2Y2PA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
489
structure length
466
Chain Sequence
b'ISEITYSDGTVIASIDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 157
structure length 466
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2pA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2pA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2pA02
3M6HA 2I72A 1XPBA 4RA7A 3VOZA 2EX8A 4PM7A 2A3UA 3ZDJA 1I5QA 5EE8A 1PWCA 3IHAA 2VGKA 4KENB 4C6YA 2WZZA 4K0XA 5DF8A 2J9OA 1TVFA 1O7EA 3BFGA 1K4FA 2Y2MA 1YLPA 5FAPA 3UNWA 4GD8A 1MPLA 1FR6A 4DXBA 4PM8A 5F1FA 1KE4A 4QD4A 3W4PA 4DDSA 1GA0A 1JTGA 1NY0A 4KZ3A 4B4XA 4K0WA 3QNBA 3UDFA 2HDQA 4QY6A 3C4OA 5CTNA 4JKTA 4IEDA 2Y2QA 1EI5A 3GSGA 1QMFA 4RVAA 4ZJ1A 2Y91A 3N7WA 4S2PA 3IQAA 1BULA 4RYEA 5FQ9A 4ZJ3A 3M6BA 1JVJA 1YLTA 4OPQA 2HP9A 5EUAA 3ZG8B 3ZHHA 4O7DA 2DNSA 1PYYA 1FSYA 1NRFA 1ES5A 4KZAA 3VFFA 2G2WA 2EX9A 1L0DA 5EVIB 2JE5A 1LI9A 1SKFA 4S2MA 2VGJA 4QB8A 1IYOA 5AQ9A 2HP5A 2XFSA 3GTCA 3V39A 1XX2A 1CEGA 2WGWB 2XGNA 1WYBA 1C3BA 3MKEA 2XD1A 1SDEA 1L2SA 2OLUA 1Y54A 4EUZA 5DVAA 3FWLA 4LCLA 2QPNA 4FCFA 2V2FF 4GD6A 4P85A 4ZBEA 1E4DA 5KSCA 5F82A 3IF6C 2XK1A 4N1XA 4MBKA 1K6RA 2PU2A 3EQVA 3IF6A 3G4PA 4KQRA 4P87A 1W5DA 4OLGA 5FQIA 2ZM8A 3LY4A 3RXWA 4PM9A 3CJMA 1GHIA 1XXMA 1OMEA 3HUOA 5DF7A 4Y7PA 5U47A 1ES3A 4CPKA 4DE1A 3PBTA 1YMXA 3VSLA 2XEPA 1K25A 1M40A 3MFDA 4FH2A 5E43A 3A3DA 3O86A 4WEKA 5M1AA 3HBRA 3IWOA 1QMEA 1S6RA 3A3EA 2RCXA 3RXXA 3O3VA 5A90A 1BUEA 1IELA 3UPOA 4MEZA 3TOIA 3V3SA 2WZXA 5KZHA 4JF5A 3NBLA 4Y0UA 3MZDA 1RP5A 4GOGA 5CRFA 5FDHA 2Y2KA 2R9XA 1YLYA 2IWDA 4IVIA 2OSUA 2QMIA 4KZ7A 3A3FA 4OOLA 4KZ9A 1DJCA 1XA1A 3PBOA 4DDYA 2XDMA 3FKWA 3EQUA 3IF5A 1HD8A 3GMWA 2EXAA 2PBYA 3WRZA 4X56A 4EBLA 1FCOA 1WYCA 