2Y2PA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
489
structure length
466
Chain Sequence
ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 157
structure length 466
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2pA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2pA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2pA02
4KZ4A 2J7VA 3ZG5A 1MWTA 3UDIA 4GD6A 1NRFA 5EVID 4KQOA 2WGVA 2OV5A 5CEBA 1KDWA 2ZLYA 5CTNA 1PWDA 5EVIB 1BSGA 1JTGA 2WKIA 4OLGA 3VP4A 3G30A 3G2YA 3A3DA 2XDMA 4RX3A 1FSWA 1K57C 1CI8A 1K4EA 4MBFA 2WGWA 2WAEA 3GQZA 4LCLA 5A90A 1YLPA 3MZEA 1LL5A 3IXDA 4GKUA 4S2OA 1FOFA 3DWZA 4HESA 2BLSA 1K25A 3HUMA 1BLCA 3QNBA 3IT9A 4H8RA 4IVIA 4X53A 4ZBEA 3ZG9B 4A5RA 1SKFA 4U0TA 3MZDA 3LY4A 5HAPA 4GDBA 5DF7A 1NYMA 1PZOA 2Y91A 3GMWA 1GHIA 3Q82A 2JBFA 3MKFA 3O3VA 3UPPA 4MNRA 1QMEA 3LO7A 1YLYA 5F83A 3SS5A 4OQIA 3MXRA 3CZDA 4GOGA 1NZOA 5HARA 4KQRA 4OOLA 2ZC4B 1YLTA 3PBOA 1HZOA 2Y59A 4Y7PA 3WS0A 5A92A 4HEFA 5CGWA 4GN2A 2Y2JA 3IWQA 2WKEA 3P09A 4OH0A 4MLLA 3UPOA 4EUZA 3ZNTA 5GL9A 5HX9A 1XX2A 3UE0A 4OQ0A 3SH7A 5EOEA 2PBYA 2VGKA 1ZC2A 4ZDXA 1LHYA 3VOYA 3D4FA 5GLBA 1L0DA 5F1FA 1K38A 4IEDA 3NCKA 2UWXA 2DRWA 1H8YA 2WAFA 1XGIA 1DY6A 5FQ9A 4ID4A 4WMCD 5EVIC 1O7EA 3G35A 4X56A 3CJMA 2WUQA 3N8LA 5EUAA 4BJPA 1K4FA 1BUEA 4OOMA 1K56D 1K54C 4JF6A 3Q1FA 1W5DA 3UPNA 1KE4A 1WE4A 2WGIA 1W79A 5EPHA 4M3KA 1XA7A 5A91A 4U3TA 1PWGA 1WYBA 3S4XA 1DJCA 4DXBA 2Y2MA 3NY4A 3VMAA 1CEGA 3SS3A 1MWRA 1TEMA 4S2IA 4GB7A 1EROA 2JE5A 1E3UD 3CMZA 3N4IA 4FH2A 5FQKA 4JXGA 3E2KA 2QMIA 3HBRA 4GNUA 3HLEA 2XK1A 3IQAA 3WS1A 2Y2NA 1RGZA 1XPBA 1PIOA 2WK0A 4IBRA 4NETA 1CEFA 2ZM8A 3HL9A 3SOIA 5E2FA 1VM1A 2Y2IA 3A3EA 3M6HA 4E3JA 5KSHA 1NZUA 1KE0A 2HP6A 2ZC3B 1BULA 4X6TA 2H5SA 3ZG0A 2EFXA 2P9VB 3G31A 1AXBA 2HP9A 4DE1A 4KQQA 4FH4A 4P85A 4S2PA 3PTEA 4B4ZA 4DXCA 1IYOA 3IHBA 2ZQCA 3BECA 1QMFA 4WZ5C 3MZFA 3C7UA 5GHXA 3UE1A 2C5WB 1YMXA 1PI5A 2EX9A 1G68A 2PU4A 3BFCA 3Q07A 4PPRA 2J9OA 2E8IA 1L0EA 2ZC5B 4GZBA 3BLMA 1Q2QA 5J8XA 5HW3A 3PBNA 4JLFA 3HLWA 1ES2A 4BLMA 1J9MA 4XUXA 4PMAA 4OPZA 2R9WA 4BL2A 1K55A 1HTZA 4S2KA 2HDRA 1JWVA 1IEMA 1FR6A 4R1GA 2WGWB 3MBZA 3IF6A 2J8YA 4B88A 4JKTA 2Z2MB 4XXRA 3VFHA 4EBPA 2Q9NA 3W4QA 2Y4AA 5HFOA 1W8QA 3V3SA 3BEBA 3IXBA 4OKPA 4R3JA 1YLZA 1K6RA 3NBLA 1ES4A 1ZG6A 2QZ6A 3OCNA 4KZ7A 3UDXA 4IBXA 3N8RA 3HLFA 5TR7A 4ZJ1A 3PAEA 3Q7VA 5FI6A 1XA1A 3GV9A 2FFYA 3M2JA 2XQZA 1KDSA 3IXHA 3G34A 4K91A 1JWPA 3NC8A 4X55A 5DVAA 1BLPA 1IKIA 3HLGA 5FI2A 1IELA 4RYEA 1E4DA 4WBGA 5HAIA 4B4XA 3VP0A 5E2GA 1FCNA 1PYYA 2ZC6B 4KZ3A 3ZVTA 2Y2HA 1RP5A 3N6IA 4OP8A 4GD8A 2GDNA 1SCWA 4ZJ2A 2PU2A 4EBNA 3FWLA 2H0YA 4OQGA 4QU3A 1CI9A 3NDGA 3C4OA 4R0QA 3EQVA 4BQMA 4R3BA 3ZDJA 4BENA 1FSYA 1OMEA 3AGFA 4QB8A 1H5XA 3W8KA 3WRTA 3FZCA 3SS4A 5HAQA 3PBSA 2BG1A 1U60A 5AQAA 1RGYA 2VGJA 3IF5A 1BZAA 1DJBA 3GTCA 4UAAA 3P98A 5JYPA 3UY6A 3OC2A 3VSKA 5L2FA 3UDFA 2V20A 1GCEA 2HPBA 2V1ZA 4KZBA 3VOZA 1K54A 5AQ9A 5M18A 2ZD8A 1ONGA 5FASA 1YLJA 3C4PA 4F94A 4U0XA 1YT4A 4Y0TA 4C6YA 1BLSA 3RXXA 2Y2QA 2EX6A 3G2ZA 2XFSA 1H8ZA 3ZGAB 2JCHA 3C7VA 3BLSA 1M40A 1BT5A 2CC1A 4HBTA 1ERMA 3M2KA 4GDNA 4RVAA 2C6WB 4N1HA 2XFTA 4S2MA 5CECA 4QY6A 2ZM2A 5G18A 5DTTA 1I5QA 4EV4A 2XF3A 4DKIA 4JXWA 3WS2A 3SH9A 3HUNA 2Y2GA 4P0MA 3ZCZA 4BD1A 3S1YA 4N1XA 3BM6A 2HP5A 2X01A 3V50A 4RX2A 2A3UA 4DRTA 5EECA 2XD5A 5FDHA 4S2NA 4JXSA 1M6KA 2H10A 2FFFB 3O87A 4JBFA 3RJUA 2Y2OA 4LCMA 5KSCA 3OCLA 4JF4A 4LENA 3EQUA 3LCEA 2Z2LB 1WYCA 3C5AA 3FYZA 2XLNA 4FCFA 1SDNA 5GHZA 1LI0A 3IH8A 1L2SA 5DTSA 1LLBA 1N9BA 4EQIA 5F1GA 3W4OA 1S6RA 4C75A 3SH8A 3LY3A 4K0XA 4KG5A 4X68A 2RCXA 3BFGA 5EVLA 2JC7A 1XP4A 4P87A 5DF9A 2HDQA 1GA9A 3B3XA 3HVFA 2IWBA 2XGNA 2HDUA 3ZVWA 3BFDA 1TDLA 3IF6B 1NJ4A 1G6AA 3A3FA 3BFEA 4X69A 5IHVA 3DTMA 1HVBA 3OPLA 4DDSA 2QPNA 2IWDA 1BLHA 1GHPA 4E6XA 4R23A 1ZG4A 1NY0A 1ZKJA 2R9XA 3OZHA 3NI9A 1BTLA 2OLVA 4MBKA 4IVKA 5CERA 2ZC7A 3ZG7B 5CGSA 1IYSA 1IKGA 2EX2A 2WZZA 2XD1A 2IWCA 4OPRA 1K57A 4E6WA 4OONA 1I2SA 5E43A 1PI4A 1K6SA 2WKHA 3V3RA 4WYYA 4L0LA 4UA9A 3VSLA 4JXVA 5GHYA 5F82A 3FV7A 3LEZA 3BRMA 4LV0A 4WELA 1ES3A 4FSFA 3VP2A 2ZMAA 4Q8IA 3IXGA 5BOHA 3VP1A 5M19A 5DF8A 5A93A 3GSGA 4QD4A 5CHJA 4WZ4A 3HLBA 4E3NA 4NK3A 2RL3A 4EWFA 3BFFA 1FQGA 4E3OA 3TSGA 1S0WA 2P9VA 4KG2A 3UN7A 4LV2A 1ERQA 2EX8A 2ZQ8A 3M6BA 3QNCA 1I2WA 4JPMA 3GVBA 4KZ5A 3IHAA 3S22A 1IYQA 2OLUA 4KZ6A 4EBLA 1YQSA 3DWKA 3I7JA 3G4PA 5HL1A 4C3QA 4DDYA 4DF6A 3PAGA 5TGFA 1NXYA 1GA0A 3Q81A 3E2LA 4KG6A 3UE3A 4MEZA 4D2OA 1YM1A 4R4RA 4RA7A 4PM6A 3ZG8B 2Y2PA 3NIAA 5KMWA 3WS5A 2X71A 3ITAA 4JF5A 4E3LA 1K55C 3DW0A 4OOYA 4Y0OA 1ALQA 1PWCA 3FKWA 5CEDA 4QHCA 5CHMA 3IF6C 1XGJA 5CXWA 5KZHA 5AQBA 4PM8A 3O86A 3ISGA 1ES5A 1JTDA 1FR1A 3IWIA 1Q2PA 4KZ8A 1HD8A 2Y2KA 4UHUA 1LL9A 4CJNA 1MKIA 5EVIA 1Y54A 1VQQA 4PM9A 4YFMA 5FSRA 5FA7A 1KE3A 2Y2LA 2Y55A 1PW1A 2ZQDA 3OPRA 5FQJA 3FKVA 4E3MA 2WYXA 4KZ9A 5U47A 2EFUA 1Z6FA 4OVDA 5I94A 2WZXA 2H0TA 3Q7ZA 3PBRA 3VFFA 4WEKA 1E25A 3WWXA 3UNWA 4E3IA 3MXSA 3V5MA 1XXMA 2OSUA 3TOIA 5TFQA 2ZQ7A 2HDSA 3BYDA 3JYIA 2DNSA 3QHYA 4PM7A 4ZJ3A 3VP3A 4PM5A 1ESUA 1MY8A 1SDEA 5D3OA 1MXOA 3MKEA 1W8YA 3ITBA 4XUZA 1CK3A 4O7DA 2ZQ9A 3W4PA 3O88A 2A49A 4MBHA 4QY5A 4KENB 2V2FF 4UA7A 4OPQA 3ZNYA 5GLDA 1KGEA 4WM9A 2ZJ9A 3RXWA 3IWOA 1RCJA 4BD0A 3OPHA 5DTKA 1NYYA 4DE3A 3PBTA 2G2WA 1GHMA 1EWZA 3A3IA 4WEJA 5FATA 1IYPA 3ZFZA 4OP5A 4DE0A 5CTMA 4WZ5A 3A3JA 5AQ7A 3GR2A 5M1AA 4BL3A 1JWZA 3IH9A 2Q9MA 3V39A 1TVFA 3AGEA 3WS4A 1EI5A 1YMSA 4N9KA 4KZAA 5FQIA 3WRZA 4YINA 5GLAA 2DCFA 2B5RA 4S2JA 2G2UA 3N7WA 4FD8A 1C3BA 1FCOA 4Y0UA 4P6BA 3N8SA 2EXBA 1KGGA 5FAQA 4WMCA 4DE2A 5JYOA 3TG9A 1MPLA 1L0FA 4HBUA 1MWUA 4N92A 3AGDA 5E2HA 1MBLA 2P74A 3HREA 2WADA 1K56A 2XR0A 3CG5A 5FAPA 1N4OA 5FQMA 4OPYA 2ZQAA 3Q7VB 4R4SA 3HUOA 2X02A 4UA6A 4ZTKA 1FCMA 4LV3A 4S2NC 4ZAMA 2XH9A 3MFDA 5FQQA 4E3KA 4QJGA 3GRJA 5EOOA 3OPPA 3HLDA 1SHVA 1XKZA 3PBQA 1ONHA 4N9LA 2EXAA 3HLCA 3ZHHA 1PW8A 2ZM0A 1E3UA 5FI7A 4CPKA 5E2EA 1MWSA 1JVJA 3UO9A 1KVMA 1L0GA 1PZPA 1TDGA 1LI9A 5EE8A 4OQHA 5CRFA 1DJAA 3NDEA 5CHUA 2J9PA 5CGXA 4OLDA 5FAOA 1KVLA 1O07A 2XEPA 4Z9QA 4K0WA 4LV1A 4S2LA 5GLCA 3G32A 1ESIA 1YLWA 1KGFA 1W7FA 2I72A
chains in the Genus database with same CATH superfamily
2W3GA 3HJKA 1ID3C 1NRFA 4GD6A 5AVBA 4J8WA 1KDWA 1P34A 2NQBB 1PWDA 1YU3A 5B2IC 3VP4A 5DNNA 3G2YA 4IBBA 4J8UA 1P0ZA 4RX3A 2FH5A 5C5KA 2WGWA 2WAEA 5B2JA 3EPKA 3CHWP 4LCLA 1G28A 1ACFA 4GKUA 3A0VA 3DWZA 3S7OA 3HUMA 3IT9A 4IVIA 1SKFA 3L29A 2HUEC 3MZDA 5G4YA 5F99D 4AWLB 4PAUA 5DF7A 2Y91A 4R70A 2JBFA 3E98A 1YLYA 4GOGA 3C1BD 2IA2A 2DF4C 1LSVA 4DJ3A 2Y59A 4Y7PA 3WS0A 3AZNC 4GN2A 3OOVA 5B32G 3MNND 3BY8A 3REJD 4HJ4A 4WUJA 3NQUA 3VOYA 4IEDA 5B24C 2WAFA 1XGIA 2NQBC 4ID4A 4WMCD 5DFYA 5L10A 4J8VD 5GT3A 5AV5A 2WUQA 3MGRA 3H0LC 1K4FA 4E44A 4NXBA 4ZBJB 2Z6DA 3QP5A 4JF6A 4XT2B 1WE4A 5EPHA 2WGIA 3UPNA 3X1SA 1UR9A 5A91A 3LZ1D 1PWGA 1WYBA 3LIBA 4Z66D 2Y2MA 3T4KA 3VMAA 1P3OB 3SS3A 1XJ6A 3REKD 4S2IA 4UUZA 4H6JB 1EROA 3CMZA 1KX3B 1XJ2A 4JXGA 2M7VA 1VB6A 2QMIA 4L9GA 4ZRRA 2XK1A 3AZJA 3DAVA 1RGZA 1XPBA 3SOIA 1W2EA 3B6FA 2ZM8A 1VM1A 4HHDA 2VA0A 1BULA 4X6TA 3ZG0A 2EFXA 3G31A 4O8GA 4F3LB 4KQQA 2L0WA 4FH4A 4S2PA 2PYOC 3PTEA 2QJ7A 2OAP1 4B4ZA 3WAAA 4Z2KA 1P3LA 2ZQCA 3BECA 5AV8B 2C5WB 1YMXA 5F5YA 5EFWA 4NXFA 4CQHA 5L07A 1ZLAC 4ZUXD 5B2IA 1F2KA 4Z2MH 1ES2A 1J9MA 3EEAA 4GCZA 3L2AA 1HTZA 4S2KA 1JWVA 1AOIA 3WA9B 1IEMA 4R1GA 3NHQA 3RELA 2J8YA 2Z2MB 4DMZA 1P3IB 1S32D 1T18A 4ZBJC 1W8QA 2PAVP 4OKPA 1K6RA 4IBFA 3NBLA 2QZ6A 3UDXA 3OCNA 5B0YA 4BBVA 1DP8A 2F8NG 1P3OC 3PAEA 2FFYA 3IXHA 1KX5A 2GJ3A 1JWPA 3HLGA 1KX3C 1N9NA 1IELA 3O62D 3VP0A 4PKYG 5E2GA 3AZGD 2ZC6B 2Y2HA 3AZNA 4GD8A 2GDNA 4EBNA 3HCYA 1J7MA 5E5AD 2PD7A 4BQMA 3H82B 4R3BA 4GW9A 3W8KA 3SS4A 1YU4A 5B1MA 3KS8A 5AV8C 3GECA 5AQAA 5B1LD 5B24A 2VGJA 1EAKA 2BYKB 3LZ0D 4IJGA 4UAAA 3ULFA 3P98A 3E4OA 2VEAA 4R3AA 5BT1D 4LLOB 2IO5B 2QYBA 4XZQA 5CPIA 3T4SA 3AFAD 3LI9A 3S7PA 2W1TB 3WA9C 1ONGA 4F94A 4Y0TA 4HGAC 1P3IC 1BLSA 2Y2QA 2EX6A 3X1VD 5B0ZA 4WU9B 3AZHA 1E15A 3BLSA 2GNXA 3LZ0A 3KFUG 3D9YA 1M40A 1ZHHB 2OAQ1 4HBTA 4EXOA 3M2KA 1B67A 1T3UA 3VH5W 4RVAA 4N1HA 2XFTA 3W2ZA 4KGCB 4UEYA 2FJ7B 4G91B 1I5QA 4I39A 4EV4A 4DKIA 5HDSA 3WS2A 3ZCZA 2HP5A 3REHA 3VH6A 3QP6A 3V50A 1TS7A 4DN0A 5EECA 2INWA 1V9ZA 1P3AB 1M6KA 2H10A 2PYOA 3OCLA 3EQUA 3LCEA 2CMNA 3B0CW 1SDNA 1LI0A 3TW8A 1ZLAA 5DTSA 4YM6D 1X0OA 3R45A 2HIOC 1P3GB 5GSUD 4X68A 4GJ4A 3BQAA 4Z2LA 2JKTM 5EVLA 2JC7A 3M7PA 2HDQA 4R8PB 2HDUA 4WF0A 3BFDA 2IO5C 5J7EA 1G6AA 3BFEA 3OPLA 5BNXB 4DDSA 4H9SC 1GHPA 3VV4A 3C1CD 3MF0A 4R23A 1NY0A 2R9XA 2R78A 1SKOA 2JKRI 4H9PA 2ZC7A 3TU4D 5CGSA 1T1BA 1IYSA 2JKFA 2IWCA 4OPRA 3DTKA 1LT0A 1K6SA 3V3RA 3KWQD 4L0LA 4KGCC 5GHYA 3FV7A 3CLOA 4JGQA 4G91C 3MGQB 4Q8IA 4Z5TB 4NZ5A 4Z2GA 4H9RA 5CPKC 3MR0A 4WN5A 4WZ4A 3B0CT 2W27A 4YS3C 3TSGA 4LV2A 2EX8A 4JPMA 4F3LA 3GVBA 3LEQA 1M18D 2VGLS 4KZ6A 5AV8A 1EQZD 2JKTI 5HL1A 4C3QA 5HPIA 1GA0A 3Q81A 4KG6A 4MEZA 4D2OA 1YM1A 3IS2B 1P3GC 1H0MA 2X71A 3AZKC 1AIWA 4NG2A 4E3LA 4R8PC 5B31B 4Y0OA 3A6NB 1OTDA 3UTBD 3MVDD 3AYWB 1TAFB 1LSXA 5CXWA 5KZHA 4PM8A 4QLCB 4CLCE 1KX4A 5DNMA 5B32A 1ES5A 1YUEA 1S66L 3UE6A 5CP6B 1YSQA 3IWIA 1Q2PA 4KZ8A 1HD8A 2Y2KA 1LL9A 1TZYB 1Y54A 1VQQA 5FSRA 2Y55A 1GOIA 1P3PA 2ZQDA 1IOUA 5CPJB 4X23A 4DJ2A 5B40A 3UTBA 1P3KD 3W97B 5JRGA 3WWXA 3MGQC 2VV7A 3T1QB 3UNWA 4E3IA 5GT0A 2PYPA 3TOIA 4Z5TC 4JJNB 1HQ3C 1CXWA 2ZQ7A 4WNNB 2CV5B 2HDSA 2GZAA 3JYIA 3R7WB 3EG5B 3K2NA 5B33D 2V0UA 1MXOA 2E8JA 1W8YA 3BW6A 4MBHA 3KUYA 1VEUA 4OPQA 2HIOA 3KXBD 3A1IA 2ZJ9A 4BD0A 1TS0A 4M6BA 2OOLA 3V9RB 1UWNX 4DE0A 4ME4A 5IU1A 3KO6A 3A3JA 3QP1A 5B31C 1NWZA 2M1CA 3A6NC 5GXQD 1ODVA 3AYWC 3AZED 3WS4A 3PHYA 3WD2A 1EI5A 4QLCC 3UMEA 4ESPA 5FQIA 3WRZA 5L8MA 2DCFA 5CP6C 4HH2A 2B5RA 2RVQC 3LICA 1TZYC 4AFIA 4OJ6A 2K2NA 4P6BA 2ZY4A 1MPLA 2F8ND 4GH9A 4N92A 3MGSD 3AV1B 3AGDA 1E6PA 1MBLA 2DMWA 4H9QB 5CPJC 2B02A 2XA7S 3DTEA 1M19A 4WJ3C 3WTPB 2XR0A 5F68A 3S7QA 5CPKA 3TJZC 1GSVA 4OPYA 2ZQAA 5AV6C 4YS3A 4ZTKA 5FQQA 1FCMA 4Q0JA 4ZAMA 4E3KA 4QJGA 1F66B 2CWEA 5EOOA 5FL3A 2NZDD 2CV5C 3HLDA 5FUGB 1SHVA 1R4VA 2EXAA 