;  1K55 C;  3C1B D;  3AV2 A;  1CEG A;  3WKJ A;  3A6N A;  4UPK A;  3KUY B;  5FAP A;  4KUD B;  3I7J A;  4KG5 A;  4R1G A;  3KUY D;  3ZVT A;  1AOI B;  3HVF A;  5CPK C;  4U3T A;  4LG2 A;  3G4P A;  4GDN A;  1SDE A;  2NZD B;  1P3I A;  5AVB C;  2Q9M A;  3G31 A;  3UTA A;  1FOF A;  1LI9 A;  4IBC A;  3ZDJ A;  4OQH A;  3B0D C;  2QMI A;  4WU9 C;  5B1M B;  5DNN B;  1K57 A;  1QME A;  1L0F A;  3AV1 C;  2OV5 A;  5EVI D;  1CK3 A;  3BFG A;  4ZBJ C;  1P3L D;  1ZLA A;  2ZY5 A;  3IH8 A;  3HLG A;  4J8X A;  3AZL D;  4OP8 A;  1HD8 A;  1K38 A;  1IKG A;  1NYM A;  4CPK A;  3X1V D;  4XZQ D;  4E3K A;  3WA9 B;  4FSF A;  5EUA A;  3CMZ A;  5EVI C;  4MLL A;  2XFT A;  4KUD A;  1W7F A;  4UHU A;  1HQ3 B;  2QPN A;  3HUM A;  3H0L C;  3ZNY A;  4EV4 A;  1ES4 A;  5EPH A;  2HIO D;  3B6F C;  4WU8 A;  1U35 D;  5GHY A;  2EXB A;  4M3K A;  4EWF A;  3SS3 A;  2BG1 A;  4XUX A;  3REL D;  3EG5 B;  4KZA A;  1YU3 A;  3M6B A;  1KX5 A;  3LEL B;  5AQA A;  4RVA A;  3LCE A;  3S22 A;  1E3U D;  1BLS A;  5CEB A;  2WGV A;  5B40 A;  4JJN D;  2DCF A;  4JJN A;  2Y2N A;  2BYM B;  3N6I A;  5G49 A;  5KDM B;  4H9Q A;  4X23 A;  2J7V A;  1KX5 B;  5B31 G;  5F1G A;  3SH9 A;  3X1T A;  5FI2 A;  3MXS A;  1DJA A;  4R4S A;  3AZE A;  2XQZ A;  1CI8 A;  1TVF A;  2EFU A;  4QU3 A;  2G5H C;  4Z5T B;  5GT3 C;  4WZS B;  1IKI A;  1MWT A;  3VP0 A;  3HRE A;  3B6G D;  5AVC B;  3X1V C;  5B0Y A;  2JC7 A;  3W97 D;  2XGN A;  5B40 D;  4OUI A;  2ZY4 A;  1TAF B;  1P34 D;  3HLB A;  1GHI A;  1M19 C;  2NZD C;  3LZ1 B;  4Y0U A;  2HP5 A;  4DRB A;  5B24 A;  3EPL A;  5AY8 D;  1WE4 A;  3V50 A;  3W4O A;  2JSS A;  4IBB A;  3AZN C;  2ZQ9 A;  3KWQ C;  3W8K A;  4Z66 C;  1P3A D;  4LD9 A;  4MBF A;  5CTM A;  2Y2Q A;  1Y54 A;  5AVB D;  4WNN A;  2PBY A;  4DXC A;  1PI5 A;  4G92 C;  4GHA A;  3ZG0 A;  1N4O A;  1K55 A;  3GR2 A;  1PYY A;  3FDD A;  4KGC D;  3LJA B;  3IT9 A;  1TZY A;  3WTP A;  1P3I B;  4YFM A;  3ZG8 B;  3AZJ D;  1P3I D;  1A7W A;  5IHV A;  3HUO A;  4QY5 A;  2RCX A;  3O86 A;  5AQ7 A;  3KUY A;  4ZUX C;  3B6F A;  3AV2 B;  5B0Y C;  4RX2 A;  1WYB A;  5AV9 B;  1KVM A;  4S2O A;  4ZJ3 A;  1P3L A;  1ZLA D;  1OME A;  2Q9N A;  3AZI B;  3WTP D;  3X1U C;  1PWG A;  4XUJ C;  2EFX A;  2PU2 A;  3WTP B;  5DVA A;  3PBQ A;  1LL9 A;  1PW1 A;  1WWI A;  3BLM A;  1ZKJ A;  3FWL A;  4JXW A;  