4BQMA 1MBLA 2WAFA 1ZKJA 5CXWA 1FOFA 3PAEA 4WZ5C 5GLAA 1Z6FA 1N4OA 3O88A 4WZ5A 1ZG4A 1PI5A 3ZVTA 3WS2A 4DE0A 5CECA 4OPYA 3HLEA 1KE3A 2V1ZA 1YLWA 4WM9A 2Y2IA 1BLSA 3FKVA 2WUQA 1W7FA 3BECA 4JF6A 5CHUA 4BD0A 3ZG0A 3OCNA 4LV1A 1MY8A 3OPHA 1KDSA 3NIAA 1FCNA 1IYQA 1H8YA 2J8YA 1FR1A 3UPPA 3FZCA 4JBFA 3IXBA 3VP0A 3QHYA 3ISGA 4EWFA 1MWTA 2Y2PA 1BSGA 2ZC7A 1JTDA 3Q7VA 5CHJA 4X69A 5GL9A 4KG6A 3UN7A 4NETA 5CERA 4EQIA 4GDNA 4S2JA 3BYDA 1YMSA 5AQAA 1H5XA 4MNRA 3B3XA 4QU3A 2WKIA 3ZVWA 1XP4A 3SOIA 3I7JA 3C5AA 4M3KA 3VP1A 5TR7A 2ZQCA 3S4XA 2Y4AA 4HBTA 1PWGA 3LY3A 5KSHA 2Y55A 4RX2A 3BLSA 4DE3A 3ZG5A 3VMAA 1H8ZA 2HP6A 3G32A 4UA6A 2Y2LA 3C7VA 1IKGA 4GKUA 2V20A 4OQIA 3SS4A 4BENA 2ZD8A 3IH8A 3MXRA 4DF6A 3OZHA 3MZEA 1RCJA 2EXBA 2WGVA 4WELA 4R3BA 4OPZA 4S2IA 3TSGA 4S2OA 1I2WA 1NJ4A 5F83A 3CZDA 1FQGA 4IVKA 4C3QA 3N6IA 2CC1A 3ZGAB 1XKZA 4KZ5A 3BFEA 1KGGA 1W79A 1K57C 4N9LA 3ITBA 4ZTKA 1K57A 2ZMAA 4OLDA 2Z2MB 5EOOA 1IEMA 1RGYA 5IHVA 3S1YA 2G2UA 1Q2PA 2DCFA 3VFHA 3ZNTA 4P0MA 1IKIA 1L0EA 1PZPA 4N9KA 1LL5A 2FFFB 4QY5A 1BLPA 2ZJ9A 3WRTA 2ZLYA 3FYZA 3JYIA 1NYMA 1ERMA 4WBGA 4ZJ2A 2X71A 2WKEA 4E3OA 2H0TA 3UO9A 4S2KA 2Y2HA 1YLZA 3AGFA 2ZQDA 1FSWA 1FCMA 2E8IA 4N92A 5GLCA 3RJUA 2HDSA 3HLBA 3ZG9B 4LENA 4MLLA 1CI8A 1LL9A 4OH0A 5EVLA 1K56D 5E2GA 3OPPA 5HX9A 4KG5A 1ES2A 5HARA 2FFYA 4B88A 2XR0A 5FQJA 5AQBA 5GHZA 5HAPA 1SDNA 1Q2QA 3S22A 3IXDA 5CGWA 5E2FA 4MBHA 4Y0TA 1NXYA 3AGEA 4JLFA 3IWIA 5EVIC 4Q8IA 3HLWA 4GZBA 3MXSA 2ZQ8A 4QJGA 5TGFA 5JYOA 3BRMA 4FH4A 3W8KA 4U3TA 2Y2OA 4JPMA 1GHPA 5FA7A 1ESIA 3WS4A 3DTMA 1L0GA 2JCHA 3LO7A 1ONHA 4UAAA 1M6KA 2Z2LB 2OLVA 4R23A 4LCMA 4LV0A 2JC7A 3QNCA 4PPRA 4R1GA 1XGJA 1ERQA 4JF4A 4OQHA 4RX3A 2ZC5B 4WMCD 4ZDXA 1MXOA 3VSKA 1PW8A 4OONA 5FSRA 2C6WB 2EX2A 4BJPA 