3W96D 5AVCB 5FI7A 3T1XA 2P7JA 5CHLB 3T4TA 1JVJA 3AZIA 3UO9A 1KVMA 1LI9A 1P3MD 5EE8A 5CRFA 1DJAA 3NDEA 1OTBA 5CHUA 1YU2A 3KYQA 3AV2D 1KVLA 1O07A 4Z9QA 3AZKA 4S2LA 2VV6A 3C2WA 1KGFA 1U35D 4KZ4A 3ZG5A 3X1TC 3UDIA 5EVID 2OV5A 4KQOA 5CTNA 1BH8A 3G30A 2FN2A 2G5HC 3A3DA 2XDMA 3REID 1K57C 4MBFA 4EQ1A 1B6WA 4BMWA 3MZEA 1BFMA 3AV1C 3IXDA 1H0GA 4D60A 4MN6A 1K25A 4H8RA 1BLCA 3QNBA 4X53A 3ZG9B 5FEGA 3CUEA 1HQ3A 3LY4A 1F9IA 5F6AA 1NYMA 1GHIA 5F99B 5J3WA 3ICYA 2J3TC 3SS5A 3CZDA 5HARA 1NZOA 5HWVA 2ZMFA 3REIA 2WKPA 4P6ZS 2O0YA 5AVCC 1HZOA 3C1BB 3P5JB 1VETA 3UPOA 3IS2A 1GSWA 3UE0A 4X25A 1W1YA 3MNNB 5DJTA 3MQQA 4JGRA 3REJB 5B31A 2PBYA 2VGKA 3A6NA 3RFBA 3D4FA 4Y15A 3MQ0A 4I3JA 5GLBA 5F1FA 3UTAD 3H7WB 4KUDA 1TZYA 1P3FA 4X56A 4J8XC 3WD0A 5EUAA 3F6TA 4J8VB 3LELD 4XUJD 1K56D 1W79A 4HQAA 4M3KA 4DXBA 1DJCA 2GX5A 2G7UA 1CEGA 3LZ1B 4Z66B 5AV6A 3KS4A 3AZLB 2JE5A 3UB6A 5AV9A 3KSHA 4WNNA 1E3UD 3N4IA 4NZ3A 4FH2A 3E2KA 3HBRA 3EPJA 4GNUA 4FTXA 3WS1A 4H9OB 4NETA 1BH9A 3HL9A 3LI8A 5E2FA 3M6HA 1M1AD 3SW1A 1KE0A 5HSQA 2ZC3B 3C1BC 2Y8HA 2HP9A 4P85A 4GS9A 2MJ6A 2AROA 4DQYB 1V9YA 1JFIB 1OTIA 5AVBD 4J8WD 1QMFA 3MNNC 3KSFA 1P34D 3UE1A 3X1TA 3N3FA 3REJC 1PI5A 2PU4A 3BFCA 2F8NK 1L0EA 2ZC5B 3BLMA 5DNND 2DQNC 5HW3A 2D01A 4J8UD 3PBNA 4JLFA 3HLWA 4ZUXB 4PMAA 2ZL1B 4OPZA 1F98A 5B2JD 2V5OA 3UT9A 1K55A 4BL2A 1TS6A 3LR0A 3MBZA 4IBDA 2EA9A 3V3SA 3IXBA 1S32B 1ZG6A 3T1SA 3BQ8A 3HLFA 5TR7A 3KSYA 2YFVA 3LZ1C 4Z66C 1E8BA 5FI6A 3AZLC 3DTIA 3G34A 4X55A 4B9OA 3W99A 3IX8A 4RYEA 2O9AA 1PYYA 4KZ3A 3N6IA 3O62B 3FWLA 2H0YA 3AZGB 5IT5A 3NDGA 4R6LA 3W98A 4L9FA 1J3WA 4TX8A 4X1MA 5E5AB 1FSYA 1N9LA 1OMEA 3AGFA 3CPTB 1LL8A 3IX4A 3FZCA 3NULA 1U60A 1RGYA 5J4EA 1BZAA 5GT3D 5B1LB 5AV5D 5JYPA 3MGRD 3LJAA 5L2FA 4IJFA 4J8XA 2V20A 3UDFA 4ZUXC 2V1ZA 3X1SD 1E88A 3AFAB 1YLJA 3T4QA 3C4PA 4MDZA 1YT4A 3VH6T 1S32C 3FC7A 3X1VB 2O9CA 1ERMA 3AZMA 2C6WB 4WV4B 3AZJD 5CECA 4IBCA 1S4RA 3B6FD 4IUKA 5G18A 4EESA 4GHIA 2PBDP 3SH9A 3HUNA 2Y2GA 4P0MA 3S1YA 4N1XA 2X01A 4DRTA 1MKMA 4Y3IA 2XD5A 3B6GA 1EW0A 4B93A 1OTAA 3WAAD 4JBFA 2FFFB 1P3LD 3O87A 4AWLC 4O0PA 4R38A 3FDDA 5HD5A 3EOIA 4EEPA 5BO0B 4JF4A 4LENA 2ZOHA 2G5IC 2Z2LB 5EM0A 3MQLA 5B2ID 5E5AC 3FYZA 4FCFA 4I3AA 5GHZA 3IH8A 3QP4A 4I5SA 1L2SA 1N9BA 4YM6B 4PHTA 4KG5A 1AOID 2RCXA 5B1LC 1XP4A 3RELD 2AVXA 3LR3A 5GSUB 5BNVB 1G5UA 3HVFA 2XGNA 3IF6B 1NJ4A 5IHVA 3F1NB 5BT1C 1HVBA 1F1EA 5B0YD 1ID3A 3AFAC 1OTEA 1ZKJA 3F1PA 3OZHA 2PR5A 3C1CB 2OLVA 1KX5D 4IVKA 3ZG7B 3X1VC 4Z2IA 4NZ4A 4E6WA 3L9KA 2WKHA 4CSRB 3VSLA 4JXVA 3AZND 2O99A 5F82A 4WELA 4FSFA 3KWQB 2VKSA 2Z6CA 4I38A 2EWWA 3IXGA 3K3CA 4HJ6A 5CHJA 4ETXA 3HLBA 3UMDA 4E3NA 4WU8B 1S0WA 3UN7A 4BBTA 3NECA 4KZ5A 1I2WA 3T4LA 1P9WA 5B1MD 3IHAA 5B24D 1KOUA 4EBLA 1M18B 1H3OA 2NQBD 4DDYA 2A24B 2W3HA 4DF6A 1EQZB 4I3IA 2EWVA 4XZQD 4R4RA 5CPID 2Y2PA 4YM6C 4WZSB 3A0SA 2ZL1A 2NUTC 4YWZA 1CF0A 5GSUC 4IBJA 3IF6C 2BYMA 5B0ZD 3AZHD 3QP2A 1JTDA 1FR1A 2NQBA 4CJNA 4UQIS 3C1CC 4EW7A 1ULYA 2Y2LA 4LPZA 3OPRA 3B0DB 2KX6A 3FPWA 4KZ9A 2EFUA 3REHD 1E6NA 4X1LA 1W1PA 2WZXA 3LYXA 3KWQC 2PYRA 1P3KB 2PYOD 5JA4B 1OJ5A 4PM5A 2DNSA 3QHYA 4WU8C 3VP3A 3HSHA 2JKRM 1OGGA 1ZLAD 4HJ3A 3CAXA 1CK3A 5B33B 3B33A 3W4PA 3CWFA 2A49A 4QY5A 1M18C 5B31G 3ZNYA 5GLDA 1KGEA 2QWSA 3KXBB 1P3BB 1H3QA 5EVEA 1Y4OA 2G2WA 2VLGA 3MXQA 1KU5A 5EM1A 5M1AA 4BL3A 4NFTA 1PRQA 3V39A 3JVVA 3IBRA 4N9KA 3AN2B 4KZAA 3AZEB 3D3OA 3KYZA 4LD9B 4LGWA 2YFWB 2G2UA 3N7WA 4FD8A 3T1RA 5DFXA 1SZVA 5FAQA 3NQJB 2HJEA 3TG9A 3B0DC 3H9WA 1YAXA 5AY8B 2QHKA 3B0BA 4XT2A 4DRAA 2F8NB 4H9NB 5HL6A 3UB7A 2WADA 4CAYB 4NE6A 3CG5A 1H8PA 4WU9C 5FAPA 5BPVA 1P3OA 1P3KC 3Q7VB 4R4SA 2X02A 4S2NC 4H6JA 5AV8D 1KX3A 3PBQA 2HZ5A 2NZDB 4NYYA 2FJ7C 1PZPA 4FUWA 4IJEA 1P3MB 1P3AC 2J9PA 4OLDA 2XEPA 5HDCA 4Y13A 1W63M 1P3BC 1WA9A 3AV2B 3EGDC 1KX4D 5DNMD 5B32D 1YLWA 1N1JB 1W7FA 1D06A 1MWTA 1U35B 2ZLYA 2H28A 5EVIB 1P3PD 3AN2C 5EV0A 3AZEC 3AZFB 1JTGA 2WKIA 3QP8A 4OLGA 4LD9C 4NXEA 4Z2MG 4X23D 3R4KA 2IOUA 3WKJB 4RQ9A 5B40D 1FSWA 3WA9A 5JRGD 5A90A 5GT0D 4S2OA 1WWIA 1P3IA 1FOFA 4NE5A 5AY8C 2V8FA 4A5RA 5KDMB 5HAPA 2YKHA 4GDBA 4HOIA 3GMWA 3Q82A 4WU8A 3O3VA 2M7UA 3IX3A 1QMEA 3LO7A 4OQIA 4Y2FA 3MXRA 3KUYD 1T1AA 1T1CA 2PHYA 2HIOD 4OOLA 4ARZB 2ZC4B 4P6ZM 4HIAA 5FEFA 4Z2HA 5CGWA 3IWQA 4OH0A 4MLLA 3LFVA 3ZNTA 5GL9A 5HX9A 4EO5B 1P3MC 3SH7A 5EOEA 2ZY5A 3BWLA 4MCWA 1E6ZA 3H82A 3AV2C 1P97A 4ZDXA 1LHYA 2F2AC 1K38A 3F1OB 2UWXA 2DRWA 2BYKA 3KX0X 3UTAB 3BJNA 5FQ9A 5EVIC 1P9RA 4IBEA 3H0RC 3AZFC 3HONA 1VHMA 2JN7A 3N8LA 1BUEA 1M19D 3WKJC 1K54C 3MS6A 4H9SA 3L25A 1KE4A 2W1TA 1N9OA 1H8MA 3LELB 4XUJB 5CPKD 1XA7A 3UB5P 4M4XA 4YS3D 4LRYC 4HMEA 3LR4A 1GSXA 4WU9A 1MWRA 4CLCB 2XSSA 1YPRA 4GB7A 3NOUC 2J3WA 4KGCA 3AZID 5FQKA 2FJ7A 3ZQ5A 1UGUA 3HLEA 1NLYA 1D1JA 3X1UB 4FOFA 1PIOA 2WK0A 3A1KA 3A3EA 3W97C 3NOTC 1NZUA 2HP6A 3AZKD 3PXPA 2YKFA 2H5SA 1M1AB 1P3AA 4JJNC 4Q0HA 3T4JA 1FILA 4DXCA 3IHBA 2W3DA 4WZ5C 3MZFA 3C7UA 5GHXA 1OJGA 2EX9A 4J8WB 2J9OA 1P34B 4GZBA 3RH8B 3G6OA 4LRXC 3AN2A 4BLMA 1P3GA 5DNNB 4LD9A 2ACGA 4NZ1A 4R8PA 2WGWB 1WWSA 5B2JB 1XFQA 2UV0E 4JKTA 2V8CA 3VH5A 4XXRA 3VFHA 2Q9NA 2Y4AA 5BNXA 2ZBBA 4Z5TD 3MGPB 5AY8A 4R3JA 1HQ3D 4H9NA 1CQAA 1YLZA 4NY2A 4LFUA 2J8PA 4IBGA 2I9VA 3VE4A 4ETZA 4CLCC 1OT6A 3Q7VA 1XA1A 3GV9A 3M2JA 4K91A 3NC8A 4G3VA 5AVFA 1IKIA 1S67L 3MGQA 3MMHA 3ZVTA 1FCNA 3X1UC 1E6RA 4UPKA 3A0RA 3WTPC 1SCWA 2PU2A 1OGBA 4Z5TA 2W3FA 4OQGA 5A8BA 4QU3A 5B31D 3A6ND 4HNBA 1DRMA 1UWPX 1F66C 2D49A 1T19A 3ZDJA 4BENA 3NQUB 1H5XA 5HAQA 5CP6D 3PBSA 4KUDD 2HGVA 1TZYD 1P3FD 2WKQA 4J8WC 4LG2A 2PR6A 2V9AA 3GTCA 3UY6A 1TS8A 3VSKA 5AV5B 3MGRB 1GCEA 2HPBA 5CPJD 3E4PA 3WKJA 1O6IA 1K54A 5AQ9A 5M18A 5FASA 3X1SB 3AYWA 3O5YA 1TAFA 5B2JC 4HMDA 3S7NA 4U0XA 4C6YA 4QLCA 3RXXA 5AV6D 1A0KA 2PDRA 3T4OA 5CP6A 3MGPC 2XFSA 1H8ZA 3ZGAB 4Q0IA 5AV9D 4UUZB 2CC1A 1CJFA 4GDNA 2B95A 4KQDA 4S2MA 4YNRA 1IFQA 2RTSA 3AZJB 5CPJA 2XF3A 3H0MC 3B6FB 3BM6A 5TBMB 3W97A 4ARZA 4IHQA 2A3UA 4G3WA 1YU0A 2AROD 2W0NA 4JJNA 3RJUA 3REKB 2CV5A 3L28A 3X1TD 1P3LB 3MFXA 3R7WA 5F99C 3JPUA 3C5AA 1UR8A 1L6JA 4EQIA 1LLBA 5B2IB 5F1GA 1S6RA 3UB8A 3SH8A 3UT9D 4GLQA 3BFGA 4HP9A 4P87A 2V1BA 5G4ZA 1AOIB 3EEHA 3B3XA 2IWBA 5AV5C 3MGRC 3V9RA 3RELB 1Z09A 4JGPA 1CK7A 3DTMA 2QPNA 3VE3A 4E6XA 2LY8A 2F8NH 5B0YB 2HUEB 2VJWA 2KLIA 3W99D 5CERA 4CLCA 2XD1A 1KX5B 1K57A 1I2SA 1PI4A 2OWJA 1W1VA 4J8VC 3EGXC 3E4QA 3AV1A 3LEZA 4LV0A 2VX8A 2QKPA 3AZJC 4H9QA 3X1UA 5BOHA 2B18A 5IS1A 3W98D 1AWIA 3WTPA 4EERA 2RL3A 4NEED 4KG2A 3JVUA 4Y5FA 5L09A 1F66A 3REKC 3VH6W 5FUGA 1IYQA 5B1MB 1P3LC 1BYWA 4K08A 1YQSA 3DWKA 5B24B 5AVCA 3L27A 3LJAD 3PAGA 4J8XD 3DBAA 3E2LA 4PM6A 2PRFA 5KMWA 5HPFA 4XZQB 3WS5A 5CPIB 3ITAA 4E45A 3DW0A 2L1MA 1AOIC 1ALQA 1PWCA 2LB9A 3FKWA 2VQRA 3RELC 3ISGA 1G6OA 5B0ZB 2ZOIA 5KIZA 3MGPA 3AZMD 3AZHB 4UHUA 3PYPA 3LZ0B 5B0YC 4YFMA 4IBKA 1D7EA 5FA7A 4UQIM 4E3MA 2WYXA 5U47A 5BS7C 1KX5C 2ZMVA 5I94A 4MN5A 1TD5A 3REHB 1TF1A 3FPVA 3B6GD 1OPXA 5MC7A 4OJ5A 3V5MA 2P08A 1XXMA 2OSUA 4IUHA 5TFQA 2PYOB 3BYDA 4ZJ3A 3GDIA 5F99A 1MY8A 1SDEA 4BWIA 3B47A 3ITBA 3K3DA 3FKEA 1ZLAB 4KHAB 5B1MC 3R45B 4OUIA 3TRCA 3C1BA 3O62C 3IWOA 3AZGC 3OPHA 5DTKA 4DE3A 1MC0A 3PBTA 1GHMA 4WEJA 1ID3D 4OP5A 4XZQC 5CTMA 5CPIC 1L3LA 3MNNA 5AQ7A 3GR2A 3REJA 1JWZA 3IH9A 2Q9MA 1TVFA 3AGEA 1YMSA 4YOFA 1GPFA 4YINA 3H7WA 1SKOB 5B0ZC 3AZLD 3AZHC 4H9PB 4S2JA 3LZ0C 1C3BA 4Y0UA 1KGGA 4WMCA 5JYOA 1L0FA 4J8VA 4HBUA 1XJ3A 2P74A 2WKRA 3HREA 5C3IB 3REHC 2HJ9C 4H9RB 5TBMA 3LZ1A 4Z66A 2XH9A 3AZLA 5HD3A 3TU4B 2HV1A 3REKA 3OPPA 1DP9A 4N9LA 3HLCA 2ZM0A 4CPKA 1STZA 5E2EA 4H9OA 1F5MA 3RTYA 5CGXA 5FAOA 3VOLA 3P7NA 4EETB 5K5BA 3LR5A 3G32A 1ESIA 1JFIA 2J7VA 1KX4B 4HGAB 5B32B 5DNMB 2VGLM 5CEBA 2WGVA 4HY8A 1BSGA 5AVEA 1K0KA 4ZUXA 1S4SA 4O01A 1P3PB 3D72A 4EEUA 5BS7A 4DRBA 1CI8A 2Y79A 4X23B 1K4EA 3B42A 2KOIA 5B40B 3GQZA 2W8SA 3UTBB 1YLPA 3MVDB 1LL5A 5JRGB 4MMNA 4HESA 2BLSA 4OJPA 5GT0B 4ZBEA 1S32A 1QO6A 5C3IC 4U0TA 1PZOA 2VZWA 3MKFA 3UPPA 4MNRA 4G92B 5F83A 3TU4C 4MN7A 4KQRA 4OJLA 4JGOA 2VV8A 1YLTA 3KUYB 1FIKA 3PBOA 1VEUB 5A92A 2HIOB 2K7SA 2V1AA 2ZY3A 3O62A 4HEFA 2L5AA 2Y2JA 4GHLA 4KUKA 2WKEA 3P09A 3AZGA 1Y28A 1MZUA 1XFNA 4EUZA 1XX2A 4OQ0A 3FG8A 4QWOA 2W3EA 5E5AA 1ZC2A 3CPTA 1L0DA 1NRJA 1KX4C 5DNMC 5B32C 3NCKA 1H8YA 3WD3A 3LIDA 1DY6A 1EQZC 5B1LA 3LIFA 1O7EA 3G35A 3CJMA 2JKGA 3LGOA 4BJPA 1P3PC 4OJOA 2PD8A 4OOMA 3Q1FA 1W5DA 4X23C 1M19B 3AFAA 5B40C 1P3OD 3UTBC 4U3TA 5GXQB 3MVDC 4HI4A 5I5LA 3S4XA 4WL9A 5JRGC 5CPKB 2ZM5A 3NY4A 5GT0C 4YS3B 1TEMA 4E04A 3X1VA 1KX3D 2ZY2A 3EPHA 4G92C 3IQAA 2Y2NA 3MGSB 3AZIB 2XA7M 4IBRA 2L4RA 1CEFA 4QPRA 2Y2IA 4KHAA 4E3JA 5KSHA 5HDDA 3KUYC 3BY9A 1ED7A 4NXGA 2P9VB 1AXBA 4DE1A 3AZKB 4GHAA 5BO0A 3L26A 1IYOA 4WLAA 3U2AA 5HZHA 1G68A 3Q07A 4PPRA 3VH5T 5B33C 2E8IA 3W96B 1BH8B 1Q2QA 3NJAA 5J8XA 3CITA 5G49B 4XUXA 4YM6A 1XJ4A 3WA9D 3HJIA 2R9WA 3KXBC 2HDRA 5GSUA 5BNVA 1FR6A 2FZ0A 1P3ID 2NUPC 3IF6A 4B88A 3MSHA 4EBPA 3F1NA 2O9BA 3W4QA 5HFOA 3BEBA 1M19C 1ES4A 3WD4A 4KZ7A 4IBXA 5GXQC 1HQ3B 4WU8D 3N8RA 5HWWA 3C1CA 4ZJ1A 3E0YA 2XQZA 1KDSA 3TU4A 5DVAA 3REIB 1BLPA 5FI2A 4CSRA 3T12B 1E4DA 4WBGA 5HAIA 4B4XA 5HWTA 3KWQA 3MGSC 3AZIC 1RP5A 4OP8A 4ZJ2A 2KDKA 1VETB 2XRNA 3LUQA 1CI9A 4MB5A 3C4OA 4R0QA 3EQVA 3LIAA 2LB5A 3CI6A 3WRTA 1HLUP 4QB8A 4IBIA 4NKPA 2BG1A 2NZDC 3IF5A 1M18A 2XROA 2A24A 4KUDB 1PZRA 1DJBA 3W96C 1EQZA 3OC2A 3KYEA 1P3FB 4KZBA 2PT7A 3VOZA 3PR6A 3WTPE 2ZD8A 1Q9CA 4KUOA 5F69A 4WU9D 1YU1A 3WX7A 3MVDA 1YSPA 3G2ZA 1U35C 2JCHA 3C7VA 5AV6B 3WD1A 1BT5A 3CUEC 4KGCD 5AV9B 3L7HA 3T50A 2FJ7D 4QY6A 3OLOA 2ZM2A 3MJQA 5DTTA 4JXWA 1BH9B 3REIC 4BD1A 3UB9A 2OWHA 4LRZE 1P3AD 4RX2A 1P3BD 1P3KA 3KSGA 5JA4A 5FDHA 4S2NA 4JXSA 4GS9B 2Y2OA 4LCMA 2AROB 5KSCA 3AL0C 1HTAA 3X1TB 1WYCA 2XLNA 3AN2D 5B33A 1P3GD 3W4OA 4LD9D 4C75A 2JHEA 3LY3A 1YKDA 4K0XA 4R8PD 4KUDC 4HMCA 3UT9B 5DF9A 1GA9A 3KXBA 1P3FC 1P3BA 5TJJA 3ZVWA 4EO5C 2A2LA 1TDLA 5AY8D 2Q0OA 3A3FA 4X69A 2V0WA 3C30A 5AVBB 2IWDA 1BLHA 4MB4A 1ZG4A 1JNUA 5GXQA 3AZEA 3NI9A 1BTLA 3LIEA 2YFVB 4MBKA 5LBRA 4J8UB 3UTAC 2BASA 2YFWA 1IKGA 2EX2A 2WZZA 1H0IA 4HH3A 3W99B 5AV9C 4OONA 5E43A 3NQJA 3MGQD 4WYYA 4UA9A 1S1YA 3BRMA 1ES3A 3VP2A 2ZMAA 2F8NA 3LELC 4XUJC 3MGSA 3VP1A 5M19A 5DF8A 5A93A 3GSGA 4CAYA 4QD4A 5CX7A 2QJ5A 3SZTA 4EWFA 3W98B 4NK3A 3BFFA 1FQGA 4E3OA 2P9VA 1ERQA 2ZQ8A 3M6BA 3QNCA 3V67A 4QNLA 4PKYA 2AROC 5DKLA 3S22A 2OLUA 5DJUA 2NZDA 2HF6A 1PDCA 3I7JA 3G4PA 5TGFA 1NXYA 3UE3A 3W96A 3AZFD 3LJAB 2W1RA 3NOPC 4RA7A 4J8XB 3ZG8B 5G49A 1M1AC 3WKJD 1P3MA 1PNEA 2K31A 3NIAA 4JF5A 3AYWD 3UT9C 1K55C 2JSSA 4OOYA 4QLCD 3AV2A 5CEDA 1S1ZA 4QHCA 3OBFA 5CHMA 1N1JA 1XGJA 5AQBA 3O86A 2RVQD 1PFLA 5AVBC 3IBJA 1U35A 1P34C 2BTFP 5AJGA 1MKIA 5EVIA 3AZMB 5GT3B 2VK3A 4PM9A 3AZFA 5DNNC 1KE3A 4J8UC 1PW1A 5FQJA 3FKVA 1Z6FA 3C8CA 4GHIB 4OVDA 3W97D 3W99C 2H0TA 3Q7ZA 3PBRA 4Y17A 3VFFA 4WEKA 4BBUA 1E25A 1Z2CB 4JJND 3MXSA 1ZTUA 3B6GB 1DP6A 2CV5D 5KDMA 4EU0A 3W98C 5DKKA 1KS0A 4PM7A 3TE8A 1ESUA 5D3OA 3EPLA 3MKEA 4XUZA 3MQOA 2D02A 2ZQ9A 4O7DA 4Z2JA 3ZYTA 3O88A 4KENB 2V2FF 4UA7A 4WM9A 3KSIA 1W1TA 3RXWA 1OT9A 4MB3A 3LJAC 1RCJA 5FDSA 1NYYA 3ZFZA 1EWZA 3A3IA 3WAAB 5FATA 1IYPA 4HP4A 4Z1WA 4WZ5A 1ID3B 1NLZA 4EUVA 3F1PB 4CLCD 3F1OA 1W63Q 5GLAA 3UTAA 3P01A 1FCOA 3AZMC 5GT3C 3AV1D 3N8SA 2EXBA 4DE2A 1MWUA 3X1UD 5E2HA 3WTPD 3X1SC 3LELA 4XUJA 1K56A 4II7A 3U4LP 1F66D 1N4OA 2J3TD 3C38A 5FQMA 3B6GC 4L9EA 3HUOA 4NE3A 1LSWA 4UA6A 4LV3A 3MFDA 2P04A 3GRJA 1GXDA 5AVCD 1XKZA 1ONHA 3ZHHA 3IP4C 1H3OB 1E3UA 1PW8A 1MWSA 3AZNB 3EWKA 1A7WA 3B6FC 1L0GA 1TDGA 2J80A 4OQHA 4G3KA 1M1AA 2RIQA 4K0WA 4LV1A 5GLCA 4NYUA 3WAAC 2BYMB 2I72A 3MGPD