1TDG A;  4Z9Q A;  3PBS A;  3AZK C;  4IBX A;  4WM9 A;  3X1S A;  4AWL C;  3UTA B;  3Q7V B;  3IWO A;  1ZC2 A;  3C1C B;  3SH8 A;  5M19 A;  4KQO A;  1K56 D;  2F8N K;  1S32 D;  1YU1 A;  2A3U A;  3RXW A;  1PW8 A;  1S32 B;  3UE3 A;  3AFA D;  1MWS A;  3MGR C;  5HAQ A;  3REH C;  2FJ7 A;  4Z2M G;  1H8Z A;  1JTD A;  3IXB A;  5EEC A;  1MWR A;  1NY0 A;  4J8U D;  3DW0 A;  3AZM C;  5GT0 B;  3VH5 W;  1KX3 B;  5TFQ A;  3G30 A;  5GT0 D;  4BLM A;  5GL9 A;  3BEB A;  1FSY A;  5GSU D;  1P3P B;  3W98 C;  2RL3 A;  3MBZ A;  4KG6 A;  3HLE A;  4QB8 A;  2HDR A;  3F6T A;  1B6W A;  4EBL A;  3AZE B;  4YM6 B;  3L28 A;  3C1C A;  1Q9C A;  2L5A A;  3NQJ B;  5CPJ C;  1L2S A;  4GB7 A;  4BJP A;  3MVD D;  4KZ7 A;  4NFT A;  5GXQ D;  4Z66 A;  4X23 D;  5B31 A;  4IBD A;  1LL5 A;  3E2L A;  5B1L A;  3LY4 A;  5BO0 A;  5AV8 B;  5FUG B;  5EE8 A;  3REK D;  1G6A A;  3LZ1 C;  5BNV B;  4J8U A;  1P3F D;  4UA7 A;  3IWI A;  3W99 A;  4WU8 D;  1ZG6 A;  4LV3 A;  3AV1 D;  2VGK A;  5F99 C;  3R45 B;  3IWQ A;  1K56 A;  5AV9 A;  2H5S A;  4CSR B;  5B0Z C;  3DTM A;  1FCO A;  1AOI D;  1HTA A;  3CZD A;  4C75 A;  2I72 A;  3TU4 C;  5DF7 A;  4S2P A;  3UT9 A;  4GH9 A;  1BLH A;  5B2J D;  3SH7 A;  3REH B;  2HUE B;  4OJ6 A;  1XPB A;  3REH D;  3GTC A;  1SHV A;  3AZM B;  2F2A C;  2ZD8 A;  2OLV A;  3A3I A;  1TZY D;  5M1A A;  5B32 G;  5CPI D;  4YS3 C;  3V9R A;  3X1S C;  3O3V A;  3AZL B;  4LD9 C;  4ID4 A;  2Y2M A;  4HBU A;  1YLT A;  3W96 C;  5B32 D;  4EO5 C;  3VOZ A;  3EQU A;  3WAA B;  2ARO B;  5DNM A;  5DTT A;  3LZ1 A;  1KX5 C;  3ZG9 B;  3IF6 C;  1ERQ A;  3AV1 A;  3IHB A;  1XX2 A;  4FD8 A;  2F8N G;  4DQY B;  3V3S A;  4N9L A;  2NQB A;  2HIO B;  1BLP A;  5AV8 A;  5AVB A;  1M18 D;  5E2E A;  3MGP A;  3AZJ B;  4ZTK A;  2WKH A;  4H8R A;  4KZ9 A;  5E2H A;  1EI5 A;  3MVD A;  3AYW C;  3LEL D;  5B24 D;  1ES3 A;  3VH6 W;  1Q2Q A;  3AV2 C;  3HSH A;  2XF3 A;  3MGS C;  3MGQ D;  4DE3 A;  4IVK A;  4CSR A;  4JF4 A;  3HLC A;  4FH4 A;  3AZI D;  4IJF A;  1E4D A;  5GT0 A;  2JE5 A;  1TEM A;  3X1U B;  4NY2 A;  5AV6 B;  1YM1 A;  3ITA A;  5B1L D;  2XD5 A;  4OLD A;  5JRG D;  3N3F A;  5AV6 D;  1XGI A;  4HEF A;  4B4Z A;  4EO5 B;  3REI C;  2ZM2 A;  2ZJ9 A;  3TOI A;  5B31 B;  4IBG A;  2V1Z A;  4A5R A;  5B24 C;  4OJO A;  2H10 A;  5EVL A;  1FR6 A;  3LO7 A;  5GLB A;  2CV5 