1E25A 1K38A 2P74A 4KZBA 4X68A 5EPHA 5A91A 4U0TA 1BZAA 5FAOA 1K54C 1YLJA 2R9WA 1K54A 3HUNA 3MKFA 1ZC2A 4CJNA 1MWUA 2IWCA 3UPNA 4OQ0A 3SS3A 1KVMA 4NK3A 3DW0A 3GVBA 2BLSA 4OP5A 5JYPA 4E3LA 4X6TA 3NCKA 4LV3A 1TDLA 4E3JA 4XXRA 4QHCA 1K55C 3Q7VB 4BD1A 2ZC6B 3G2YA 2EX6A 1MWSA 2WYXA 1K55A 4DKIA 3N8LA 3W4OA 2P9VB 3SH9A 1IYPA 2IWBA 3PTEA 1W8QA 1SCWA 4UA7A 1ES4A 3HLCA 5KMWA 1BTLA 4OQGA 3Q07A 5A93A 1IYSA 3BEBA 4N1HA 1GHMA 3VOYA 3VP3A 4KQQA 1BLCA 1PIOA 3Q82A 2Y2NA 1CI9A 4WZ4A 4HESA 1K56A 4A5RA 2XLNA 2OV5A 3N8SA 1E3UD 2WADA 2H10A 2H5SA 2PU4A 3N8RA 1HTZA 5DTTA 2BG1A 1W8YA 2Q9NA 3C4PA 4OP8A 5EVID 5HAQA 4DXCA 2XQZA 3O87A 2ZQAA 3BFFA 3D4FA 4JXWA 1JWPA 3UE3A 4EV4A 3LCEA 1PI4A 2A49A 4BLMA 3GQZA 2HDUA 4OKPA 2H0YA 5FQKA 3UY6A 1YM1A 2XF3A 4KQOA 2DRWA 4PM6A 5GHYA 1G6AA 4UA9A 4E6WA 4KZ6A 2EFXA 5CGXA 4K91A 1JWZA 5FATA 4JXVA 1K6SA 1ZG6A 5AQ7A 1TDGA 1PWDA 1LI0A 3G2ZA 4UHUA 2XD5A 5TFQA 3IT9A 3HLFA 4WMCA 1ALQA 4HEFA 2EFUA 3IXHA 4IBXA 4YINA 1WE4A 3Q7ZA 4D2OA 3P09A 3GR2A 4IBRA 1U60A 3LEZA 4PMAA 5E2EA 2UWXA 1CK3A 3OCLA 1O07A 3IXGA 3UE1A 4EBNA 5M19A 5DTSA 3AGDA 4WEJA 5CGSA 3ZG7B 4S2NC 2Q9MA 1PZOA 2ZM0A 2HPBA 4XUZA 4S2NA 3HREA 1I2SA 3G31A 3BFDA 3Q81A 4YFMA 1NZOA 5F1GA 5FASA 2C5WB 1YT4A 3HL9A 3NY4A 4Z9QA 1L0FA 3BM6A 3IF6B 4R4SA 3MBZA 1VM1A 3PBQA 1ONGA 2ZM2A 3V3RA 2X02A 3VP4A 1ESUA 4EBPA 5HL1A 3E2KA 5M18A 5HFOA 5FI6A 3OPLA 1KDWA 3GRJA 4L0LA 4R4RA 4GB7A 3ITAA 4BL3A 2JBFA 4X53A 3BLMA 4OOYA 3NDEA 4B4ZA 1E3UA 2WKHA 3ZCZA 3CMZA 5GHXA 5G18A 4H8RA 5CHMA 4KZ4A 1G68A 4X55A 3SH7A 4C75A 5EVIA 3N4IA 3PBRA 2B5RA 1HVBA 4JXSA 1KGEA 3DWZA 3NI9A 1AXBA 3CG5A 3FV7A 2HDRA 2X01A 4BL2A 4E3IA 3IWQA 2J9PA 5GLBA 3UDXA 4OPRA 4E3KA 1TEMA 3A3JA 1GA9A 2WGWA 3PBNA 2ZQ7A 1JWVA 3P98A 4OVDA 4ZAMA 1BLHA 1XGIA 4MBFA 