chains in the Genus database with same CATH topology
1ID3C 1NRFA 4GD6A 5AVBA 4J8WA 1KDWA 1P34A 2NQBB 1PWDA 1YU3A 5B2IC 3VP4A 5DNNA 3G2YA 4IBBA 4J8UA 4RX3A 2WGWA 2WAEA 5B2JA 3EPKA 4LCLA 4GKUA 3DWZA 3HUMA 3IT9A 4IVIA 1SKFA 3L29A 2HUEC 3MZDA 5F99D 4AWLB 5DF7A 2Y91A 2JBFA 1YLYA 4GOGA 3C1BD 2DF4C 2Y59A 4Y7PA 3WS0A 3AZNC 4GN2A 5B32G 3MNND 3REJD 3NQUA 3VOYA 4IEDA 5B24C 2WAFA 1XGIA 2NQBC 4ID4A 4WMCD 4J8VD 5GT3A 5AV5A 2WUQA 3MGRA 3H0LC 1K4FA 4E44A 4ZBJB 4JF6A 3UPNA 1WE4A 5EPHA 2WGIA 3X1SA 5A91A 3LZ1D 1PWGA 1WYBA 4Z66D 2Y2MA 3VMAA 1P3OB 3SS3A 3REKD 4S2IA 4UUZA 1EROA 3CMZA 1KX3B 4JXGA 2QMIA 2XK1A 3AZJA 1RGZA 1XPBA 3SOIA 1W2EA 3B6FA 2ZM8A 1VM1A 1BULA 4X6TA 3ZG0A 2EFXA 3G31A 4KQQA 4FH4A 4S2PA 2PYOC 3PTEA 4B4ZA 3WAAA 1P3LA 2ZQCA 3BECA 5AV8B 2C5WB 1YMXA 1ZLAC 4ZUXD 5B2IA 4Z2MH 1ES2A 1J9MA 3L2AA 1HTZA 4S2KA 1JWVA 1AOIA 3WA9B 1IEMA 4R1GA 3RELA 2J8YA 2Z2MB 1P3IB 1S32D 4ZBJC 1W8QA 4OKPA 1K6RA 4IBFA 3NBLA 2QZ6A 3UDXA 3OCNA 5B0YA 2F8NG 1P3OC 3PAEA 2FFYA 3IXHA 1KX5A 1JWPA 3HLGA 1KX3C 1IELA 3O62D 3VP0A 5E2GA 3AZGD 2ZC6B 2Y2HA 3AZNA 4GD8A 2GDNA 4EBNA 5E5AD 4BQMA 4R3BA 3W8KA 3SS4A 1YU4A 5B1MA 3KS8A 5AV8C 5AQAA 5B1LD 5B24A 2VGJA 2BYKB 3LZ0D 4UAAA 3P98A 5BT1D 2IO5B 4XZQA 5CPIA 3AFAD 3WA9C 1ONGA 4F94A 4Y0TA 4HGAC 1P3IC 1BLSA 2Y2QA 2EX6A 3X1VD 5B0ZA 4WU9B 3AZHA 3BLSA 3LZ0A 3KFUG 1M40A 4HBTA 3M2KA 1B67A 1T3UA 3VH5W 4RVAA 4N1HA 2XFTA 4KGCB 2FJ7B 4G91B 1I5QA 4EV4A 4DKIA 3WS2A 3ZCZA 2HP5A 3REHA 3VH6A 3V50A 5EECA 1P3AB 1M6KA 2H10A 2PYOA 3OCLA 3EQUA 3LCEA 3B0CW 1SDNA 1LI0A 1ZLAA 5DTSA 4YM6D 3R45A 2HIOC 1P3GB 5GSUD 4X68A 5EVLA 2JC7A 2HDQA 4R8PB 2HDUA 3BFDA 2IO5C 1G6AA 3BFEA 3OPLA 5BNXB 4DDSA 4H9SC 1GHPA 3C1CD 4R23A 1NY0A 2R9XA 4H9PA 2ZC7A 3TU4D 5CGSA 1IYSA 2IWCA 4OPRA 1K6SA 3V3RA 3KWQD 4L0LA 4KGCC 5GHYA 3FV7A 4G91C 3MGQB 4Q8IA 4Z5TB 4NZ5A 4H9RA 5CPKC 4WZ4A 3B0CT 4YS3C 3TSGA 4LV2A 2EX8A 4JPMA 3GVBA 1M18D 4KZ6A 5AV8A 1EQZD 5HL1A 4C3QA 1GA0A 3Q81A 4KG6A 4MEZA 4D2OA 1YM1A 1P3GC 2X71A 3AZKC 4E3LA 4R8PC 5B31B 4Y0OA 3A6NB 3UTBD 3MVDD 3AYWB 1TAFB 5CXWA 5KZHA 4PM8A 4QLCB 1KX4A 5DNMA 5B32A 1ES5A 1YUEA 5CP6B 3IWIA 1Q2PA 4KZ8A 1HD8A 2Y2KA 1LL9A 1TZYB 1Y54A 1VQQA 5FSRA 2Y55A 2ZQDA 1P3PA 5CPJB 4X23A 5B40A 3UTBA 1P3KD 3W97B 5JRGA 3WWXA 3MGQC 3UNWA 4E3IA 5GT0A 3TOIA 4Z5TC 4JJNB 1HQ3C 2ZQ7A 4WNNB 2CV5B 2HDSA 3JYIA 3EG5B 5B33D 1MXOA 1W8YA 4MBHA 3KUYA 4OPQA 2HIOA 3KXBD 3A1IA 2ZJ9A 4BD0A 4M6BA 3V9RB 4DE0A 3A3JA 5B31C 3A6NC 5GXQD 3AYWC 3AZED 3WS4A 1EI5A 4QLCC 5FQIA 3WRZA 2DCFA 5CP6C 2B5RA 2RVQC 1TZYC 4OJ6A 4P6BA 2ZY4A 1MPLA 2F8ND 4GH9A 4N92A 3MGSD 3AV1B 3AGDA 1MBLA 5CPJC 4H9QB 1M19A 4WJ3C 3WTPB 2XR0A 5CPKA 4OPYA 2ZQAA 5AV6C 4YS3A 4ZTKA 5FQQA 1FCMA 4ZAMA 4E3KA 4QJGA 1F66B 2CWEA 5EOOA 2NZDD 2CV5C 3HLDA 5FUGB 1SHVA 1R4VA 2EXAA 3W96D 5AVCB 5FI7A 5CHLB 1JVJA 3AZIA 3UO9A 1KVMA 1LI9A 1P3MD 5EE8A 5CRFA 1DJAA 3NDEA 5CHUA 1YU2A 3AV2D 1KVLA 1O07A 4Z9QA 3AZKA 4S2LA 1KGFA 1U35D 4KZ4A 3ZG5A 3X1TC 3UDIA 5EVID 2OV5A 4KQOA 5CTNA 1BH8A 3G30A 2G5HC 3A3DA 2XDMA 3REID 1K57C 4MBFA 1B6WA 3MZEA 1BFMA 3AV1C 3IXDA 1K25A 4H8RA 1BLCA 3QNBA 4X53A 3ZG9B 1HQ3A 3LY4A 1NYMA 1GHIA 5F99B 3SS5A 3CZDA 5HARA 1NZOA 3REIA 5AVCC 1HZOA 3C1BB 3P5JB 3UPOA 3UE0A 3MNNB 3REJB 5B31A 2PBYA 2VGKA 3A6NA 3D4FA 5GLBA 5F1FA 3UTAD 4KUDA 1TZYA 1P3FA 4X56A 4J8XC 5EUAA 3F6TA 4J8VB 3LELD 4XUJD 1K56D 1W79A 4M3KA 4DXBA 1DJCA 1CEGA 3LZ1B 4Z66B 5AV6A 3KS4A 3AZLB 2JE5A 5AV9A 4WNNA 1E3UD 3N4IA 4NZ3A 4FH2A 3E2KA 3HBRA 3EPJA 4GNUA 3WS1A 4H9OB 4NETA 1BH9A 3HL9A 5E2FA 3M6HA 1M1AD 1KE0A 2ZC3B 3C1BC 2HP9A 4P85A 2AROA 4DQYB 1JFIB 5AVBD 4J8WD 1QMFA 3MNNC 1P34D 3UE1A 3X1TA 3N3FA 3REJC 1PI5A 2PU4A 3BFCA 2F8NK 1L0EA 2ZC5B 3BLMA 5DNND 2DQNC 5HW3A 3PBNA 4J8UD 4JLFA 3HLWA 4ZUXB 4PMAA 4OPZA 5B2JD 4BL2A 3UT9A 1K55A 3MBZA 4IBDA 3V3SA 3IXBA 1S32B 1ZG6A 3HLFA 5TR7A 3KSYA 2YFVA 3LZ1C 4Z66C 5FI6A 3AZLC 3G34A 4X55A 3W99A 4RYEA 1PYYA 4KZ3A 3N6IA 3O62B 3FWLA 2H0YA 3AZGB 3NDGA 3W98A 5E5AB 1FSYA 1OMEA 3AGFA 3FZCA 1U60A 1RGYA 1BZAA 5GT3D 5B1LB 5AV5D 5JYPA 3MGRD 3LJAA 5L2FA 4IJFA 4J8XA 2V20A 3UDFA 4ZUXC 2V1ZA 3X1SD 3AFAB 1YLJA 3C4PA 1YT4A 3VH6T 1S32C 3X1VB 1ERMA 3AZMA 2C6WB 4WV4B 3AZJD 5CECA 4IBCA 5G18A 3B6FD 3SH9A 3HUNA 2Y2GA 4P0MA 3S1YA 4N1XA 2X01A 4DRTA 2XD5A 3B6GA 3WAAD 4JBFA 2FFFB 1P3LD 3O87A 4AWLC 3FDDA 5BO0B 4JF4A 4LENA 2G5IC 2Z2LB 5B2ID 5E5AC 3FYZA 4FCFA 5GHZA 3IH8A 1L2SA 1N9BA 4YM6B 4KG5A 1AOID 2RCXA 5B1LC 1XP4A 3RELD 5GSUB 5BNVB 3HVFA 2XGNA 3IF6B 1NJ4A 5IHVA 5BT1C 1HVBA 1F1EA 5B0YD 1ID3A 3AFAC 1ZKJA 3OZHA 3C1CB 2OLVA 1KX5D 4IVKA 3ZG7B 3X1VC 4NZ4A 4E6WA 2WKHA 4CSRB 3VSLA 4JXVA 3AZND 5F82A 4WELA 4FSFA 3KWQB 3IXGA 5CHJA 3HLBA 4E3NA 4WU8B 1S0WA 3UN7A 4KZ5A 1I2WA 5B1MD 3IHAA 5B24D 4EBLA 1M18B 1H3OA 2NQBD 4DDYA 4DF6A 1EQZB 4XZQD 4R4RA 5CPID 2Y2PA 4YM6C 4WZSB 5GSUC 4IBJA 3IF6C 2BYMA 5B0ZD 3AZHD 1JTDA 1FR1A 2NQBA 4CJNA 3C1CC 1ULYA 2Y2LA 3OPRA 3B0DB 4KZ9A 2EFUA 3REHD 2WZXA 3KWQC 1P3KB 2PYOD 5JA4B 4PM5A 2DNSA 3QHYA 4WU8C 3VP3A 3HSHA 1ZLAD 1CK3A 5B33B 3W4PA 2A49A 4QY5A 1M18C 5B31G 3ZNYA 5GLDA 1KGEA 3KXBB 1P3BB 2G2WA 1KU5A 5M1AA 4BL3A 4NFTA 3V39A 4N9KA 3AN2B 4KZAA 3AZEB 4LD9B 2YFWB 2G2UA 3N7WA 4FD8A 5FAQA 3NQJB 3TG9A 3B0DC 5AY8B 3B0BA 4DRAA 2F8NB 4H9NB 2WADA 4CAYB 4NE6A 3CG5A 4WU9C 5FAPA 5BPVA 1P3OA 1P3KC 3Q7VB 4R4SA 2X02A 4S2NC 5AV8D 1KX3A 3PBQA 2NZDB 4NYYA 2FJ7C 1PZPA 4IJEA 1P3MB 1P3AC 2J9PA 4OLDA 2XEPA 1P3BC 3AV2B 1KX4D 5DNMD 5B32D 1YLWA 1N1JB 1W7FA 1MWTA 1U35B 2ZLYA 5EVIB 1P3PD 3AN2C 3AZEC 3AZFB 1JTGA 2WKIA 4OLGA 4LD9C 4Z2MG 4X23D 2IOUA 3WKJB 5B40D 1FSWA 3WA9A 5JRGD 5A90A 5GT0D 4S2OA 1WWIA 1P3IA 1FOFA 4NE5A 5AY8C 4A5RA 5KDMB 5HAPA 4GDBA 3GMWA 3Q82A 4WU8A 3O3VA 1QMEA 3LO7A 4OQIA 3MXRA 3KUYD 2HIOD 4OOLA 2ZC4B 5CGWA 3IWQA 4OH0A 4MLLA 3ZNTA 5GL9A 5HX9A 4EO5B 1P3MC 3SH7A 5EOEA 2ZY5A 3AV2C 4ZDXA 1LHYA 2F2AC 1K38A 2UWXA 2DRWA 2BYKA 3UTAB 5FQ9A 5EVIC 4IBEA 3H0RC 3AZFC 3HONA 3N8LA 1BUEA 1M19D 3WKJC 1K54C 4H9SA 3L25A 1KE4A 3LELB 4XUJB 5CPKD 1XA7A 4YS3D 4WU9A 1MWRA 4GB7A 4KGCA 3AZID 5FQKA 2FJ7A 3HLEA 3X1UB 1PIOA 2WK0A 3A1KA 3A3EA 3W97C 1NZUA 2HP6A 3AZKD 2H5SA 1M1AB 1P3AA 4JJNC 4DXCA 3IHBA 4WZ5C 3MZFA 3C7UA 5GHXA 2EX9A 4J8WB 2J9OA 1P34B 4GZBA 3AN2A 4BLMA 1P3GA 5DNNB 4LD9A 4NZ1A 4R8PA 2WGWB 1WWSA 5B2JB 4JKTA 3VH5A 4XXRA 3VFHA 2Q9NA 2Y4AA 5BNXA 4Z5TD 3MGPB 5AY8A 4R3JA 1HQ3D 4H9NA 1YLZA 4NY2A 2J8PA 4IBGA 3Q7VA 1XA1A 3GV9A 3M2JA 4K91A 3NC8A 1IKIA 3MGQA 3ZVTA 1FCNA 3X1UC 4UPKA 3WTPC 1SCWA 2PU2A 4Z5TA 4OQGA 4QU3A 5B31D 3A6ND 1F66C 3ZDJA 4BENA 3NQUB 1H5XA 5HAQA 5CP6D 3PBSA 4KUDD 1TZYD 1P3FD 4J8WC 4LG2A 3GTCA 3UY6A 3VSKA 5AV5B 3MGRB 1GCEA 2HPBA 5CPJD 3WKJA 1K54A 5AQ9A 5M18A 5FASA 3X1SB 3AYWA 1TAFA 5B2JC 4U0XA 4C6YA 4QLCA 3RXXA 5AV6D 5CP6A 3MGPC 2XFSA 1H8ZA 3ZGAB 5AV9D 4UUZB 2CC1A 4GDNA 4S2MA 3AZJB 5CPJA 2XF3A 3H0MC 3B6FB 3BM6A 3W97A 2A3UA 1YU0A 2AROD 4JJNA 3RJUA 3REKB 2CV5A 3L28A 3X1TD 1P3LB 5F99C 3C5AA 4EQIA 1LLBA 5B2IB 5F1GA 1S6RA 3SH8A 3UT9D 3BFGA 4P87A 1AOIB 3B3XA 2IWBA 5AV5C 3MGRC 3V9RA 3RELB 3DTMA 2QPNA 4E6XA 2LY8A 2F8NH 5B0YB 2HUEB 3W99D 5CERA 2XD1A 1KX5B 1K57A 1I2SA 1PI4A 4J8VC 3AV1A 3LEZA 4LV0A 3AZJC 4H9QA 3X1UA 5BOHA 3W98D 3WTPA 2RL3A 4KG2A 1F66A 3REKC 3VH6W 5FUGA 1IYQA 5B1MB 1P3LC 1YQSA 3DWKA 5B24B 5AVCA 3L27A 3LJAD 3PAGA 4J8XD 3E2LA 4PM6A 5KMWA 4XZQB 3WS5A 5CPIB 3ITAA 4E45A 3DW0A 1AOIC 1ALQA 1PWCA 3FKWA 2VQRA 3RELC 3ISGA 5B0ZB 3MGPA 3AZMD 3AZHB 4UHUA 3LZ0B 5B0YC 4YFMA 4IBKA 5FA7A 4E3MA 2WYXA 5U47A 5BS7C 1KX5C 5I94A 3REHB 3B6GD 4OJ5A 3V5MA 1XXMA 2OSUA 5TFQA 2PYOB 3BYDA 4ZJ3A 5F99A 1MY8A 1SDEA 3ITBA 3FKEA 1ZLAB 4KHAB 5B1MC 3R45B 4OUIA 3C1BA 3O62C 3IWOA 3AZGC 3OPHA 5DTKA 4DE3A 3PBTA 1GHMA 4WEJA 1ID3D 4OP5A 4XZQC 5CTMA 5CPIC 3MNNA 5AQ7A 3GR2A 3REJA 1JWZA 3IH9A 2Q9MA 1TVFA 3AGEA 1YMSA 4YINA 5B0ZC 3AZLD 3AZHC 4H9PB 4S2JA 3LZ0C 1C3BA 4Y0UA 1KGGA 4WMCA 5JYOA 1L0FA 4J8VA 4HBUA 2P74A 3HREA 5C3IB 3REHC 4H9RB 3LZ1A 4Z66A 2XH9A 3AZLA 3TU4B 3REKA 3OPPA 4N9LA 3HLCA 2ZM0A 4CPKA 5E2EA 4H9OA 5CGXA 5FAOA 3G32A 1ESIA 1JFIA 2J7VA 1KX4B 4HGAB 5B32B 5DNMB 5CEBA 2WGVA 1BSGA 4ZUXA 1P3PB 5BS7A 4DRBA 1CI8A 4X23B 1K4EA 5B40B 3GQZA 2W8SA 3UTBB 1YLPA 3MVDB 1LL5A 5JRGB 4HESA 2BLSA 4OJPA 5GT0B 4ZBEA 1S32A 5C3IC 4U0TA 1PZOA 3MKFA 3UPPA 4MNRA 4G92B 5F83A 3TU4C 4KQRA 4OJLA 1YLTA 3KUYB 3PBOA 5A92A 2HIOB 2ZY3A 3O62A 4HEFA 2L5AA 2Y2JA 4GHLA 2WKEA 3P09A 3AZGA 4EUZA 1XX2A 4OQ0A 5E5AA 1ZC2A 1L0DA 1KX4C 5DNMC 5B32C 3NCKA 1H8YA 1DY6A 1EQZC 5B1LA 1O7EA 3G35A 3CJMA 4BJPA 1P3PC 4OJOA 4OOMA 3Q1FA 1W5DA 4X23C 1M19B 3AFAA 5B40C 1P3OD 3UTBC 4U3TA 5GXQB 3MVDC 3S4XA 5JRGC 5CPKB 2ZM5A 3NY4A 5GT0C 4YS3B 1TEMA 3X1VA 1KX3D 2ZY2A 3EPHA 4G92C 3IQAA 2Y2NA 3MGSB 