B;  5F99 B;  3TG9 A;  3REL A;  3B6G C;  3RJU A;  1KX4 C;  2G5I C;  3W97 B;  3UTA C;  3QNB A;  3OPH A;  3KXB D;  3AZI A;  2W8S A;  4K91 A;  3SOI A;  4H9R A;  4KG2 A;  3WX7 A;  4N1X A;  1F66 C;  4YS3 A;  1DY6 A;  1E3U A;  4JBF A;  5AQ9 A;  2FJ7 D;  3NBL A;  3LZ0 C;  5CGX A;  4P87 A;  3UPN A;  1JVJ A;  1F1E A;  3P98 A;  1RGY A;  4RX3 A;  2E8I A;  1BH8 A;  1S32 A;  1P3O A;  2IWD A;  3UTB B;  1PZP A;  4PM7 A;  5B32 C;  3VSK A;  5CGS A;  1GA9 A;  3X1S D;  2HIO A;  3AZJ A;  4MEZ A;  4H9P B;  2IWB A;  1F66 D;  4KQQ A;  4GOG A;  1L0E A;  4DXB A;  3SS4 A;  3MKF A;  3DWK A;  3AZG A;  4WV4 B;  1BH9 B;  5B2I B;  1WYC A;  3NDG A;  3BFE A;  3ZG7 B;  5B2J C;  3WAA A;  4NZ4 A;  4S2N C;  1IEM A;  4IJE A;  4OP5 A;  4BEN A;  2HIO C;  2BYK A;  3W98 B;  5HW3 A;  4LEN A;  4WBG A;  3MGS A;  3VMA A;  3AZF C;  3W96 A;  5E2F A;  5B0Y B;  1HVB A;  5B33 D;  4JXS A;  3LZ0 A;  5L2F A;  5B0Y D;  3PAG A;  1P3M D;  3VFF A;  3HLF A;  3Q07 A;  4R8P A;  5KSC A;  3MGS B;  1K6S A;  3WS2 A;  5DTK A;  3Q82 A;  1ALQ A;  3MGQ C;  1P3A A;  3X1V B;  4XZQ B;  4E3O A;  3EQV A;  3AZH B;  3R45 A;  5BT1 D;  4YIN A;  3S1Y A;  5FQM A;  3AZF A;  4BD1 A;  1ERO A;  2NQB C;  1IEL A;  3VP1 A;  4OJL A;  4N92 A;  3MKE A;  1YLJ A;  1P34 A;  2HP9 A;  4ZBJ B;  3MGP C;  3W99 D;  4EBP A;  2CV5 A;  1TAF A;  4LCL A;  4KZB A;  3RXX A;  4H9N B;  5JA4 A;  3B0D B;  1RCJ A;  1W8Y A;  3AZI C;  1NZO A;  3AZE D;  1SCW A;  4KHA A;  4J8U C;  4GDB A;  3B0C T;  2F8N D;  3AZN A;  1KE3 A;  1P3O B;  1KX4 B;  4YM6 D;  4ZUX B;  1ULY A;  1BH8 B;  1TDL A;  5HFO A;  2F8N B;  2XR0 A;  3W97 C;  1Z6F A;  1Z2C B;  4G91 C;  1P3P A;  3MNN C;  3FYZ A;  3O62 C;  1VQQ A;  3N7W A;  3X1T D;  3O62 D;  1LI0 A;  4N9K A;  5DTS A;  4RA7 A;  5GT3 D;  4YM6 C;  1HTZ A;  3O88 A;  5CPI C;  1P3F B;  5KZH A;  2ZY2 A;  2Y2L A;  2WK0 A;  3KS4 A;  3VH5 A;  5F99 A;  3B0C W;  4KUD D;  1KX5 D;  3AZK B;  3HUN A;  3N4I A;  3BYD A;  5B2J B;  4E44 A;  4OPQ A;  1KX4 A;  1XGJ A;  3WTP E;  3TU4 A;  4GD6 A;  4GN2 A;  3Q7Z A;  4DE2 A;  5B1M A;  5DNN A;  3C1C C;  5JA4 B;  1KE0 A;  3VP2 A;  5AV5 A;  4Q8I A;  4C6Y A;  5F1F A;  1NYY A;  4X53 A;  1EWZ A;  1LLB A;  2ARO A;  3L29 A;  5FI7 A;  3LZ1 D;  2JCH A;  4E45 A;  4J8X D;  3AZL A;  3AZH A;  1KGG A;  1MBL A;  3B6F D;  1EQZ C;  5A92 A;  