5FI2A 1BT5A 3GV9A 4GDBA 1K4EA 3HLDA 5L2FA 2Y2GA 4HBUA 4PM5A 4R0QA 4U0XA 1LHYA 2WGIA 5FQQA 1J9MA 3MZFA 4LV2A 5FAQA 4GNUA 2Y2JA 4FSFA 2XH9A 5D3OA 4FD8A 1KGFA 2RL3A 4P6BA 5CTMA 1KE0A 3G34A 1S0WA 4S2LA 1RGZA 3G35A 2WK0A 3HVFA 3HLGA 3Q1FA 4XUXA 3ZFZA 1SHVA 4GN2A 3W4QA 3BFCA 3DWKA 5HAIA 2WAEA 3WWXA 1DJAA 3TG9A 5HW3A 5GLDA 1MWRA 1PW1A 1DY6A 2ZC4B 4E3MA 4F94A 3V5MA 5EECA 3UDIA 3V50A 1GCEA 1CEFA 4E3NA 2ZC3B 2J7VA 3OPRA 4Y0OA 3NC8A 5DTKA 3NDGA 2GDNA 3G30A 5A92A 3C7UA 4KG2A 1N9BA 1EWZA 2QZ6A 3SS5A 4E6XA 2Y59A 3HUMA 1MKIA 2ZQ9A 4OOMA 5FI7A 3IHBA 1DJBA 3M2KA 3VP2A 1NZUA 4JXGA 1LLBA 3PAGA 1YQSA 1HZOA 1XA7A 4ID4A 5CEDA 3UE0A 2XFTA 4DRTA 3PBSA 5DF9A 1EROA 3ZNYA 5BOHA 4KZ8A 3WS5A 3IH9A 3M2JA 4WYYA 3OC2A 3E2LA 5I94A 1KVLA 1VQQA 5EOEA 3A3IA 3WS0A 3WS1A 5CEBA 5J8XA 5FQMA 1NYYA 4DE2A 2P9VA 4R3JA 5E2HA 3SH8A
chains in the Genus database with same CATH superfamily
3VOZA 2EX8A 2KDKA 2MJ6A 1I5QA 5B2ID 4O8GA 3BFGA 1NWZA 3AZIA 4DXBA 4PM8A 4HJ4A 4E04A 1GA0A 1H3OB 4X23A 4KZ3A 4EO5C 3KSFA 1GXDA 2HDQA 4QY6A 5GT0B 3EWKA 4IEDA 3AZHB 4L9GA 1H0GA 5J7EA 3T1XA 4ZJ1A 3D3OA 1T18A 2HUEC 5DNMD 4HNBA 3W99C 2PR5A 3N7WA 2BYMA 5AY8C 5FQ9A 4ZJ3A 1NLYA 3M6BA 4CQHA 2V0UA 3AZGD 2W1RA 3C1BB 1PYYA 4KGCC 4OJ6A 3NQJA 1ES5A 5B2JA 3E0YA 1KX3A 1T1AA 1UR8A 2JE5A 1LI9A 1IOUA 1GSVA 4QB8A 2YKHA 3AZLC 4QWOA 3AV1A 2EWVA 4XUJD 2WGWB 4YOFA 1P34C 3MGQD 1BFMA 5B40B 5B0YA 1KX5C 3MR0A 4EUZA 4GD6A 2CV5A 1E4DA 5F82A 3IF6C 3F1PA 5AVEA 2PU2A 3EQVA 3IS2A 2HIOA 3RXWA 3VOLA 1OMEA 4HIAA 4J8UC 4J8VB 2HJ9C 3AZKB 1ES3A 3X1SB 3TU4A 4DE1A 3PBTA 5E43A 1K25A 3MFDA 3W96C 4WEKA 5M1AA 2W3EA 2QJ5A 3IWOA 1QMEA 3KXBC 3O3VA 1IELA 3WKJD 4IBEA 4YS3B 4Y17A 3V3SA 1HQ3B 3AZJA 5CPKB 2OWJA 3DBAA 2AROC 1LL8A 1YLYA 5BO0A 4IVIA 4Z1WA 1P3IC 5GSUC 