3AZIB 4IBRA 1CEFA 4E3JA 2Y2IA 4KHAA 5KSHA 3KUYC 2P9VB 1AXBA 4DE1A 3AZKB 4GHAA 5BO0A 3L26A 1IYOA 1G68A 3Q07A 4PPRA 3VH5T 5B33C 2E8IA 3W96B 1BH8B 1Q2QA 5J8XA 5G49B 4XUXA 4YM6A 3WA9D 2R9WA 3KXBC 2HDRA 5GSUA 5BNVA 1FR6A 1P3ID 3IF6A 4B88A 4EBPA 3W4QA 5HFOA 3BEBA 1M19C 1ES4A 4KZ7A 4IBXA 5GXQC 1HQ3B 4WU8D 3N8RA 3C1CA 4ZJ1A 2XQZA 1KDSA 3TU4A 5DVAA 3REIB 1BLPA 5FI2A 4CSRA 1E4DA 4WBGA 5HAIA 4B4XA 3KWQA 3MGSC 3AZIC 1RP5A 4OP8A 4ZJ2A 1CI9A 3C4OA 4R0QA 3EQVA 3WRTA 4QB8A 4IBIA 2BG1A 2NZDC 3IF5A 1M18A 4KUDB 1PZRA 1DJBA 3W96C 1EQZA 3OC2A 1P3FB 4KZBA 3VOZA 3WTPE 2ZD8A 1Q9CA 4WU9D 1YU1A 3WX7A 3MVDA 3G2ZA 1U35C 2JCHA 3C7VA 5AV6B 1BT5A 4KGCD 5AV9B 2FJ7D 4QY6A 2ZM2A 5DTTA 4JXWA 1BH9B 3REIC 4BD1A 1P3AD 4RX2A 1P3BD 1P3KA 5JA4A 5FDHA 4S2NA 4JXSA 2Y2OA 4LCMA 2AROB 5KSCA 3AL0C 1HTAA 3X1TB 1WYCA 2XLNA 3AN2D 5B33A 1P3GD 3W4OA 4LD9D 4C75A 3LY3A 4K0XA 4R8PD 4KUDC 5DF9A 3UT9B 1GA9A 3KXBA 1P3FC 1P3BA 3ZVWA 4EO5C 1TDLA 5AY8D 3A3FA 4X69A 5AVBB 2IWDA 1BLHA 1ZG4A 5GXQA 3AZEA 3NI9A 1BTLA 2YFVB 4MBKA 4J8UB 3UTAC 2YFWA 1IKGA 2EX2A 2WZZA 3W99B 5AV9C 4OONA 5E43A 3NQJA 3MGQD 4WYYA 4UA9A 3BRMA 1ES3A 3VP2A 2ZMAA 2F8NA 3LELC 4XUJC 3MGSA 3VP1A 5M19A 5DF8A 5A93A 3GSGA 4CAYA 4QD4A 4EWFA 3W98B 4NK3A 3BFFA 1FQGA 4E3OA 2P9VA 1ERQA 2ZQ8A 3M6BA 3QNCA 4QNLA 2AROC 3S22A 2OLUA 2NZDA 3I7JA 3G4PA 5TGFA 1NXYA 3UE3A 3W96A 3AZFD 3LJAB 4RA7A 4J8XB 3ZG8B 5G49A 1M1AC 3WKJD 1P3MA 3NIAA 4JF5A 3AYWD 3UT9C 1K55C 2JSSA 4OOYA 4QLCD 3AV2A 5CEDA 4QHCA 5CHMA 1N1JA 1XGJA 5AQBA 3O86A 2RVQD 5AVBC 1U35A 1P34C 1MKIA 5EVIA 3AZMB 5GT3B 4PM9A 3AZFA 5DNNC 1KE3A 4J8UC 1PW1A 5FQJA 3FKVA 1Z6FA 4OVDA 3W97D 3W99C 2H0TA 3Q7ZA 3PBRA 3VFFA 4WEKA 1E25A 1Z2CB 4JJND 3MXSA 3B6GB 2CV5D 5KDMA 3W98C 4PM7A 1ESUA 5D3OA 3EPLA 3MKEA 4XUZA 4O7DA 2ZQ9A 3O88A 4KENB 2V2FF 4UA7A 4WM9A 3RXWA 3LJAC 1RCJA 1NYYA 3ZFZA 1EWZA 3A3IA 3WAAB 5FATA 1IYPA 4WZ5A 1ID3B 5GLAA 3UTAA 1FCOA 3AZMC 5GT3C 3AV1D 3N8SA 2EXBA 4DE2A 1MWUA 3X1UD 5E2HA 3WTPD 3X1SC 3LELA 4XUJA 1K56A 1F66D 1N4OA 5FQMA 3B6GC 3HUOA 4NE3A 4UA6A 4LV3A 3MFDA 3GRJA 5AVCD 1XKZA 1ONHA 3ZHHA 3IP4C 1H3OB 1E3UA 1PW8A 1MWSA 3AZNB 1A7WA 3B6FC 1L0GA 1TDGA 4OQHA 1M1AA 2RIQA 4K0WA 4LV1A 5GLCA 4NYUA 3WAAC 2BYMB 2I72A 3MGPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ4 A;  2J7V A;  3ZG5 A;  1MWT A;  3UDI A;  4GD6 A;  1NRF A;  5EVI D;  4KQO A;  2WGV A;  2OV5 A;  5CEB A;  1KDW A;  2ZLY A;  5CTN A;  1PWD A;  5EVI B;  1BSG A;  1JTG A;  2WKI A;  4OLG A;  3VP4 A;  3G30 A;  3G2Y A;  3A3D A;  2XDM A;  4RX3 A;  1FSW A;  1K57 C;  1CI8 A;  1K4E A;  4MBF A;  2WGW A;  2WAE A;  3GQZ A;  4LCL A;  5A90 A;  1YLP A;  3MZE A;  1LL5 A;  3IXD A;  4GKU A;  4S2O A;  1FOF A;  3DWZ A;  4HES A;  2BLS A;  1K25 A;  3HUM A;  1BLC A;  3QNB A;  3IT9 A;  4H8R A;  4IVI A;  4X53 A;  4ZBE A;  3ZG9 B;  4A5R A;  1SKF A;  4U0T A;  3MZD A;  3LY4 A;  5HAP A;  4GDB A;  5DF7 A;  1NYM A;  1PZO A;  2Y91 A;  3GMW A;  1GHI A;  3Q82 A;  2JBF A;  3MKF A;  3O3V A;  3UPP A;  4MNR A;  1QME A;  3LO7 A;  1YLY A;  5F83 A;  3SS5 A;  4OQI A;  3MXR A;  3CZD A;  4GOG A;  1NZO A;  5HAR A;  4KQR A;  4OOL A;  2ZC4 B;  1YLT A;  3PBO A;  1HZO A;  2Y59 A;  4Y7P A;  3WS0 A;  5A92 A;  4HEF A;  5CGW A;  4GN2 A;  2Y2J A;  3IWQ A;  2WKE A;  3P09 A;  4OH0 A;  4MLL A;  3UPO A;  4EUZ A;  3ZNT A;  5GL9 A;  5HX9 A;  1XX2 A;  3UE0 A;  4OQ0 A;  3SH7 A;  5EOE A;  2PBY A;  2VGK A;  1ZC2 A;  4ZDX A;  1LHY A;  3VOY A;  3D4F A;  5GLB A;  1L0D A;  5F1F A;  1K38 A;  4IED A;  3NCK A;  2UWX A;  2DRW A;  1H8Y A;  2WAF A;  1XGI A;  1DY6 A;  5FQ9 A;  4ID4 A;  4WMC D;  5EVI C;  1O7E A;  3G35 A;  4X56 A;  3CJM A;  2WUQ A;  3N8L A;  5EUA A;  4BJP A;  1K4F A;  1BUE A;  4OOM A;  1K56 D;  1K54 C;  4JF6 A;  3Q1F A;  1W5D A;  3UPN A;  1KE4 A;  1WE4 A;  2WGI A;  1W79 A;  5EPH A;  4M3K A;  1XA7 A;  5A91 A;  4U3T A;  1PWG A;  1WYB A;  3S4X A;  1DJC A;  4DXB A;  2Y2M A;  3NY4 A;  3VMA A;  1CEG A;  3SS3 A;  1MWR A;  1TEM A;  4S2I A;  4GB7 A;  1ERO A;  2JE5 A;  1E3U D;  3CMZ A;  3N4I A;  4FH2 A;  5FQK A;  4JXG A;  3E2K A;  2QMI A;  3HBR A;  4GNU A;  3HLE A;  2XK1 A;  3IQA A;  3WS1 A;  2Y2N A;  1RGZ A;  1XPB A;  1PIO A;  2WK0 A;  4IBR A;  4NET A;  1CEF A;  2ZM8 A;  3HL9 A;  3SOI A;  5E2F A;  1VM1 A;  2Y2I A;  3A3E A;  3M6H A;  4E3J A;  5KSH A;  1NZU A;  1KE0 A;  2HP6 A;  2ZC3 B;  1BUL A;  4X6T A;  2H5S A;  3ZG0 A;  2EFX A;  2P9V B;  3G31 A;  1AXB A;  2HP9 A;  4DE1 A;  4KQQ A;  4FH4 A;  4P85 A;  4S2P A;  3PTE A;  4B4Z A;  4DXC A;  1IYO A;  3IHB A;  2ZQC A;  3BEC A;  1QMF A;  4WZ5 C;  3MZF A;  3C7U A;  5GHX A;  3UE1 A;  2C5W B;  1YMX A;  1PI5 A;  2EX9 A;  1G68 A;  2PU4 A;  3BFC A;  3Q07 A;  4PPR A;  2J9O A;  2E8I A;  1L0E A;  2ZC5 B;  4GZB A;  3BLM A;  1Q2Q A;  5J8X A;  5HW3 A;  3PBN A;  4JLF A;  3HLW A;  1ES2 A;  4BLM A;  1J9M A;  4XUX A;  4PMA A;  4OPZ A;  2R9W A;  4BL2 A;  1K55 A;  1HTZ A;  4S2K A;  2HDR A;  1JWV A;  1IEM A;  1FR6 A;  4R1G A;  2WGW B;  3MBZ A;  3IF6 A;  2J8Y A;  4B88 A;  4JKT A;  2Z2M B;  4XXR A;  3VFH A;  4EBP A;  2Q9N A;  3W4Q A;  2Y4A A;  5HFO A;  1W8Q A;  3V3S A;  3BEB A;  3IXB A;  4OKP A;  4R3J A;  1YLZ A;  1K6R A;  3NBL A;  1ES4 A;  1ZG6 A;  2QZ6 A;  3OCN A;  4KZ7 A;  3UDX A;  4IBX A;  3N8R A;  3HLF A;  5TR7 A;  4ZJ1 A;  3PAE A;  3Q7V A;  5FI6 A;  1XA1 A;  3GV9 A;  2FFY A;  3M2J A;  2XQZ A;  1KDS A;  3IXH A;  3G34 A;  4K91 A;  1JWP A;  3NC8 A;  4X55 A;  5DVA A;  1BLP A;  1IKI A;  3HLG A;  5FI2 A;  1IEL A;  4RYE A;  1E4D A;  4WBG A;  5HAI A;  4B4X A;  3VP0 A;  5E2G A;  1FCN A;  1PYY A;  2ZC6 B;  4KZ3 A;  3ZVT A;  2Y2H A;  1RP5 A;  3N6I A;  4OP8 A;  4GD8 A;  2GDN A;  1SCW A;  4ZJ2 A;  2PU2 A;  4EBN A;  3FWL A;  2H0Y A;  4OQG A;  4QU3 A;  1CI9 A;  3NDG A;  3C4O A;  4R0Q A;  3EQV A;  4BQM A;  4R3B A;  3ZDJ A;  4BEN A;  1FSY A;  1OME A;  3AGF A;  4QB8 A;  1H5X A;  3W8K A;  3WRT A;  3FZC A;  3SS4 A;  5HAQ A;  3PBS A;  2BG1 A;  1U60 A;  5AQA A;  1RGY A;  2VGJ A;  3IF5 A;  1BZA A;  1DJB A;  3GTC A;  4UAA A;  3P98 A;  5JYP A;  3UY6 A;  3OC2 A;  3VSK A;  5L2F A;  3UDF A;  2V20 A;  1GCE A;  2HPB A;  2V1Z A;  4KZB A;  3VOZ A;  1K54 A;  5AQ9 A;  5M18 A;  2ZD8 A;  1ONG A;  5FAS A;  1YLJ A;  3C4P A;  4F94 A;  4U0X A;  1YT4 A;  4Y0T A;  4C6Y A;  1BLS A;  3RXX A;  2Y2Q A;  2EX6 A;  3G2Z A;  2XFS A;  1H8Z A;  3ZGA B;  2JCH A;  3C7V A;  3BLS A;  1M40 A;  1BT5 A;  2CC1 A;  4HBT A;  1ERM A;  3M2K A;  4GDN A;  4RVA A;  2C6W B;  4N1H A;  2XFT A;  4S2M A;  5CEC A;  4QY6 A;  2ZM2 A;  5G18 A;  5DTT A;  1I5Q A;  4EV4 A;  2XF3 A;  4DKI A;  4JXW A;  3WS2 A;  3SH9 A;  3HUN A;  2Y2G A;  4P0M A;  3ZCZ A;  4BD1 A;  3S1Y A;  4N1X A;  3BM6 A;  2HP5 A;  2X01 A;  3V50 A;  4RX2 A;  2A3U A;  4DRT A;  5EEC A;  2XD5 A;  5FDH A;  4S2N A;  4JXS A;  1M6K A;  2H10 A;  2FFF B;  3O87 A;  4JBF A;  3RJU A;  2Y2O A;  4LCM A;  5KSC A;  3OCL A;  4JF4 A;  4LEN A;  3EQU A;  3LCE A;  2Z2L B;  1WYC A;  3C5A A;  3FYZ A;  2XLN A;  4FCF A;  1SDN A;  5GHZ A;  1LI0 A;  3IH8 A;  1L2S A;  5DTS A;  1LLB A;  1N9B A;  4EQI A;  5F1G A;  3W4O A;  1S6R A;  4C75 A;  3SH8 A;  3LY3 A;  4K0X A;  4KG5 A;  4X68 A;  2RCX A;  3BFG A;  5EVL A;  2JC7 A;  1XP4 A;  4P87 A;  5DF9 A;  2HDQ A;  1GA9 A;  3B3X A;  3HVF A;  2IWB A;  2XGN A;  2HDU A;  3ZVW A;  3BFD A;  1TDL A;  3IF6 B;  1NJ4 A;  1G6A A;  3A3F A;  3BFE A;  4X69 A;  5IHV A;  3DTM A;  1HVB A;  3OPL A;  4DDS A;  2QPN A;  2IWD A;  1BLH A;  1GHP A;  4E6X A;  4R23 A;  1ZG4 A;  1NY0 A;  1ZKJ A;  2R9X A;  3OZH A;  3NI9 A;  1BTL A;  2OLV A;  4MBK A;  4IVK A;  5CER A;  2ZC7 A;  3ZG7 B;  5CGS A;  1IYS A;  1IKG A;  2EX2 A;  2WZZ A;  2XD1 A;  2IWC A;  4OPR A;  1K57 A;  4E6W A;  4OON A;  1I2S A;  5E43 A;  1PI4 A;  1K6S A;  2WKH A;  3V3R A;  4WYY A;  4L0L A;  4UA9 A;  3VSL A;  4JXV A;  5GHY A;  5F82 A;  3FV7 A;  3LEZ A;  3BRM A;  4LV0 A;  4WEL A;  1ES3 A;  4FSF A;  3VP2 A;  2ZMA A;  4Q8I A;  3IXG A;  5BOH A;  3VP1 A;  5M19 A;  5DF8 A;  5A93 A;  3GSG A;  4QD4 A;  5CHJ A;  4WZ4 A;  3HLB A;  4E3N A;  4NK3 A;  2RL3 A;  4EWF A;  3BFF A;  1FQG A;  4E3O A;  3TSG A;  1S0W A;  2P9V A;  4KG2 A;  3UN7 A;  4LV2 A;  1ERQ A;  2EX8 A;  2ZQ8 A;  3M6B A;  3QNC A;  1I2W A;  4JPM A;  3GVB A;  4KZ5 A;  3IHA A;  3S22 A;  1IYQ A;  2OLU A;  4KZ6 A;  4EBL A;  1YQS A;  3DWK A;  3I7J A;  3G4P A;  5HL1 A;  4C3Q A;  4DDY A;  4DF6 A;  3PAG A;  5TGF A;  1NXY A;  1GA0 A;  3Q81 A;  3E2L A;  4KG6 A;  3UE3 A;  4MEZ A;  4D2O A;  1YM1 A;  4R4R A;  4RA7 A;  4PM6 A;  3ZG8 B;  2Y2P A;  3NIA A;  5KMW A;  3WS5 A;  2X71 A;  3ITA A;  4JF5 A;  4E3L A;  1K55 C;  3DW0 A;  4OOY A;  4Y0O A;  1ALQ A;  1PWC A;  3FKW A;  5CED A;  4QHC A;  5CHM A;  3IF6 C;  1XGJ A;  5CXW A;  5KZH A;  5AQB A;  4PM8 A;  3O86 A;  3ISG A;  1ES5 A;  1JTD A;  1FR1 A;  3IWI A;  1Q2P A;  4KZ8 A;  1HD8 A;  2Y2K A;  4UHU A;  1LL9 A;  4CJN A;  1MKI A;  5EVI A;  1Y54 A;  1VQQ A;  4PM9 A;  4YFM A;  5FSR A;  5FA7 A;  1KE3 A;  2Y2L A;  2Y55 A;  1PW1 A;  2ZQD A;  3OPR A;  5FQJ A;  3FKV A;  4E3M A;  2WYX A;  4KZ9 A;  5U47 A;  2EFU A;  1Z6F A;  4OVD A;  5I94 A;  2WZX A;  2H0T A;  3Q7Z A;  3PBR A;  3VFF A;  4WEK A;  1E25 A;  3WWX A;  3UNW A;  4E3I A;  3MXS A;  3V5M A;  1XXM A;  2OSU A;  3TOI A;  5TFQ A;  2ZQ7 A;  2HDS A;  3BYD A;  3JYI A;  2DNS A;  3QHY A;  4PM7 A;  4ZJ3 A;  3VP3 A;  4PM5 A;  1ESU A;  1MY8 A;  1SDE A;  5D3O A;  1MXO A;  3MKE A;  1W8Y A;  3ITB A;  4XUZ A;  1CK3 A;  4O7D A;  2ZQ9 A;  3W4P A;  3O88 A;  2A49 A;  4MBH A;  4QY5 A;  4KEN B;  2V2F F;  4UA7 A;  4OPQ A;  3ZNY A;  5GLD A;  1KGE A;  4WM9 A;  2ZJ9 A;  3RXW A;  3IWO A;  1RCJ A;  4BD0 A;  3OPH A;  5DTK A;  1NYY A;  4DE3 A;  3PBT A;  2G2W A;  1GHM A;  1EWZ A;  3A3I A;  4WEJ A;  5FAT A;  1IYP A;  3ZFZ A;  4OP5 A;  4DE0 A;  5CTM A;  4WZ5 A;  3A3J A;  5AQ7 A;  3GR2 A;  5M1A A;  4BL3 A;  1JWZ A;  3IH9 A;  2Q9M A;  3V39 A;  1TVF A;  3AGE A;  3WS4 A;  1EI5 A;  1YMS A;  4N9K A;  4KZA A;  5FQI A;  3WRZ A;  4YIN A;  5GLA A;  2DCF A;  2B5R A;  4S2J A;  2G2U A;  3N7W A;  4FD8 A;  1C3B A;  1FCO A;  4Y0U A;  4P6B A;  3N8S A;  2EXB A;  1KGG A;  5FAQ A;  4WMC A;  4DE2 A;  5JYO A;  3TG9 A;  1MPL A;  1L0F A;  4HBU A;  1MWU A;  4N92 A;  3AGD A;  5E2H A;  1MBL A;  2P74 A;  3HRE A;  2WAD A;  1K56 A;  2XR0 A;  3CG5 A;  5FAP A;  1N4O A;  5FQM A;  4OPY A;  2ZQA A;  3Q7V B;  4R4S A;  3HUO A;  2X02 A;  4UA6 A;  4ZTK A;  1FCM A;  4LV3 A;  4S2N C;  4ZAM A;  2XH9 A;  3MFD A;  5FQQ A;  4E3K A;  4QJG A;  3GRJ A;  5EOO A;  3OPP A;  3HLD A;  1SHV A;  1XKZ A;  3PBQ A;  1ONH A;  4N9L A;  2EXA A;  3HLC A;  3ZHH A;  1PW8 A;  2ZM0 A;  1E3U A;  5FI7 A;  4CPK A;  5E2E A;  1MWS A;  1JVJ A;  3UO9 A;  1KVM A;  1L0G A;  1PZP A;  1TDG A;  1LI9 A;  5EE8 A;  4OQH A;  5CRF A;  1DJA A;  3NDE A;  5CHU A;  2J9P A;  5CGX A;  4OLD A;  5FAO A;  1KVL A;  1O07 A;  2XEP A;  4Z9Q A;  4K0W A;  4LV1 A;  4S2L A;  5GLC A;  3G32 A;  1ESI A;  1YLW A;  1KGF A;  1W7F A;  2I72 A; 