1P3G C;  3A3D A;  5A90 A;  1RGZ A;  1O7E A;  1DJC A;  3AGF A;  3KFU G;  5CPI A;  5FAS A;  3AZM A;  4BQM A;  2WGW B;  1W8Q A;  5AVB B;  3OC2 A;  3C4O A;  4KZ8 A;  1P3F C;  5GSU C;  2V2F F;  1KVL A;  2HDQ A;  1YUE A;  1H3O B;  4JLF A;  3AZL C;  2Y2K A;  3UT9 D;  2EXA A;  1W79 A;  4GNU A;  4WNN B;  5GXQ C;  5FQ9 A;  3AV2 D;  3UPP A;  4IBJ A;  1K57 C;  5AV9 D;  4XXR A;  3OZH A;  3C4P A;  4Y7P A;  1JFI A;  5BNV A;  1SDN A;  3PTE A;  3C1B A;  5A91 A;  3C7V A;  5TR7 A;  5GT0 C;  2XH9 A;  4WU9 A;  5FQJ A;  3A6N C;  3NIA A;  5B33 B;  3WS4 A;  1P3B C;  1YU4 A;  5B31 D;  3G2Y A;  2ZC7 A;  1ZLA C;  1YMS A;  3BRM A;  2X71 A;  2VGJ A;  1NZU A;  3ZFZ A;  2J9O A;  3MNN D;  4ZAM A;  2HDS A;  4X68 A;  4YS3 B;  1CI9 A;  3VH6 A;  4J8W D;  3AFA B;  3AL0 C;  1KX3 D;  4WZ5 A;  1B67 A;  4BD0 A;  4QJG A;  3PBO A;  1GHP A;  5TGF A;  5BNX B;  3P09 A;  5AV6 C;  5FQQ A;  1EQZ D;  5B1L C;  1N1J A;  3W99 C;  1IYS A;  2WZX A;  4WYY A;  3L26 A;  3VH5 T;  4FH2 A;  5CP6 D;  3M2J A;  1P3A C;  2GDN A;  3MGP D;  4YM6 A;  4ZUX D;  3SS5 A;  4UA6 A;  1F66 B;  1H3O A;  4BL3 A;  2Z2L B;  5BT1 C;  1P3I C;  1M40 A;  3O62 B;  2NQB D;  1U35 A;  4MNR A;  2HUE C;  4UA9 A;  4E3N A;  1M1A C;  4B4X A;  4WU8 B;  4KGC C;  1BUE A;  5HAI A;  4QHC A;  4H9O B;  3AN2 B;  3C1B B;  1J9M A;  4OKP A;  3MVD C;  3LEZ A;  1YLW A;  1ZLA B;  5B31 C;  2CC1 A;  2OSU A;  4WMC D;  2NZD D;  4KEN B;  3AZG C;  4GZB A;  3WRT A;  4NZ1 A;  1PZO A;  4C3Q A;  2ZQ8 A;  2YFW A;  3Q81 A;  3O87 A;  3OCN A;  4DRT A;  5A93 A;  3HBR A;  2Y4A A;  5GLA A;  3G34 A;  3W96 D;  4KZ4 A;  3AZM D;  3UE0 A;  4LD9 D;  2B5R A;  5CHL B;  1P3L B;  4WZ4 A;  3NI9 A;  3W4Q A;  1FSW A;  1ONH A;  5AQB A;  3WKJ B;  3NDE A;  3AZH D;  4JXG A;  2WAD A;  1P3B A;  3IXG A;  3UT9 C;  2Y91 A;  1M1A A;  3A6N D;  5FAT A;  3WS0 A;  3WAA D;  5EOE A;  1JWV A;  3A6N B;  2ZC3 B;  1P3F A;  1P3P C;  3UDF A;  4E6X A;  3FKW A;  3BFC A;  1K54 A;  5FA7 A;  4P0M A;  5GHZ A;  3EPH A;  5CPK B;  3B6G A;  3MZF A;  4LV2 A;  3VFH A;  1U35 B;  3VSL A;  3A3F A;  1M18 B;  2ZM8 A;  3FZC A;  5C3I C;  3AN2 C;  1FCN A;  1P3O D;  1KX4 D;  1PWC A;  2WAF A;  3KWQ A;  3ZGA B;  4JXV A;  4B88 A;  5KDM A;  3OPP A;  4KHA B;  4OOL A;  4X69 A;  4DDS A;  5AVC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...