3LR4A 4KUDC 3W97D 3EQUA 2J3WA 1HD8A 3GMWA 2EXAA 4ZBJB 3AZEC 3REKA 1KU5A 3MNNC 4BQMA 3MVDB 2PD7A 4EEUA 1N4OA 3HLEA 4MCWA 4WM9A 1BLSA 4CLCE 1W7FA 3F1NA 4BD0A 3ZG0A 4LV1A 3B0CT 1KDSA 4WU9B 1BH9B 1UGUA 1P3BB 5B32A 2FN2A 3IXBA 4JBFA 3QHYA 3ISGA 3REHD 5AV9B 1WWSA 4EWFA 2RVQC 2Z6DA 1E6ZA 5AVBC 5CPJC 1ZLAA 1JTDA 3Q7VA 2LB9A 2HV1A 1N1JA 3MJQA 3L29A 4G91B 4S2JA 2JKFA 3BYDA 5F99C 4OUIA 1H5XA 3AN2C 3REIB 1M19D 3ZVWA 1M1AB 2VGLM 3SOIA 3VP1A 4AWLB 5HPFA 2Y55A 4Z66A 1AWIA 3LGOA 4QLCD 4EETB 4I5SA 3C2WA 2Y2LA 3UT9D 1IFQA 1GPFA 4GKUA 2XA7S 3FKEA 2ZD8A 4DF6A 4H6JA 2JHEA 1RCJA 2FH5A 3W98A 4S2OA 5B1MC 1I2WA 1P3OB 1XKZA 3T4LA 2J80A 3MGPB 4ZTKA 4OLDA 2Z2MB 1SZVA 4Y5FA 4LRXC 5B0ZD 4LG2A 4JGOA 1RGYA 5IHVA 2NZDC 1F98A 4P0MA 2JKTM 1BLPA 1H3QA 5GXQB 3WRTA 2J3TC 5GT0C 3FYZA 1U35A 3AZHC 4E3OA 2H0TA 5L09A 2E8IA 4N92A 3RJUA 4KUOA 4ZUXA 3HLBA 4WUJA 3AYWB 1KX5A 5AVCA 1M18D 3OPPA 3X1TA 4B9OA 1T1BA 4Z2MH 3C1BC 2XR0A 5AQBA 2D02A 4GHLA 4LD9D 5CGWA 4MBHA 4J8UA 1S1YA 4Y0TA 1NXYA 4JLFA 1P3KB 1V9YA 2FZ0A 4YM6B 4Q8IA 5FUGB 3HLWA 3VE3A 3W96A 5TGFA 4R70A 3BRMA 4FH4A 4OJPA 3W8KA 3RELA 2G7UA 1ESIA 3RTYA 3DTMA 1L0GA 2WKPA 4Z5TD 2ZMVA 1XJ6A 5B1LB 4UAAA 1TAFA 5B40C 3AZND 5EM1A 4R1GA 1XGJA 1DP6A 2BYKB 2D49A 4FUWA 2JSSA 4JF4A 4OQHA 4ZDXA 3BQAA 3VSKA 2F8ND 1P9WA 1PW8A 4OONA 4BJPA 4IJFA 2M1CA 1K38A 4P6ZS 3QP5A 5A91A 4J8VC 1K54C 4WZSB 4J8XB 3MNNA 3AZKC 3X1SC 4CJNA 4E45A 4OQ0A 1KVMA 4NK3A 2DQNC 2BLSA 2BTFP 3NCKA 3F1OB 3X1UB 4YS3C 1HQ3C 4LV3A 5CPKC 3R7WB 3AZMB 2YFWA 1K55C 3CPTB 4BD1A 5AV8D 3HJKA 4KHAA 3KWQD 2WYXA 1VHMA 3SH9A 1IYPA 1L3LA 1W8QA 1ES4A 1MKMA 3HLCA 1YAXA 1AOIA 2VZWA 4ZBJC 4OJLA 5CPJA 4PKYG 4WLAA 3VOYA 3MVDC 5J4EA 5CP6A 3N8SA 4H9PA 1E3UD 1YU3A 1HTZA 4ARZA 2BG1A 4X23B 4MB5A 5EVID 2P04A 2XQZA 