#chains in the Genus database with same CATH topology
 2W3G A;  3HJK A;  1ID3 C;  1NRF A;  4GD6 A;  5AVB A;  4J8W A;  1KDW A;  1P34 A;  2NQB B;  1PWD A;  1YU3 A;  5B2I C;  3VP4 A;  5DNN A;  3G2Y A;  4IBB A;  4J8U A;  1P0Z A;  4RX3 A;  2FH5 A;  5C5K A;  2WGW A;  2WAE A;  5B2J A;  3EPK A;  3CHW P;  4LCL A;  1G28 A;  1ACF A;  4GKU A;  3A0V A;  3DWZ A;  3S7O A;  3HUM A;  3IT9 A;  4IVI A;  1SKF A;  3L29 A;  2HUE C;  3MZD A;  5G4Y A;  5F99 D;  4AWL B;  4PAU A;  5DF7 A;  2Y91 A;  4R70 A;  2JBF A;  3E98 A;  1YLY A;  4GOG A;  3C1B D;  2IA2 A;  2DF4 C;  1LSV A;  4DJ3 A;  2Y59 A;  4Y7P A;  3WS0 A;  3AZN C;  4GN2 A;  3OOV A;  5B32 G;  3MNN D;  3BY8 A;  3REJ D;  4HJ4 A;  4WUJ A;  3NQU A;  3VOY A;  4IED A;  5B24 C;  2WAF A;  1XGI A;  2NQB C;  4ID4 A;  4WMC D;  5DFY A;  5L10 A;  4J8V D;  5GT3 A;  5AV5 A;  2WUQ A;  3MGR A;  3H0L C;  1K4F A;  4E44 A;  4NXB A;  4ZBJ B;  2Z6D A;  3QP5 A;  4JF6 A;  4XT2 B;  1WE4 A;  5EPH A;  2WGI A;  3UPN A;  3X1S A;  1UR9 A;  5A91 A;  3LZ1 D;  1PWG A;  1WYB A;  3LIB A;  4Z66 D;  2Y2M A;  3T4K A;  3VMA A;  1P3O B;  3SS3 A;  1XJ6 A;  3REK D;  4S2I A;  4UUZ A;  4H6J B;  1ERO A;  3CMZ A;  1KX3 B;  1XJ2 A;  4JXG A;  2M7V A;  1VB6 A;  2QMI A;  4L9G A;  4ZRR A;  2XK1 A;  3AZJ A;  3DAV A;  1RGZ A;  1XPB A;  3SOI A;  1W2E A;  3B6F A;  2ZM8 A;  1VM1 A;  4HHD A;  2VA0 A;  1BUL A;  4X6T A;  3ZG0 A;  2EFX A;  3G31 A;  4O8G A;  4F3L B;  4KQQ A;  2L0W A;  4FH4 A;  4S2P A;  2PYO C;  3PTE A;  2QJ7 A;  2OAP 1;  4B4Z A;  3WAA A;  4Z2K A;  1P3L A;  2ZQC A;  3BEC A;  5AV8 B;  2C5W B;  1YMX A;  5F5Y A;  5EFW A;  4NXF A;  4CQH A;  5L07 A;  1ZLA C;  4ZUX D;  5B2I A;  1F2K A;  4Z2M H;  1ES2 A;  1J9M A;  3EEA A;  4GCZ A;  3L2A A;  1HTZ A;  4S2K A;  1JWV A;  1AOI A;  3WA9 B;  1IEM A;  4R1G A;  3NHQ A;  3REL A;  2J8Y A;  2Z2M B;  4DMZ A;  1P3I B;  1S32 D;  1T18 A;  4ZBJ C;  1W8Q A;  2PAV P;  4OKP A;  1K6R A;  4IBF A;  3NBL A;  2QZ6 A;  3UDX A;  3OCN A;  5B0Y A;  4BBV A;  1DP8 A;  2F8N G;  1P3O C;  3PAE A;  2FFY A;  3IXH A;  1KX5 A;  2GJ3 A;  1JWP A;  3HLG A;  1KX3 C;  1N9N A;  1IEL A;  3O62 D;  3VP0 A;  4PKY G;  5E2G A;  3AZG D;  2ZC6 B;  2Y2H A;  3AZN A;  4GD8 A;  2GDN A;  4EBN A;  3HCY A;  1J7M A;  5E5A D;  2PD7 A;  4BQM A;  3H82 B;  4R3B A;  4GW9 A;  3W8K A;  3SS4 A;  1YU4 A;  5B1M A;  3KS8 A;  5AV8 C;  3GEC A;  5AQA A;  5B1L D;  5B24 A;  2VGJ A;  1EAK A;  2BYK B;  3LZ0 D;  4IJG A;  4UAA A;  3ULF A;  3P98 A;  3E4O A;  2VEA A;  4R3A A;  5BT1 D;  4LLO B;  2IO5 B;  2QYB A;  4XZQ A;  5CPI A;  3T4S A;  3AFA D;  3LI9 A;  3S7P A;  2W1T B;  3WA9 C;  1ONG A;  4F94 A;  4Y0T A;  4HGA C;  1P3I C;  1BLS A;  2Y2Q A;  2EX6 A;  3X1V D;  5B0Z A;  4WU9 B;  3AZH A;  1E15 A;  3BLS A;  2GNX A;  3LZ0 A;  3KFU G;  3D9Y A;  1M40 A;  1ZHH B;  2OAQ 1;  4HBT A;  4EXO A;  3M2K A;  1B67 A;  1T3U A;  3VH5 W;  4RVA A;  4N1H A;  2XFT A;  3W2Z A;  4KGC B;  4UEY A;  2FJ7 B;  4G91 B;  1I5Q A;  4I39 A;  4EV4 A;  4DKI A;  5HDS A;  3WS2 A;  3ZCZ A;  2HP5 A;  3REH A;  3VH6 A;  3QP6 A;  3V50 A;  1TS7 A;  4DN0 A;  5EEC A;  2INW A;  1V9Z A;  1P3A B;  1M6K A;  2H10 A;  2PYO A;  3OCL A;  3EQU A;  3LCE A;  2CMN A;  3B0C W;  1SDN A;  1LI0 A;  3TW8 A;  1ZLA A;  5DTS A;  4YM6 D;  1X0O A;  3R45 A;  2HIO C;  1P3G B;  5GSU D;  4X68 A;  4GJ4 A;  3BQA A;  4Z2L A;  2JKT M;  5EVL A;  2JC7 A;  3M7P A;  2HDQ A;  4R8P B;  2HDU A;  4WF0 A;  3BFD A;  2IO5 C;  5J7E A;  1G6A A;  3BFE A;  3OPL A;  5BNX B;  4DDS A;  4H9S C;  1GHP A;  3VV4 A;  3C1C D;  3MF0 A;  4R23 A;  1NY0 A;  2R9X A;  2R78 A;  1SKO A;  2JKR I;  4H9P A;  2ZC7 A;  3TU4 D;  5CGS A;  1T1B A;  1IYS A;  2JKF A;  2IWC A;  4OPR A;  3DTK A;  1LT0 A;  1K6S A;  3V3R A;  3KWQ D;  4L0L A;  4KGC C;  5GHY A;  3FV7 A;  3CLO A;  4JGQ A;  4G91 C;  3MGQ B;  4Q8I A;  4Z5T B;  4NZ5 A;  4Z2G A;  4H9R A;  5CPK C;  3MR0 A;  4WN5 A;  4WZ4 A;  3B0C T;  2W27 A;  4YS3 C;  3TSG A;  4LV2 A;  2EX8 A;  4JPM A;  4F3L A;  3GVB A;  3LEQ A;  1M18 D;  2VGL S;  4KZ6 A;  5AV8 A;  1EQZ D;  2JKT I;  5HL1 A;  4C3Q A;  5HPI A;  1GA0 A;  3Q81 A;  4KG6 A;  4MEZ A;  4D2O A;  1YM1 A;  3IS2 B;  1P3G C;  1H0M A;  2X71 A;  3AZK C;  1AIW A;  4NG2 A;  4E3L A;  4R8P C;  5B31 B;  4Y0O A;  3A6N B;  1OTD A;  3UTB D;  3MVD D;  3AYW B;  1TAF B;  1LSX A;  5CXW A;  5KZH A;  4PM8 A;  4QLC B;  4CLC E;  1KX4 A;  5DNM A;  5B32 A;  1ES5 A;  1YUE A;  1S66 L;  3UE6 A;  5CP6 B;  1YSQ A;  3IWI A;  1Q2P A;  4KZ8 A;  1HD8 A;  2Y2K A;  1LL9 A;  1TZY B;  1Y54 A;  1VQQ A;  5FSR A;  2Y55 A;  1GOI A;  1P3P A;  2ZQD A;  1IOU A;  5CPJ B;  4X23 A;  4DJ2 A;  5B40 A;  3UTB A;  1P3K D;  3W97 B;  5JRG A;  3WWX A;  3MGQ C;  2VV7 A;  3T1Q B;  3UNW A;  4E3I A;  5GT0 A;  2PYP A;  3TOI A;  4Z5T C;  4JJN B;  1HQ3 C;  1CXW A;  2ZQ7 A;  4WNN B;  2CV5 B;  2HDS A;  2GZA A;  3JYI A;  3R7W B;  3EG5 B;  3K2N A;  5B33 D;  2V0U A;  1MXO A;  2E8J A;  1W8Y A;  3BW6 A;  4MBH A;  3KUY A;  1VEU A;  4OPQ A;  2HIO A;  3KXB D;  3A1I A;  2ZJ9 A;  4BD0 A;  1TS0 A;  4M6B A;  2OOL A;  3V9R B;  1UWN X;  4DE0 A;  4ME4 A;  5IU1 A;  3KO6 A;  3A3J A;  3QP1 A;  5B31 C;  1NWZ A;  2M1C A;  3A6N C;  5GXQ D;  1ODV A;  3AYW C;  3AZE D;  3WS4 A;  3PHY A;  3WD2 A;  1EI5 A;  4QLC C;  3UME A;  4ESP A;  5FQI A;  3WRZ A;  5L8M A;  2DCF A;  5CP6 C;  4HH2 A;  2B5R A;  2RVQ C;  3LIC A;  1TZY C;  4AFI A;  4OJ6 A;  2K2N A;  4P6B A;  2ZY4 A;  1MPL A;  2F8N D;  4GH9 A;  4N92 A;  3MGS D;  3AV1 B;  3AGD A;  1E6P A;  1MBL A;  2DMW A;  4H9Q B;  5CPJ C;  2B02 A;  2XA7 S;  3DTE A;  1M19 A;  4WJ3 C;  3WTP B;  2XR0 A;  5F68 A;  3S7Q A;  5CPK A;  3TJZ C;  1GSV A;  4OPY A;  2ZQA A;  5AV6 C;  4YS3 A;  4ZTK A;  5FQQ A;  1FCM A;  4Q0J A;  4ZAM A;  4E3K A;  4QJG A;  1F66 B;  2CWE A;  5EOO A;  5FL3 A;  2NZD D;  2CV5 C;  3HLD A;  5FUG B;  1SHV A;  1R4V A;  2EXA A;  3W96 D;  5AVC B;  5FI7 A;  3T1X A;  2P7J A;  5CHL B;  3T4T A;  1JVJ A;  3AZI A;  3UO9 A;  1KVM A;  1LI9 A;  1P3M D;  5EE8 A;  5CRF A;  1DJA A;  3NDE A;  1OTB A;  5CHU A;  1YU2 A;  3KYQ A;  3AV2 D;  1KVL A;  1O07 A;  4Z9Q A;  3AZK A;  4S2L A;  2VV6 A;  3C2W A;  1KGF A;  1U35 D;  4KZ4 A;  3ZG5 A;  3X1T C;  3UDI A;  5EVI D;  2OV5 A;  4KQO A;  5CTN A;  1BH8 A;  3G30 A;  2FN2 A;  2G5H C;  3A3D A;  2XDM A;  3REI D;  1K57 C;  4MBF A;  4EQ1 A;  1B6W A;  4BMW A;  3MZE A;  1BFM A;  3AV1 C;  3IXD A;  1H0G A;  4D60 A;  4MN6 A;  1K25 A;  4H8R A;  1BLC A;  3QNB A;  4X53 A;  3ZG9 B;  5FEG A;  3CUE A;  1HQ3 A;  3LY4 A;  1F9I A;  5F6A A;  1NYM A;  1GHI A;  5F99 B;  5J3W A;  3ICY A;  2J3T C;  3SS5 A;  3CZD A;  5HAR A;  1NZO A;  5HWV A;  2ZMF A;  3REI A;  2WKP A;  4P6Z S;  2O0Y A;  5AVC C;  1HZO A;  3C1B B;  3P5J B;  1VET A;  3UPO A;  3IS2 A;  1GSW A;  3UE0 A;  4X25 A;  1W1Y A;  3MNN B;  5DJT A;  3MQQ A;  4JGR A;  3REJ B;  5B31 A;  2PBY A;  2VGK A;  3A6N A;  3RFB A;  3D4F A;  4Y15 A;  3MQ0 A;  4I3J A;  5GLB A;  5F1F A;  3UTA D;  3H7W B;  4KUD A;  1TZY A;  1P3F A;  4X56 A;  4J8X C;  3WD0 A;  5EUA A;  3F6T A;  4J8V B;  3LEL D;  4XUJ D;  1K56 D;  1W79 A;  4HQA A;  4M3K A;  4DXB A;  1DJC A;  2GX5 A;  2G7U A;  1CEG A;  3LZ1 B;  4Z66 B;  5AV6 A;  3KS4 A;  3AZL B;  2JE5 A;  3UB6 A;  5AV9 A;  3KSH A;  4WNN A;  1E3U D;  3N4I A;  4NZ3 A;  4FH2 A;  3E2K A;  3HBR A;  3EPJ A;  4GNU A;  4FTX A;  3WS1 A;  4H9O B;  4NET A;  1BH9 A;  3HL9 A;  3LI8 A;  5E2F A;  3M6H A;  1M1A D;  3SW1 A;  1KE0 A;  5HSQ A;  2ZC3 B;  3C1B C;  2Y8H A;  2HP9 A;  4P85 A;  4GS9 A;  2MJ6 A;  2ARO A;  4DQY B;  1V9Y A;  1JFI B;  1OTI A;  5AVB D;  4J8W D;  1QMF A;  3MNN C;  3KSF A;  1P34 D;  3UE1 A;  3X1T A;  3N3F A;  3REJ C;  1PI5 A;  2PU4 A;  3BFC A;  2F8N K;  1L0E A;  2ZC5 B;  3BLM A;  5DNN D;  2DQN C;  5HW3 A;  2D01 A;  4J8U D;  3PBN A;  4JLF A;  3HLW A;  4ZUX B;  4PMA A;  2ZL1 B;  4OPZ A;  1F98 A;  5B2J D;  2V5O A;  3UT9 A;  1K55 A;  4BL2 A;  1TS6 A;  3LR0 A;  3MBZ A;  4IBD A;  2EA9 A;  3V3S A;  3IXB A;  1S32 B;  1ZG6 A;  3T1S A;  3BQ8 A;  3HLF A;  5TR7 A;  3KSY A;  2YFV A;  3LZ1 C;  4Z66 C;  1E8B A;  5FI6 A;  3AZL C;  3DTI A;  3G34 A;  4X55 A;  4B9O A;  3W99 A;  3IX8 A;  4RYE A;  2O9A A;  1PYY A;  4KZ3 A;  3N6I A;  3O62 B;  3FWL A;  2H0Y A;  3AZG B;  5IT5 A;  3NDG A;  4R6L A;  3W98 A;  4L9F A;  1J3W A;  4TX8 A;  4X1M A;  5E5A B;  1FSY A;  1N9L A;  1OME A;  3AGF A;  3CPT B;  1LL8 A;  3IX4 A;  3FZC A;  3NUL A;  1U60 A;  1RGY A;  5J4E A;  1BZA A;  5GT3 D;  5B1L B;  5AV5 D;  5JYP A;  3MGR D;  3LJA A;  5L2F A;  4IJF A;  4J8X A;  2V20 A;  3UDF A;  4ZUX C;  2V1Z A;  3X1S D;  1E88 A;  3AFA B;  1YLJ A;  3T4Q A;  3C4P A;  4MDZ A;  1YT4 A;  3VH6 T;  1S32 C;  3FC7 A;  3X1V B;  2O9C A;  1ERM A;  3AZM A;  2C6W B;  4WV4 B;  3AZJ D;  5CEC A;  4IBC A;  1S4R A;  3B6F D;  4IUK A;  5G18 A;  4EES A;  4GHI A;  2PBD P;  3SH9 A;  3HUN A;  2Y2G A;  4P0M A;  3S1Y A;  4N1X A;  2X01 A;  4DRT A;  1MKM A;  4Y3I A;  2XD5 A;  3B6G A;  1EW0 A;  4B93 A;  1OTA A;  3WAA D;  4JBF A;  2FFF B;  1P3L D;  3O87 A;  4AWL C;  4O0P A;  4R38 A;  3FDD A;  5HD5 A;  3EOI A;  4EEP A;  5BO0 B;  4JF4 A;  4LEN A;  2ZOH A;  2G5I C;  2Z2L B;  5EM0 A;  3MQL A;  5B2I D;  5E5A C;  3FYZ A;  4FCF A;  4I3A A;  5GHZ A;  3IH8 A;  3QP4 A;  4I5S A;  1L2S A;  1N9B A;  4YM6 B;  4PHT A;  4KG5 A;  1AOI D;  2RCX A;  5B1L C;  1XP4 A;  3REL D;  2AVX A;  3LR3 A;  5GSU B;  5BNV B;  1G5U A;  3HVF A;  2XGN A;  3IF6 B;  1NJ4 A;  5IHV A;  3F1N B;  5BT1 C;  1HVB A;  1F1E A;  5B0Y D;  1ID3 A;  3AFA C;  1OTE A;  1ZKJ A;  3F1P A;  3OZH A;  2PR5 A;  3C1C B;  2OLV A;  1KX5 D;  4IVK A;  3ZG7 B;  3X1V C;  4Z2I A;  4NZ4 A;  4E6W A;  3L9K A;  2WKH A;  4CSR B;  3VSL A;  4JXV A;  3AZN D;  2O99 A;  5F82 A;  4WEL A;  4FSF A;  3KWQ B;  2VKS A;  2Z6C A;  4I38 A;  2EWW A;  3IXG A;  3K3C A;  4HJ6 A;  5CHJ A;  4ETX A;  3HLB A;  3UMD A;  4E3N A;  4WU8 B;  1S0W A;  3UN7 A;  4BBT A;  3NEC A;  4KZ5 A;  1I2W A;  3T4L A;  1P9W A;  5B1M D;  3IHA A;  5B24 D;  1KOU A;  4EBL A;  1M18 B;  1H3O A;  2NQB D;  4DDY A;  2A24 B;  2W3H A;  4DF6 A;  1EQZ B;  4I3I A;  2EWV A;  4XZQ D;  4R4R A;  5CPI D;  2Y2P A;  4YM6 C;  4WZS B;  3A0S A;  2ZL1 A;  2NUT C;  4YWZ A;  1CF0 A;  5GSU C;  4IBJ A;  3IF6 C;  2BYM A;  5B0Z D;  3AZH D;  3QP2 A;  1JTD A;  1FR1 A;  2NQB A;  4CJN A;  4UQI S;  3C1C C;  4EW7 A;  1ULY A;  2Y2L A;  4LPZ A;  3OPR A;  3B0D B;  2KX6 A;  3FPW A;  4KZ9 A;  2EFU A;  3REH D;  1E6N A;  4X1L A;  1W1P A;  2WZX A;  3LYX A;  3KWQ C;  2PYR A;  1P3K B;  2PYO D;  5JA4 B;  1OJ5 A;  4PM5 A;  2DNS A;  3QHY A;  4WU8 C;  3VP3 A;  3HSH A;  2JKR M;  1OGG A;  1ZLA D;  4HJ3 A;  3CAX A;  1CK3 A;  5B33 B;  3B33 A;  3W4P A;  3CWF A;  2A49 A;  4QY5 A;  1M18 C;  5B31 G;  3ZNY A;  5GLD A;  1KGE A;  2QWS A;  3KXB B;  1P3B B;  1H3Q A;  5EVE A;  1Y4O A;  2G2W A;  2VLG A;  3MXQ A;  1KU5 A;  5EM1 A;  5M1A A;  4BL3 A;  4NFT A;  1PRQ A;  3V39 A;  3JVV A;  3IBR A;  4N9K A;  3AN2 B;  4KZA A;  3AZE B;  3D3O A;  3KYZ A;  4LD9 B;  4LGW A;  2YFW B;  2G2U A;  3N7W A;  4FD8 A;  3T1R A;  5DFX A;  1SZV A;  5FAQ A;  3NQJ B;  2HJE A;  3TG9 A;  3B0D C;  3H9W A;  1YAX A;  5AY8 B;  2QHK A;  3B0B A;  4XT2 A;  4DRA A;  2F8N B;  4H9N B;  5HL6 A;  3UB7 A;  2WAD A;  4CAY B;  4NE6 A;  3CG5 A;  1H8P A;  4WU9 C;  5FAP A;  5BPV A;  1P3O A;  1P3K C;  3Q7V B;  4R4S A;  2X02 A;  4S2N C;  4H6J A;  5AV8 D;  1KX3 A;  3PBQ A;  2HZ5 A;  2NZD B;  4NYY A;  2FJ7 C;  1PZP A;  4FUW A;  4IJE A;  1P3M B;  1P3A C;  2J9P A;  4OLD A;  2XEP A;  5HDC A;  4Y13 A;  1W63 M;  1P3B C;  1WA9 A;  3AV2 B;  3EGD C;  1KX4 D;  5DNM D;  5B32 D;  1YLW A;  1N1J B;  1W7F A;  1D06 A;  1MWT A;  1U35 B;  2ZLY A;  2H28 A;  5EVI B;  1P3P D;  3AN2 C;  5EV0 A;  3AZE C;  3AZF B;  1JTG A;  2WKI A;  3QP8 A;  4OLG A;  4LD9 C;  4NXE A;  4Z2M G;  4X23 D;  3R4K A;  2IOU A;  3WKJ B;  4RQ9 A;  5B40 D;  1FSW A;  3WA9 A;  5JRG D;  5A90 A;  5GT0 D;  4S2O A;  1WWI A;  1P3I A;  1FOF A;  4NE5 A;  5AY8 C;  2V8F A;  4A5R A;  5KDM B;  5HAP A;  2YKH A;  4GDB A;  4HOI A;  3GMW A;  3Q82 A;  4WU8 A;  3O3V A;  2M7U A;  3IX3 A;  1QME A;  3LO7 A;  4OQI A;  4Y2F A;  3MXR A;  3KUY D;  1T1A A;  1T1C A;  2PHY A;  2HIO D;  4OOL A;  4ARZ B;  2ZC4 B;  4P6Z M;  4HIA A;  5FEF A;  4Z2H A;  5CGW A;  3IWQ A;  4OH0 A;  4MLL A;  3LFV A;  3ZNT A;  5GL9 A;  5HX9 A;  4EO5 B;  1P3M C;  3SH7 A;  5EOE A;  2ZY5 A;  3BWL A;  4MCW A;  1E6Z A;  3H82 A;  3AV2 C;  1P97 A;  4ZDX A;  1LHY A;  2F2A C;  1K38 A;  3F1O B;  2UWX A;  2DRW A;  2BYK A;  3KX0 X;  3UTA B;  3BJN A;  5FQ9 A;  5EVI C;  1P9R A;  4IBE A;  3H0R C;  3AZF C;  3HON A;  1VHM A;  2JN7 A;  3N8L A;  1BUE A;  1M19 D;  3WKJ C;  1K54 C;  3MS6 A;  4H9S A;  3L25 A;  1KE4 A;  2W1T A;  1N9O A;  1H8M A;  3LEL B;  4XUJ B;  5CPK D;  1XA7 A;  3UB5 P;  4M4X A;  4YS3 D;  4LRY C;  4HME A;  3LR4 A;  1GSX A;  4WU9 A;  1MWR A;  4CLC B;  2XSS A;  1YPR A;  4GB7 A;  3NOU C;  2J3W A;  4KGC A;  3AZI D;  5FQK A;  2FJ7 A;  3ZQ5 A;  1UGU A;  3HLE A;  1NLY A;  1D1J A;  3X1U B;  4FOF A;  1PIO A;  2WK0 A;  3A1K A;  3A3E A;  3W97 C;  3NOT C;  1NZU A;  2HP6 A;  3AZK D;  3PXP A;  2YKF A;  2H5S A;  1M1A B;  1P3A A;  4JJN C;  4Q0H A;  3T4J A;  1FIL A;  4DXC A;  3IHB A;  2W3D A;  4WZ5 C;  3MZF A;  3C7U A;  5GHX A;  1OJG A;  2EX9 A;  4J8W B;  2J9O A;  1P34 B;  4GZB A;  3RH8 B;  3G6O A;  4LRX C;  3AN2 A;  4BLM A;  1P3G A;  5DNN B;  4LD9 A;  2ACG A;  4NZ1 A;  4R8P A;  2WGW B;  1WWS A;  5B2J B;  1XFQ A;  2UV0 E;  4JKT A;  2V8C A;  3VH5 A;  4XXR A;  3VFH A;  2Q9N A;  2Y4A A;  5BNX A;  2ZBB A;  4Z5T D;  3MGP B;  5AY8 A;  4R3J A;  1HQ3 D;  4H9N A;  1CQA A;  1YLZ A;  4NY2 A;  4LFU A;  2J8P A;  4IBG A;  2I9V A;  3VE4 A;  4ETZ A;  4CLC C;  1OT6 A;  3Q7V A;  1XA1 A;  3GV9 A;  3M2J A;  4K91 A;  3NC8 A;  4G3V A;  5AVF A;  1IKI A;  1S67 L;  3MGQ A;  3MMH A;  3ZVT A;  1FCN A;  3X1U C;  1E6R A;  4UPK A;  3A0R A;  3WTP C;  1SCW A;  2PU2 A;  1OGB A;  4Z5T A;  2W3F A;  4OQG A;  5A8B A;  4QU3 A;  5B31 D;  3A6N D;  4HNB A;  1DRM A;  1UWP X;  1F66 C;  2D49 A;  1T19 A;  3ZDJ A;  4BEN A;  3NQU B;  1H5X A;  5HAQ A;  5CP6 D;  3PBS A;  4KUD D;  2HGV A;  1TZY D;  1P3F D;  2WKQ A;  4J8W C;  4LG2 A;  2PR6 A;  2V9A A;  3GTC A;  3UY6 A;  1TS8 A;  3VSK A;  5AV5 B;  3MGR B;  1GCE A;  2HPB A;  5CPJ D;  3E4P A;  3WKJ A;  1O6I A;  1K54 A;  5AQ9 A;  5M18 A;  5FAS A;  3X1S B;  3AYW A;  3O5Y A;  1TAF A;  5B2J C;  4HMD A;  3S7N A;  4U0X A;  4C6Y A;  4QLC A;  3RXX A;  5AV6 D;  1A0K A;  2PDR A;  3T4O A;  5CP6 A;  3MGP C;  2XFS A;  1H8Z A;  3ZGA B;  4Q0I A;  5AV9 D;  4UUZ B;  2CC1 A;  1CJF A;  4GDN A;  2B95 A;  4KQD A;  4S2M A;  4YNR A;  1IFQ A;  2RTS A;  3AZJ B;  5CPJ A;  2XF3 A;  3H0M C;  3B6F B;  3BM6 A;  5TBM B;  3W97 A;  4ARZ A;  4IHQ A;  2A3U A;  4G3W A;  1YU0 A;  2ARO D;  2W0N A;  4JJN A;  3RJU A;  3REK B;  2CV5 A;  3L28 A;  3X1T D;  1P3L B;  3MFX A;  3R7W A;  5F99 C;  3JPU A;  3C5A A;  1UR8 A;  1L6J A;  4EQI A;  1LLB A;  5B2I B;  5F1G A;  1S6R A;  3UB8 A;  3SH8 A;  3UT9 D;  4GLQ A;  3BFG A;  4HP9 A;  4P87 A;  2V1B A;  5G4Z A;  1AOI B;  3EEH A;  3B3X A;  2IWB A;  5AV5 C;  3MGR C;  3V9R A;  3REL B;  1Z09 A;  4JGP A;  1CK7 A;  3DTM A;  2QPN A;  3VE3 A;  4E6X A;  2LY8 A;  2F8N H;  5B0Y B;  2HUE B;  2VJW A;  2KLI A;  3W99 D;  5CER A;  4CLC A;  2XD1 A;  1KX5 B;  1K57 A;  1I2S A;  1PI4 A;  2OWJ A;  1W1V A;  4J8V C;  3EGX C;  3E4Q A;  3AV1 A;  3LEZ A;  4LV0 A;  2VX8 A;  2QKP A;  3AZJ C;  4H9Q A;  3X1U A;  5BOH A;  2B18 A;  5IS1 A;  3W98 D;  1AWI A;  3WTP A;  4EER A;  2RL3 A;  4NEE D;  4KG2 A;  3JVU A;  4Y5F A;  5L09 A;  1F66 A;  3REK C;  3VH6 W;  5FUG A;  1IYQ A;  5B1M B;  1P3L C;  1BYW A;  4K08 A;  1YQS A;  3DWK A;  5B24 B;  5AVC A;  3L27 A;  3LJA D;  3PAG A;  4J8X D;  3DBA A;  3E2L A;  4PM6 A;  2PRF A;  5KMW A;  5HPF A;  4XZQ B;  3WS5 A;  5CPI B;  3ITA A;  4E45 A;  3DW0 A;  2L1M A;  1AOI C;  1ALQ A;  1PWC A;  2LB9 A;  3FKW A;  2VQR A;  3REL C;  3ISG A;  1G6O A;  5B0Z B;  2ZOI A;  5KIZ A;  3MGP A;  3AZM D;  3AZH B;  4UHU A;  3PYP A;  3LZ0 B;  5B0Y C;  4YFM A;  4IBK A;  1D7E A;  5FA7 A;  4UQI M;  4E3M A;  2WYX A;  5U47 A;  5BS7 C;  1KX5 C;  2ZMV A;  5I94 A;  4MN5 A;  1TD5 A;  3REH B;  1TF1 A;  3FPV A;  3B6G D;  1OPX A;  5MC7 A;  4OJ5 A;  3V5M A;  2P08 A;  1XXM A;  2OSU A;  4IUH A;  5TFQ A;  2PYO B;  3BYD A;  4ZJ3 A;  3GDI A;  5F99 A;  1MY8 A;  1SDE A;  4BWI A;  3B47 A;  3ITB A;  3K3D A;  3FKE A;  1ZLA B;  4KHA B;  5B1M C;  3R45 B;  4OUI A;  3TRC A;  3C1B A;  3O62 C;  3IWO A;  3AZG C;  3OPH A;  5DTK A;  4DE3 A;  1MC0 A;  3PBT A;  1GHM A;  4WEJ A;  1ID3 D;  4OP5 A;  4XZQ C;  5CTM A;  5CPI C;  1L3L A;  3MNN A;  5AQ7 A;  3GR2 A;  3REJ A;  1JWZ A;  3IH9 A;  2Q9M A;  1TVF A;  3AGE A;  1YMS A;  4YOF A;  1GPF A;  4YIN A;  3H7W A;  1SKO B;  5B0Z C;  3AZL D;  3AZH C;  4H9P B;  4S2J A;  3LZ0 C;  1C3B A;  4Y0U A;  1KGG A;  4WMC A;  5JYO A;  1L0F A;  4J8V A;  4HBU A;  1XJ3 A;  2P74 A;  2WKR A;  3HRE A;  5C3I B;  3REH C;  2HJ9 C;  4H9R B;  5TBM A;  3LZ1 A;  4Z66 A;  2XH9 A;  3AZL A;  5HD3 A;  3TU4 B;  2HV1 A;  3REK A;  3OPP A;  1DP9 A;  4N9L A;  3HLC A;  2ZM0 A;  4CPK A;  1STZ A;  5E2E A;  4H9O A;  1F5M A;  3RTY A;  5CGX A;  5FAO A;  3VOL A;  3P7N A;  4EET B;  5K5B A;  3LR5 A;  3G32 A;  1ESI A;  1JFI A;  2J7V A;  1KX4 B;  4HGA B;  5B32 B;  5DNM B;  2VGL M;  5CEB A;  2WGV A;  4HY8 A;  1BSG A;  5AVE A;  1K0K A;  4ZUX A;  1S4S A;  4O01 A;  1P3P B;  3D72 A;  4EEU A;  5BS7 A;  4DRB A;  1CI8 A;  2Y79 A;  4X23 B;  1K4E A;  3B42 A;  2KOI A;  5B40 B;  3GQZ A;  2W8S A;  3UTB B;  1YLP A;  3MVD B;  1LL5 A;  5JRG B;  4MMN A;  4HES A;  2BLS A;  4OJP A;  5GT0 B;  4ZBE A;  1S32 A;  1QO6 A;  5C3I C;  4U0T A;  1PZO A;  2VZW A;  3MKF A;  3UPP A;  4MNR A;  4G92 B;  5F83 A;  3TU4 C;  4MN7 A;  4KQR A;  4OJL A;  4JGO A;  2VV8 A;  1YLT A;  3KUY B;  1FIK A;  3PBO A;  1VEU B;  5A92 A;  2HIO B;  2K7S A;  2V1A A;  2ZY3 A;  3O62 A;  4HEF A;  2L5A A;  2Y2J A;  4GHL A;  4KUK A;  2WKE A;  3P09 A;  3AZG A;  1Y28 A;  1MZU A;  1XFN A;  4EUZ A;  1XX2 A;  4OQ0 A;  3FG8 A;  4QWO A;  2W3E A;  5E5A A;  1ZC2 A;  3CPT A;  1L0D A;  1NRJ A;  1KX4 C;  5DNM C;  5B32 C;  3NCK A;  1H8Y A;  3WD3 A;  3LID A;  1DY6 A;  1EQZ C;  5B1L A;  3LIF A;  1O7E A;  3G35 A;  3CJM A;  2JKG A;  3LGO A;  4BJP A;  1P3P C;  4OJO A;  2PD8 A;  4OOM A;  3Q1F A;  1W5D A;  4X23 C;  1M19 B;  3AFA A;  5B40 C;  1P3O D;  3UTB C;  4U3T A;  5GXQ B;  3MVD C;  4HI4 A;  5I5L A;  3S4X A;  4WL9 A;  5JRG C;  5CPK B;  2ZM5 A;  3NY4 A;  5GT0 C;  4YS3 B;  1TEM A;  4E04 A;  3X1V A;  1KX3 D;  2ZY2 A;  3EPH A;  4G92 C;  3IQA A;  2Y2N A;  3MGS B;  3AZI B;  2XA7 M;  4IBR A;  2L4R A;  1CEF A;  4QPR A;  2Y2I A;  4KHA A;  4E3J A;  5KSH A;  5HDD A;  3KUY C;  3BY9 A;  1ED7 A;  4NXG A;  2P9V B;  1AXB A;  4DE1 A;  3AZK B;  4GHA A;  5BO0 A;  3L26 A;  1IYO A;  4WLA A;  3U2A A;  5HZH A;  1G68 A;  3Q07 A;  4PPR A;  3VH5 T;  5B33 C;  2E8I A;  3W96 B;  1BH8 B;  1Q2Q A;  3NJA A;  5J8X A;  3CIT A;  5G49 B;  4XUX A;  4YM6 A;  1XJ4 A;  3WA9 D;  3HJI A;  2R9W A;  3KXB C;  2HDR A;  5GSU A;  5BNV A;  1FR6 A;  2FZ0 A;  1P3I D;  2NUP C;  3IF6 A;  4B88 A;  3MSH A;  4EBP A;  3F1N A;  2O9B A;  3W4Q A;  5HFO A;  3BEB A;  1M19 C;  1ES4 A;  3WD4 A;  4KZ7 A;  4IBX A;  5GXQ C;  1HQ3 