4WU8A 4H9RA 1JWPA 4EV4A 3UY6A 4WU9C 3KYQA 3EGXC 4PM6A 5DKLA 1P3BC 5GHYA 5AV9C 2BYMB 2EFXA 3IX3A 1JWZA 1ZG6A 3TRCA 1EW0A 3G2ZA 4G91C 4HMEA 4KQDA 3HLFA 3MS6A 4WMCA 3NQJB 3IXHA 4IBXA 4YINA 5B2JB 3REIC 1KX3B 4LGWA 4PMAA 3EPJA 4AWLC 2UWXA 3OCLA 3AV1B 1O07A 4EBNA 2ZM5A 3MGSD 4GLQA 4XZQC 2O9BA 2NZDA 5B0YB 3REHB 2Q9MA 3FG8A 3UTBD 2HPBA 4XUZA 3MQOA 2CV5B 3UB8A 3BFDA 4YFMA 4X1LA 3HL9A 3F1PB 3BM6A 4EEPA 3NQUA 3IS2B 2HIOB 1P97A 3AFAD 1P3OC 1ESUA 4EBPA 5HL1A 3E2KA 4BBTA 5M18A 3TU4B 3C30A 3VE4A 5BNXB 1TS8A 3RH8B 4H9SA 5KIZA 3MGPC 4R4RA 3BLMA 3LR3A 4B4ZA 3AZJB 5G18A 2XRNA 3FPWA 4KZ4A 4C75A 3UT9B 3PBRA 2B5RA 5BO0B 5GXQC 2XSSA 4H9QB 1ODVA 5F5YA 1KGEA 4JGRA 3HONA 3IWQA 3UDXA 1ID3D 4OPRA 2WGWA 3REKB 2VV7A 5FI2A 4MBFA 2O99A 5AJGA 3HLDA 3UB5P 3AYWC 4G3KA 4HBUA 2PRFA 1P3AD 5TBMA 4G3VA 2GX5A 5B2IC 3BW6A 1FIKA 1OT6A 2V8CA 4FD8A 2RL3A 4GHIB 4P6BA 1P3LD 3LJAD 5CTMA 5HWVA 1RGZA 3F1NB 3G35A 3HVFA 3SW1A 1P3KC 1SHVA 3X1SA 4GN2A 4R6LA 3MXQA 4NEED 3BFCA 3DWKA 2WAEA 5B32B 3CWFA 3BY9A 3B0CW 4NYYA 4B93A 5B1LC 3KFUG 1DY6A 1ZLAB 3ULFA 4E3MA 3C1CA 5HD5A 3UDIA 3H7WA 1N1JB 2O9AA 2J7VA 2ZC3B 4J8WD 4OJOA 2WKRA 4NZ4A 5B33D 2GDNA 2V0WA 1EWZA 5AV5D 2QZ6A 4E6XA 2A24A 3LZ0A 4J8XC 2BASA 4FOFA 3VP2A 1LLBA 4Z66B 4R8PD 5HD3A 1H0MA 3KUYA 4KUKA 5CEDA 3UE0A 3AV2A 1PNEA 3X1UC 1UWPX 5BOHA 3AZMC 3IH9A 4H6JB 1P3PD 3L28A 2DMWA 2PR6A 4M4XA 3W98B 3WS0A 5J8XA 3VH5T 4DMZA 3FC7A 3A0SA 3M6HA 1XPBA 3K3CA 5EFWA 3ZDJA 1F66D 5EE8A 2VK3A 1DP9A 1KX4D 2J9OA 5AV6A 5FAPA 4NXBA 3MMHA 4I3AA 1FR6A 4X23C 4QD4A 1P3FA 3NOTC 1NY0A 4K0WA 4JJND 1S32D 3P01A 3QNBA 1U35B 3UDFA 5CTNA 3M7PA 1W63M 3EPKA 5B32G 3GSGA 4XZQA 1QMFA 3WTPE 4ZUXB 3AZFA 4GH9A 5AVCB 1BULA 3BQ8A 4RYEA 3X1TB 3WD0A 4R3AA 1P3GD 2XA7M 3WD2A 4HMCA 2DNSA 3HCYA 1P3OA 