B;  4WU8 D;  3N8R A;  5HWW A;  3C1C A;  4ZJ1 A;  3E0Y A;  2XQZ A;  1KDS A;  3TU4 A;  5DVA A;  3REI B;  1BLP A;  5FI2 A;  4CSR A;  3T12 B;  1E4D A;  4WBG A;  5HAI A;  4B4X A;  5HWT A;  3KWQ A;  3MGS C;  3AZI C;  1RP5 A;  4OP8 A;  4ZJ2 A;  2KDK A;  1VET B;  2XRN A;  3LUQ A;  1CI9 A;  4MB5 A;  3C4O A;  4R0Q A;  3EQV A;  3LIA A;  2LB5 A;  3CI6 A;  3WRT A;  1HLU P;  4QB8 A;  4IBI A;  4NKP A;  2BG1 A;  2NZD C;  3IF5 A;  1M18 A;  2XRO A;  2A24 A;  4KUD B;  1PZR A;  1DJB A;  3W96 C;  1EQZ A;  3OC2 A;  3KYE A;  1P3F B;  4KZB A;  2PT7 A;  3VOZ A;  3PR6 A;  3WTP E;  2ZD8 A;  1Q9C A;  4KUO A;  5F69 A;  4WU9 D;  1YU1 A;  3WX7 A;  3MVD A;  1YSP A;  3G2Z A;  1U35 C;  2JCH A;  3C7V A;  5AV6 B;  3WD1 A;  1BT5 A;  3CUE C;  4KGC D;  5AV9 B;  3L7H A;  3T50 A;  2FJ7 D;  4QY6 A;  3OLO A;  2ZM2 A;  3MJQ A;  5DTT A;  4JXW A;  1BH9 B;  3REI C;  4BD1 A;  3UB9 A;  2OWH A;  4LRZ E;  1P3A D;  4RX2 A;  1P3B D;  1P3K A;  3KSG A;  5JA4 A;  5FDH A;  4S2N A;  4JXS A;  4GS9 B;  2Y2O A;  4LCM A;  2ARO B;  5KSC A;  3AL0 C;  1HTA A;  3X1T B;  1WYC A;  2XLN A;  3AN2 D;  5B33 A;  1P3G D;  3W4O A;  4LD9 D;  4C75 A;  2JHE A;  3LY3 A;  1YKD A;  4K0X A;  4R8P D;  4KUD C;  4HMC A;  3UT9 B;  5DF9 A;  1GA9 A;  3KXB A;  1P3F C;  1P3B A;  5TJJ A;  3ZVW A;  4EO5 C;  2A2L A;  1TDL A;  5AY8 D;  2Q0O A;  3A3F A;  4X69 A;  2V0W A;  3C30 A;  5AVB B;  2IWD A;  1BLH A;  4MB4 A;  1ZG4 A;  1JNU A;  5GXQ A;  3AZE A;  3NI9 A;  1BTL A;  3LIE A;  2YFV B;  4MBK A;  5LBR A;  4J8U B;  3UTA C;  2BAS A;  2YFW A;  1IKG A;  2EX2 A;  2WZZ A;  1H0I A;  4HH3 A;  3W99 B;  5AV9 C;  4OON A;  5E43 A;  3NQJ A;  3MGQ D;  4WYY A;  4UA9 A;  1S1Y A;  3BRM A;  1ES3 A;  3VP2 A;  2ZMA A;  2F8N A;  3LEL C;  4XUJ C;  3MGS A;  3VP1 A;  5M19 A;  5DF8 A;  5A93 A;  3GSG A;  4CAY A;  4QD4 A;  5CX7 A;  2QJ5 A;  3SZT A;  4EWF A;  3W98 B;  4NK3 A;  3BFF A;  1FQG A;  4E3O A;  2P9V A;  1ERQ A;  2ZQ8 A;  3M6B A;  3QNC A;  3V67 A;  4QNL A;  4PKY A;  2ARO C;  5DKL A;  3S22 A;  2OLU A;  5DJU A;  2NZD A;  2HF6 A;  1PDC A;  3I7J A;  3G4P A;  5TGF A;  1NXY A;  3UE3 A;  3W96 A;  3AZF D;  3LJA B;  2W1R A;  3NOP C;  4RA7 A;  4J8X B;  3ZG8 B;  5G49 A;  1M1A C;  3WKJ D;  1P3M A;  1PNE A;  2K31 A;  3NIA A;  4JF5 A;  3AYW D;  3UT9 C;  1K55 C;  2JSS A;  4OOY A;  4QLC D;  3AV2 A;  5CED A;  1S1Z A;  4QHC A;  3OBF A;  5CHM A;  1N1J A;  1XGJ A;  5AQB A;  3O86 A;  2RVQ D;  1PFL A;  5AVB C;  3IBJ A;  1U35 A;  1P34 C;  2BTF P;  5AJG A;  1MKI A;  5EVI A;  3AZM B;  5GT3 B;  2VK3 A;  4PM9 A;  3AZF A;  5DNN C;  1KE3 A;  4J8U C;  1PW1 A;  5FQJ A;  3FKV A;  1Z6F A;  3C8C A;  4GHI B;  4OVD A;  3W97 D;  3W99 C;  2H0T A;  3Q7Z A;  3PBR A;  4Y17 A;  3VFF A;  4WEK A;  4BBU A;  1E25 A;  1Z2C B;  4JJN D;  3MXS A;  1ZTU A;  3B6G B;  1DP6 A;  2CV5 D;  5KDM A;  4EU0 A;  3W98 C;  5DKK A;  1KS0 A;  4PM7 A;  3TE8 A;  1ESU A;  5D3O A;  3EPL A;  3MKE A;  4XUZ A;  3MQO A;  2D02 A;  2ZQ9 A;  4O7D A;  4Z2J A;  3ZYT A;  3O88 A;  4KEN B;  2V2F F;  4UA7 A;  4WM9 A;  3KSI A;  1W1T A;  3RXW A;  1OT9 A;  4MB3 A;  3LJA C;  1RCJ A;  5FDS A;  1NYY A;  3ZFZ A;  1EWZ A;  3A3I A;  3WAA B;  5FAT A;  1IYP A;  4HP4 A;  4Z1W A;  4WZ5 A;  1ID3 B;  1NLZ A;  4EUV A;  3F1P B;  4CLC D;  3F1O A;  1W63 Q;  5GLA A;  3UTA A;  3P01 A;  1FCO A;  3AZM C;  5GT3 C;  3AV1 D;  3N8S A;  2EXB A;  4DE2 A;  1MWU A;  3X1U D;  5E2H A;  3WTP D;  3X1S C;  3LEL A;  4XUJ A;  1K56 A;  4II7 A;  3U4L P;  1F66 D;  1N4O A;  2J3T D;  3C38 A;  5FQM A;  3B6G C;  4L9E A;  3HUO A;  4NE3 A;  1LSW A;  4UA6 A;  4LV3 A;  3MFD A;  2P04 A;  3GRJ A;  1GXD A;  5AVC D;  1XKZ A;  1ONH A;  3ZHH A;  3IP4 C;  1H3O B;  1E3U A;  1PW8 A;  1MWS A;  3AZN B;  3EWK A;  1A7W A;  3B6F C;  1L0G A;  1TDG A;  2J80 A;  4OQH A;  4G3K A;  1M1A A;  2RIQ A;  4K0W A;  4LV1 A;  5GLC A;  4NYU A;  3WAA C;  2BYM B;  2I72 A;  3MGP D; 
#chains in the Genus database with same CATH homology
 1ID3 C;  1NRF A;  4GD6 A;  5AVB A;  4J8W A;  1KDW A;  1P34 A;  2NQB B;  1PWD A;  1YU3 A;  5B2I C;  3VP4 A;  5DNN A;  3G2Y A;  4IBB A;  4J8U A;  4RX3 A;  2WGW A;  2WAE A;  5B2J A;  3EPK A;  4LCL A;  4GKU A;  3DWZ A;  3HUM A;  3IT9 A;  4IVI A;  1SKF A;  3L29 A;  2HUE C;  3MZD A;  5F99 D;  4AWL B;  5DF7 A;  2Y91 A;  2JBF A;  1YLY A;  4GOG A;  3C1B D;  2DF4 C;  2Y59 A;  4Y7P A;  3WS0 A;  3AZN C;  4GN2 A;  5B32 G;  3MNN D;  3REJ D;  3NQU A;  3VOY A;  4IED A;  5B24 C;  2WAF A;  1XGI A;  2NQB C;  4ID4 A;  4WMC D;  4J8V D;  5GT3 A;  5AV5 A;  2WUQ A;  3MGR A;  3H0L C;  1K4F A;  4E44 A;  4ZBJ B;  4JF6 A;  3UPN A;  1WE4 A;  5EPH A;  2WGI A;  3X1S A;  5A91 A;  3LZ1 D;  1PWG A;  1WYB A;  4Z66 D;  2Y2M A;  3VMA A;  1P3O B;  3SS3 A;  3REK D;  4S2I A;  4UUZ A;  1ERO A;  3CMZ A;  1KX3 B;  4JXG A;  2QMI A;  2XK1 A;  3AZJ A;  1RGZ A;  1XPB A;  3SOI A;  1W2E A;  3B6F A;  2ZM8 A;  1VM1 A;  1BUL A;  4X6T A;  3ZG0 A;  2EFX A;  3G31 A;  4KQQ A;  4FH4 A;  4S2P A;  2PYO C;  3PTE A;  4B4Z A;  3WAA A;  1P3L A;  2ZQC A;  3BEC A;  5AV8 B;  2C5W B;  1YMX A;  1ZLA C;  4ZUX D;  5B2I A;  4Z2M H;  1ES2 A;  1J9M A;  3L2A A;  1HTZ A;  4S2K A;  1JWV A;  1AOI A;  3WA9 B;  1IEM A;  4R1G A;  3REL A;  2J8Y A;  2Z2M B;  1P3I B;  1S32 D;  4ZBJ C;  1W8Q A;  4OKP A;  1K6R A;  4IBF A;  3NBL A;  2QZ6 A;  3UDX A;  3OCN A;  5B0Y A;  2F8N G;  1P3O C;  3PAE A;  2FFY A;  3IXH A;  1KX5 A;  1JWP A;  3HLG A;  1KX3 C;  1IEL A;  3O62 D;  3VP0 A;  5E2G A;  3AZG D;  2ZC6 B;  2Y2H A;  3AZN A;  4GD8 A;  2GDN A;  4EBN A;  5E5A D;  4BQM A;  4R3B A;  3W8K A;  3SS4 A;  1YU4 A;  5B1M A;  3KS8 A;  5AV8 C;  5AQA A;  5B1L D;  5B24 A;  2VGJ A;  2BYK B;  3LZ0 D;  4UAA A;  3P98 A;  5BT1 D;  2IO5 B;  4XZQ A;  5CPI A;  3AFA D;  3WA9 C;  1ONG A;  4F94 A;  4Y0T A;  4HGA C;  1P3I C;  1BLS A;  2Y2Q A;  2EX6 A;  3X1V D;  5B0Z A;  4WU9 B;  3AZH A;  3BLS A;  3LZ0 A;  3KFU G;  1M40 A;  4HBT A;  3M2K A;  1B67 A;  1T3U A;  3VH5 W;  4RVA A;  4N1H A;  2XFT A;  4KGC B;  2FJ7 B;  4G91 B;  1I5Q A;  4EV4 A;  4DKI A;  3WS2 A;  3ZCZ A;  2HP5 A;  3REH A;  3VH6 A;  3V50 A;  5EEC A;  1P3A B;  1M6K A;  2H10 A;  2PYO A;  3OCL A;  3EQU A;  3LCE A;  3B0C W;  1SDN A;  1LI0 A;  1ZLA A;  5DTS A;  4YM6 D;  3R45 A;  2HIO C;  1P3G B;  5GSU D;  4X68 A;  5EVL A;  2JC7 A;  2HDQ A;  4R8P B;  2HDU A;  3BFD A;  2IO5 C;  1G6A A;  3BFE A;  3OPL A;  5BNX B;  4DDS A;  4H9S C;  1GHP A;  3C1C D;  4R23 A;  1NY0 A;  2R9X A;  4H9P A;  2ZC7 A;  3TU4 D;  5CGS A;  1IYS A;  2IWC A;  4OPR A;  1K6S A;  3V3R A;  3KWQ D;  4L0L A;  4KGC C;  5GHY A;  3FV7 A;  4G91 C;  3MGQ B;  4Q8I A;  4Z5T B;  4NZ5 A;  4H9R A;  5CPK C;  4WZ4 A;  3B0C T;  4YS3 C;  3TSG A;  4LV2 A;  2EX8 A;  4JPM A;  3GVB A;  1M18 D;  4KZ6 A;  5AV8 A;  1EQZ D;  5HL1 A;  4C3Q A;  1GA0 A;  3Q81 A;  4KG6 A;  4MEZ A;  4D2O A;  1YM1 A;  1P3G C;  2X71 A;  3AZK C;  4E3L A;  4R8P C;  5B31 B;  4Y0O A;  3A6N B;  3UTB D;  3MVD D;  3AYW B;  1TAF B;  5CXW A;  5KZH A;  4PM8 A;  4QLC B;  1KX4 A;  5DNM A;  5B32 A;  1ES5 A;  1YUE A;  5CP6 B;  3IWI A;  1Q2P A;  4KZ8 A;  1HD8 A;  2Y2K A;  1LL9 A;  1TZY B;  1Y54 A;  1VQQ A;  5FSR A;  2Y55 A;  2ZQD A;  1P3P A;  5CPJ B;  4X23 A;  5B40 A;  3UTB A;  1P3K D;  3W97 B;  5JRG A;  3WWX A;  3MGQ C;  3UNW A;  4E3I A;  5GT0 A;  3TOI A;  4Z5T C;  4JJN B;  1HQ3 C;  2ZQ7 A;  4WNN B;  2CV5 B;  2HDS A;  3JYI A;  3EG5 B;  5B33 D;  1MXO A;  1W8Y A;  4MBH A;  3KUY A;  4OPQ A;  2HIO A;  3KXB D;  3A1I A;  2ZJ9 A;  4BD0 A;  4M6B A;  3V9R B;  4DE0 A;  3A3J A;  5B31 C;  3A6N C;  5GXQ D;  3AYW C;  3AZE D;  3WS4 A;  1EI5 A;  4QLC C;  5FQI A;  3WRZ A;  2DCF A;  5CP6 C;  2B5R A;  2RVQ C;  1TZY C;  4OJ6 A;  4P6B A;  2ZY4 A;  1MPL A;  2F8N D;  4GH9 A;  4N92 A;  3MGS D;  3AV1 B;  3AGD A;  1MBL A;  5CPJ C;  4H9Q B;  1M19 A;  4WJ3 C;  3WTP B;  2XR0 A;  5CPK A;  4OPY A;  2ZQA A;  5AV6 C;  4YS3 A;  4ZTK A;  5FQQ A;  1FCM A;  4ZAM A;  4E3K A;  4QJG A;  1F66 B;  2CWE A;  5EOO A;  2NZD D;  2CV5 C;  3HLD A;  5FUG B;  1SHV A;  1R4V A;  2EXA A;  3W96 D;  5AVC B;  5FI7 A;  5CHL B;  1JVJ A;  3AZI A;  3UO9 A;  1KVM A;  1LI9 A;  1P3M D;  5EE8 A;  5CRF A;  1DJA A;  3NDE A;  5CHU A;  1YU2 A;  3AV2 D;  1KVL A;  1O07 A;  4Z9Q A;  3AZK A;  4S2L A;  1KGF A;  1U35 D;  4KZ4 A;  3ZG5 A;  3X1T C;  3UDI A;  5EVI D;  2OV5 A;  4KQO A;  5CTN A;  1BH8 A;  3G30 A;  2G5H C;  3A3D A;  2XDM A;  3REI D;  1K57 C;  4MBF A;  1B6W A;  3MZE A;  1BFM A;  3AV1 C;  3IXD A;  1K25 A;  4H8R A;  1BLC A;  3QNB A;  4X53 A;  3ZG9 B;  1HQ3 A;  3LY4 A;  1NYM A;  1GHI A;  5F99 B;  3SS5 A;  3CZD A;  5HAR A;  1NZO A;  3REI A;  5AVC C;  1HZO A;  3C1B B;  3P5J B;  3UPO A;  3UE0 A;  3MNN B;  3REJ B;  5B31 A;  2PBY A;  2VGK A;  3A6N A;  3D4F A;  5GLB A;  5F1F A;  3UTA D;  4KUD A;  1TZY A;  1P3F A;  4X56 A;  4J8X C;  5EUA A;  3F6T A;  4J8V B;  3LEL D;  4XUJ D;  1K56 D;  1W79 A;  4M3K A;  4DXB A;  1DJC A;  1CEG A;  3LZ1 B;  4Z66 B;  5AV6 A;  3KS4 A;  3AZL B;  2JE5 A;  5AV9 A;  4WNN A;  1E3U D;  3N4I A;  4NZ3 A;  4FH2 A;  3E2K A;  3HBR A;  3EPJ A;  4GNU A;  3WS1 A;  4H9O B;  4NET A;  1BH9 A;  3HL9 A;  5E2F A;  3M6H A;  1M1A D;  1KE0 A;  2ZC3 B;  3C1B C;  2HP9 A;  4P85 A;  2ARO A;  4DQY B;  1JFI B;  5AVB D;  4J8W D;  1QMF A;  3MNN C;  1P34 D;  3UE1 A;  3X1T A;  3N3F A;  3REJ C;  1PI5 A;  2PU4 A;  3BFC A;  2F8N K;  1L0E A;  2ZC5 B;  3BLM A;  5DNN D;  2DQN C;  5HW3 A;  3PBN A;  4J8U D;  4JLF A;  3HLW A;  4ZUX B;  4PMA A;  4OPZ A;  5B2J D;  4BL2 A;  3UT9 A;  1K55 A;  3MBZ A;  4IBD A;  3V3S A;  3IXB A;  1S32 B;  1ZG6 A;  3HLF A;  5TR7 A;  3KSY A;  2YFV A;  3LZ1 C;  4Z66 C;  5FI6 A;  3AZL C;  3G34 A;  4X55 A;  3W99 A;  4RYE A;  1PYY A;  4KZ3 A;  3N6I A;  3O62 B;  3FWL A;  2H0Y A;  3AZG B;  3NDG A;  3W98 A;  5E5A B;  1FSY A;  1OME A;  3AGF A;  3FZC A;  1U60 A;  1RGY A;  1BZA A;  5GT3 D;  5B1L B;  5AV5 D;  5JYP A;  3MGR D;  3LJA A;  5L2F A;  4IJF A;  4J8X A;  2V20 A;  3UDF A;  4ZUX C;  2V1Z A;  3X1S D;  3AFA B;  1YLJ A;  3C4P A;  1YT4 A;  3VH6 T;  1S32 C;  3X1V B;  1ERM A;  3AZM A;  2C6W B;  4WV4 B;  3AZJ D;  5CEC A;  4IBC A;  5G18 A;  3B6F D;  3SH9 A;  3HUN A;  2Y2G A;  4P0M A;  3S1Y A;  4N1X A;  2X01 A;  4DRT A;  2XD5 A;  3B6G A;  3WAA D;  4JBF A;  2FFF B;  1P3L D;  3O87 A;  4AWL C;  3FDD A;  5BO0 B;  4JF4 A;  4LEN A;  2G5I C;  2Z2L B;  5B2I D;  5E5A C;  3FYZ A;  4FCF A;  5GHZ A;  3IH8 A;  1L2S A;  1N9B A;  4YM6 B;  4KG5 A;  1AOI D;  2RCX A;  5B1L C;  1XP4 A;  3REL D;  5GSU B;  5BNV B;  3HVF A;  2XGN A;  3IF6 B;  1NJ4 A;  5IHV A;  5BT1 C;  1HVB A;  1F1E A;  5B0Y D;  1ID3 A;  3AFA C;  1ZKJ A;  3OZH A;  3C1C B;  2OLV A;  1KX5 D;  4IVK A;  3ZG7 B;  3X1V C;  4NZ4 A;  4E6W A;  2WKH A;  4CSR B;  3VSL A;  4JXV A;  3AZN D;  5F82 A;  4WEL A;  4FSF A;  3KWQ B;  3IXG A;  5CHJ A;  3HLB A;  4E3N A;  4WU8 B;  1S0W A;  3UN7 A;  4KZ5 A;  1I2W A;  5B1M D;  3IHA A;  5B24 D;  4EBL A;  1M18 B;  1H3O A;  2NQB D;  4DDY A;  4DF6 A;  1EQZ B;  4XZQ D;  4R4R A;  5CPI D;  2Y2P A;  4YM6 C;  4WZS B;  5GSU C;  4IBJ A;  3IF6 C;  2BYM A;  5B0Z D;  3AZH D;  1JTD A;  1FR1 A;  2NQB A;  4CJN A;  3C1C C;  1ULY A;  2Y2L A;  3OPR A;  3B0D B;  4KZ9 A;  2EFU A;  3REH D;  2WZX A;  3KWQ C;  1P3K B;  2PYO D;  5JA4 B;  4PM5 A;  2DNS A;  3QHY A;  4WU8 C;  3VP3 A;  3HSH A;  1ZLA D;  1CK3 A;  5B33 B;  3W4P A;  2A49 A;  4QY5 A;  1M18 C;  5B31 G;  3ZNY A;  5GLD A;  1KGE A;  3KXB B;  1P3B B;  2G2W A;  1KU5 A;  5M1A A;  4BL3 A;  4NFT A;  3V39 A;  4N9K A;  3AN2 B;  4KZA A;  3AZE B;  4LD9 B;  2YFW B;  2G2U A;  3N7W A;  4FD8 A;  5FAQ A;  3NQJ B;  3TG9 A;  3B0D C;  5AY8 B;  3B0B A;  4DRA A;  2F8N B;  4H9N B;  2WAD A;  4CAY B;  4NE6 A;  3CG5 A;  4WU9 C;  5FAP A;  5BPV A;  1P3O A;  1P3K C;  3Q7V B;  4R4S A;  2X02 A;  4S2N C;  5AV8 D;  1KX3 A;  3PBQ A;  2NZD B;  4NYY A;  2FJ7 C;  1PZP A;  4IJE A;  1P3M B;  1P3A C;  2J9P A;  4OLD A;  2XEP A;  1P3B C;  3AV2 B;  1KX4 D;  5DNM D;  5B32 D;  1YLW A;  1N1J B;  1W7F A;  1MWT A;  1U35 B;  2ZLY A;  5EVI B;  1P3P D;  3AN2 C;  3AZE C;  3AZF B;  1JTG A;  2WKI A;  4OLG A;  4LD9 C;  4Z2M G;  4X23 D;  2IOU A;  3WKJ B;  5B40 D;  1FSW A;  3WA9 A;  5JRG D;  5A90 A;  5GT0 D;  4S2O A;  1WWI A;  1P3I A;  1FOF A;  4NE5 A;  5AY8 C;  4A5R A;  5KDM B;  5HAP A;  4GDB A;  3GMW A;  3Q82 A;  4WU8 A;  3O3V A;  1QME A;  3LO7 A;  4OQI A;  3MXR A;  3KUY D;  2HIO D;  4OOL A;  2ZC4 B;  5CGW A;  3IWQ A;  4OH0 A;  4MLL A;  3ZNT A;  5GL9 A;  5HX9 A;  4EO5 B;  1P3M C;  3SH7 A;  5EOE A;  2ZY5 A;  3AV2 C;  4ZDX A;  1LHY A;  2F2A C;  1K38 A;  2UWX A;  2DRW A;  2BYK A;  3UTA B;  5FQ9 A;  5EVI C;  4IBE A;  3H0R C;  3AZF C;  3HON A;  3N8L A;  1BUE A;  1M19 D;  3WKJ C;  1K54 C;  4H9S A;  3L25 A;  1KE4 A;  3LEL B;  4XUJ B;  5CPK D;  1XA7 A;  4YS3 D;  4WU9 A;  1MWR A;  4GB7 A;  4KGC A;  3AZI D;  5FQK A;  2FJ7 A;  3HLE A;  3X1U B;  1PIO A;  2WK0 A;  3A1K A;  3A3E A;  3W97 C;  1NZU A;  2HP6 A;  3AZK D;  2H5S A;  1M1A B;  1P3A A;  4JJN C;  4DXC A;  3IHB A;  4WZ5 C;  3MZF A;  3C7U A;  5GHX A;  2EX9 A;  4J8W B;  2J9O A;  1P34 B;  4GZB A;  3AN2 A;  4BLM A;  1P3G A;  5DNN B;  4LD9 A;  4NZ1 A;  4R8P A;  2WGW B;  1WWS A;  5B2J B;  4JKT A;  3VH5 A;  4XXR A;  3VFH A;  2Q9N A;  2Y4A A;  5BNX A;  4Z5T D;  3MGP B;  5AY8 A;  4R3J A;  1HQ3 D;  4H9N A;  1YLZ A;  4NY2 A;  2J8P A;  4IBG A;  3Q7V A;  1XA1 A;  3GV9 A;  3M2J A;  4K91 A;  3NC8 A;  1IKI A;  3MGQ A;  3ZVT A;  1FCN A;  3X1U C;  4UPK A;  3WTP C;  1SCW A;  2PU2 A;  4Z5T A;  4OQG A;  4QU3 A;  5B31 D;  3A6N D;  1F66 C;  3ZDJ A;  4BEN A;  3NQU B;  1H5X A;  5HAQ A;  5CP6 D;  3PBS A;  4KUD D;  1TZY D;  1P3F D;  4J8W C;  4LG2 A;  3GTC A;  3UY6 A;  3VSK A;  5AV5 B;  3MGR B;  1GCE A;  2HPB A;  5CPJ D;  3WKJ A;  1K54 A;  5AQ9 A;  5M18 A;  5FAS A;  3X1S B;  3AYW A;  1TAF A;  5B2J C;  4U0X A;  4C6Y A;  4QLC A;  3RXX A;  5AV6 D;  5CP6 A;  3MGP C;  2XFS A;  1H8Z A;  3ZGA B;  5AV9 D;  4UUZ B;  2CC1 A;  4GDN A;  4S2M A;  3AZJ B;  5CPJ A;  2XF3 A;  3H0M C;  3B6F B;  3BM6 A;  3W97 A;  2A3U A;  1YU0 A;  2ARO D;  4JJN A;  3RJU A;  3REK B;  2CV5 A;  3L28 A;  3X1T D;  1P3L B;  5F99 C;  3C5A A;  4EQI A;  1LLB A;  5B2I B;  5F1G A;  1S6R A;  3SH8 A;  3UT9 D;  3BFG A;  4P87 A;  1AOI B;  3B3X A;  2IWB A;  5AV5 C;  3MGR C;  3V9R A;  3REL B;  3DTM A;  2QPN A;  4E6X A;  2LY8 A;  2F8N H;  5B0Y B;  2HUE B;  3W99 D;  5CER A;  2XD1 A;  1KX5 B;  1K57 A;  1I2S A;  1PI4 A;  4J8V C;  3AV1 A;  3LEZ A;  4LV0 A;  3AZJ C;  4H9Q A;  3X1U A;  5BOH A;  3W98 D;  3WTP A;  2RL3 A;  4KG2 A;  1F66 A;  3REK C;  3VH6 W;  5FUG A;  1IYQ A;  5B1M B;  1P3L C;  1YQS A;  3DWK A;  5B24 B;  5AVC A;  3L27 A;  3LJA D;  3PAG A;  4J8X D;  3E2L A;  4PM6 A;  5KMW A;  4XZQ B;  3WS5 A;  5CPI B;  3ITA A;  4E45 A;  3DW0 A;  1AOI C;  1ALQ A;  1PWC A;  3FKW A;  2VQR A;  3REL C;  3ISG A;  5B0Z B;  3MGP A;  3AZM D;  3AZH B;  4UHU A;  3LZ0 B;  5B0Y C;  4YFM A;  4IBK A;  5FA7 A;  4E3M A;  2WYX A;  5U47 A;  5BS7 C;  1KX5 C;  5I94 A;  3REH B;  3B6G D;  4OJ5 A;  3V5M A;  1XXM A;  2OSU A;  5TFQ A;  2PYO B;  3BYD A;  4ZJ3 A;  5F99 A;  1MY8 A;  1SDE A;  3ITB A;  3FKE A;  1ZLA B;  4KHA B;  5B1M C;  3R45 B;  4OUI A;  3C1B A;  3O62 C;  3IWO A;  3AZG C;  3OPH A;  5DTK A;  4DE3 A;  3PBT A;  1GHM A;  4WEJ A;  1ID3 D;  4OP5 A;  4XZQ C;  5CTM A;  5CPI C;  3MNN A;  5AQ7 A;  3GR2 A;  3REJ A;  1JWZ A;  3IH9 A;  2Q9M A;  1TVF A;  3AGE A;  1YMS A;  4YIN A;  5B0Z C;  3AZL D;  3AZH C;  4H9P B;  4S2J A;  3LZ0 C;  1C3B A;  4Y0U A;  1KGG A;  4WMC A;  5JYO A;  1L0F A;  4J8V A;  4HBU A;  2P74 A;  3HRE A;  5C3I B;  3REH C;  4H9R B;  3LZ1 A;  4Z66 A;  2XH9 A;  3AZL A;  3TU4 B;  3REK A;  3OPP A;  4N9L A;  3HLC A;  2ZM0 A;  4CPK A;  5E2E A;  4H9O A;  5CGX A;  5FAO A;  3G32 A;  1ESI A;  1JFI A;  2J7V A;  1KX4 B;  4HGA B;  5B32 B;  5DNM B;  5CEB A;  2WGV A;  1BSG A;  4ZUX A;  1P3P B;  5BS7 A;  4DRB A;  1CI8 A;  4X23 B;  1K4E A;  5B40 B;  3GQZ A;  2W8S A;  3UTB B;  1YLP A;  3MVD B;  1LL5 A;  5JRG B;  4HES A;  2BLS A;  4OJP A;  5GT0 B;  4ZBE A;  1S32 A;  5C3I C;  4U0T A;  1PZO A;  3MKF A;  3UPP A;  4MNR A;  4G92 B;  5F83 A;  3TU4 C;  4KQR A;  4OJL A;  1YLT A;  3KUY B;  3PBO A;  5A92 A;  2HIO B;  2ZY3 A;  3O62 A;  4HEF A;  2L5A A;  2Y2J A;  4GHL A;  2WKE A;  3P09 A;  3AZG A;  4EUZ A;  1XX2 A;  4OQ0 A;  5E5A A;  1ZC2 A;  1L0D A;  1KX4 C;  5DNM C;  5B32 C;  3NCK A;  1H8Y A;  1DY6 A;  1EQZ C;  5B1L A;  1O7E A;  3G35 A;  3CJM A;  4BJP A;  1P3P C;  4OJO A;  4OOM A;  3Q1F A;  1W5D A;  4X23 C;  1M19 B;  3AFA A;  5B40 C;  1P3O D;  3UTB C;  4U3T A;  5GXQ B;  3MVD C;  3S4X A;  5JRG C;  5CPK B;  2ZM5 A;  3NY4 A;  5GT0 C;  4YS3 B;  1TEM A;  3X1V A;  1KX3 D;  2ZY2 A;  3EPH A;  4G92 C;  3IQA A;  2Y2N A;  3MGS B;  3AZI B;  4IBR A;  1CEF A;  4E3J A;  2Y2I A;  4KHA A;  5KSH A;  3KUY C;  2P9V B;  1AXB A;  4DE1 A;  3AZK B;  4GHA A;  5BO0 A;  3L26 A;  1IYO A;  1G68 A;  3Q07 A;  4PPR A;  3VH5 T;  5B33 C;  2E8I A;  3W96 B;  1BH8 B;  1Q2Q A;  5J8X A;  5G49 B;  4XUX A;  4YM6 A;  3WA9 D;  2R9W A;  3KXB C;  2HDR A;  5GSU A;  5BNV A;  1FR6 A;  1P3I D;  3IF6 A;  4B88 A;  4EBP A;  3W4Q A;  5HFO A;  3BEB A;  1M19 C;  1ES4 A;  4KZ7 A;  4IBX A;  5GXQ C;  1HQ3 B;  4WU8 D;  3N8R A;  3C1C A;  4ZJ1 A;  2XQZ A;  1KDS A;  3TU4 A;  5DVA A;  3REI B;  1BLP A;  5FI2 A;  4CSR A;  1E4D A;  4WBG A;  5HAI A;  4B4X A;  3KWQ A;  3MGS C;  3AZI C;  1RP5 A;  4OP8 A;  4ZJ2 A;  1CI9 A;  3C4O A;  4R0Q A;  3EQV A;  3WRT A;  4QB8 A;  4IBI A;  2BG1 A;  2NZD C;  3IF5 A;  1M18 A;  4KUD B;  1PZR A;  1DJB A;  3W96 C;  1EQZ A;  3OC2 A;  1P3F B;  4KZB A;  3VOZ A;  3WTP E;  2ZD8 A;  1Q9C A;  4WU9 D;  1YU1 A;  3WX7 A;  3MVD A;  3G2Z A;  1U35 C;  2JCH A;  3C7V A;  5AV6 B;  1BT5 A;  4KGC D;  5AV9 B;  2FJ7 D;  4QY6 A;  2ZM2 A;  5DTT A;  4JXW A;  1BH9 B;  3REI C;  4BD1 A;  1P3A D;  4RX2 A;  1P3B D;  1P3K A;  5JA4 A;  5FDH A;  4S2N A;  4JXS A;  2Y2O A;  4LCM A;  2ARO B;  5KSC A;  3AL0 C;  1HTA A;  3X1T B;  1WYC A;  2XLN A;  3AN2 D;  5B33 A;  1P3G D;  3W4O A;  4LD9 D;  4C75 A;  3LY3 A;  4K0X A;  4R8P D;  4KUD C;  5DF9 A;  3UT9 B;  1GA9 A;  3KXB A;  1P3F C;  1P3B A;  3ZVW A;  4EO5 C;  1TDL A;  5AY8 D;  3A3F A;  4X69 A;  5AVB B;  2IWD A;  1BLH A;  1ZG4 A;  5GXQ A;  3AZE A;  3NI9 A;  1BTL A;  2YFV B;  4MBK A;  4J8U B;  3UTA C;  2YFW A;  1IKG A;  2EX2 A;  2WZZ A;  3W99 B;  5AV9 C;  4OON A;  5E43 A;  3NQJ A;  3MGQ D;  4WYY A;  4UA9 A;  3BRM A;  1ES3 A;  3VP2 A;  2ZMA A;  2F8N A;  3LEL C;  4XUJ C;  3MGS A;  3VP1 A;  5M19 A;  5DF8 A;  5A93 A;  3GSG A;  4CAY A;  4QD4 A;  4EWF A;  3W98 B;  4NK3 A;  3BFF A;  1FQG A;  4E3O A;  2P9V A;  1ERQ A;  2ZQ8 A;  3M6B A;  3QNC A;  4QNL A;  2ARO C;  3S22 A;  2OLU A;  2NZD A;  3I7J A;  3G4P A;  5TGF A;  1NXY A;  3UE3 A;  3W96 A;  3AZF D;  3LJA B;  4RA7 A;  4J8X B;  3ZG8 B;  5G49 A;  1M1A C;  3WKJ D;  1P3M A;  3NIA A;  4JF5 A;  3AYW D;  3UT9 C;  1K55 C;  2JSS A;  4OOY A;  4QLC D;  3AV2 A;  5CED A;  4QHC A;  5CHM A;  1N1J A;  1XGJ A;  5AQB A;  3O86 A;  2RVQ D;  5AVB C;  1U35 A;  1P34 C;  1MKI A;  5EVI A;  3AZM B;  5GT3 B;  4PM9 A;  3AZF A;  5DNN C;  1KE3 A;  4J8U C;  1PW1 A;  5FQJ A;  3FKV A;  1Z6F A;  4OVD A;  3W97 D;  3W99 C;  2H0T A;  3Q7Z A;  3PBR A;  3VFF A;  4WEK A;  1E25 A;  1Z2C B;  4JJN D;  3MXS A;  3B6G B;  2CV5 D;  5KDM A;  3W98 C;  4PM7 A;  1ESU A;  5D3O A;  3EPL A;  3MKE A;  4XUZ A;  4O7D A;  2ZQ9 A;  3O88 A;  4KEN B;  2V2F F;  4UA7 A;  4WM9 A;  3RXW A;  3LJA C;  1RCJ A;  1NYY A;  3ZFZ A;  1EWZ A;  3A3I A;  3WAA B;  5FAT A;  1IYP A;  4WZ5 A;  1ID3 B;  5GLA A;  3UTA A;  1FCO A;  3AZM C;  5GT3 C;  3AV1 D;  3N8S A;  2EXB A;  4DE2 A;  1MWU A;  3X1U D;  5E2H A;  3WTP D;  3X1S C;  3LEL A;  4XUJ A;  1K56 A;  1F66 D;  1N4O A;  5FQM A;  3B6G C;  3HUO A;  4NE3 A;  4UA6 A;  4LV3 A;  3MFD A;  3GRJ A;  5AVC D;  1XKZ A;  1ONH A;  3ZHH A;  3IP4 C;  1H3O B;  1E3U A;  1PW8 A;  1MWS A;  3AZN B;  1A7W A;  3B6F C;  1L0G A;  1TDG A;  4OQH A;  1M1A A;  2RIQ A;  4K0W A;  4LV1 A;  5GLC A;  4NYU A;  3WAA C;  2BYM B;  2I72 A;  3MGP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...