1T1CA 5B2JC 3L26A 2PYOD 1KX3C 1FSYA 4HGAB 3REJD 3CITA 2W1TB 5EVIB 3MGPA 2NQBD 3AV1C 3RELB 3WAAD 4Z2KA 1S67L 2HP5A 1XX2A 1TAFB 1CEGA 2XGNA 5B0YC 2XD1A 3REHC 2GZAA 5K5BA 2CV5C 3LZ1A 2QPNA 4LCLA 4P85A 1G5UA 5KSCA 3R4KA 2HIOC 2XK1A 2GJ3A 2NUTC 5HDDA 1ZTUA 3LY4A 3CJMA 1Y4OA 1GHIA 2W8SA 3MNNB 2D01A 3TU4C 5DF7A 4PKYA 4CPKA 1YSQA 3EGDC 2XEPA 4FH2A 3B0BA 3B42A 3O86A 3EPHA 3HBRA 5B2IA 3PHYA 2RCXA 5A90A 1BUEA 1E8BA 3AZJC 2ZL1A 4Q0JA 1OTDA 3TOIA 4JF5A 3NBLA 4KHAB 3EEAA 3LICA 3UT9C 3JPUA 5B31D 2R9XA 2IWDA 2OSUA 2QMIA 2YKFA 3A3FA 1EQZD 1DJCA 1XA1A 1AOIB 4IJEA 3PBOA 4DDYA 3FKWA 3REKC 3IF5A 5CPJB 2QWSA 5DNMA 2PBYA 3WRZA 2IA2A 5CP6B 4H9PB 2WAFA 1XJ4A 3S7NA 5GLAA 3L7HA 4WZ5A 3AZGA 2FJ7D 4WU8B 4OPYA 4Q0HA 2INWA 1KE3A 1OPXA 4H9RB 2Y2IA 4K08A 3FKVA 1OJGA 5CHUA 2QKPA 2ZY3A 3BJNA 4F3LA 2W3FA 5B32C 1FCNA 1IYQA 3B6GD 1FR1A 2PYRA 3VP0A 4XUJA 1ZLAC 1MWTA 4DJ2A 2Y2PA 2ZC7A 4IBKA 3MGQA 3ZQ5A 3CPTA 5CHJA 4NETA 5CERA 3A6ND 5G49A 5B24D 2EA9A 4QU3A 3EG5B 1P3LB 3LJAB 3I7JA 4Z66C 4ETZA 3LY3A 5KSHA 4RX2A 2NZDB 3DAVA 5DNND 4UA6A 3C7VA 3WKJA 1LT0A 3WX7A 3IH8A 3MXRA 3OZHA 2VX8A 3NQUB 3W98C 3MZEA 4R3BA 1UR9A 3LR0A 4OPZA 2PHYA 3TSGA 5B33B 2YFVB 1NJ4A 5F83A 3LIFA 1DRMA 3W97A 3N6IA 2IOUA 4UQIS 3BFEA 1YKDA 1K57A 1YU2A 1Q2PA 1IKIA 1PZPA 2JN7A 1LL5A 5FEFA 1U35C 5L10A 1ERMA 1G6OA 2X71A 4S2KA 4HJ3A 2Y2HA 4ZUXC 1FCMA 3KX0X 3ZG9B 3REHA 5LBRA 5AVCC 5TBMB 4OH0A 5EVLA 3X1TC 5HX9A 1ES2A 2H28A 2B02A 1CK7A 1TZYB 4NZ1A 4L9EA 5G4ZA 5HAPA 1SDNA 1Q2QA 4HMDA 4HGAC 3QP1A 1M19A 5EVIC 5BNXA 4JJNB 2ZQ8A 3RELC 2A2LA 3WS4A 2AVXA 5FA7A 1GHPA 1NRJA 2JCHA 4QLCA 3C1CB 1M6KA 3H7WB 4LRZE 2OLVA 1W1YA 4LCMA 2JC7A 3UT9A 3VH6A 2L4RA 4H9QA 4CAYA 1ERQA 4RX3A 4Y15A 1P3GB 2A24B 4KZBA 3LZ0B 4ESPA 1OTBA 4RQ9A 1F1EA 4LFUA 4WV4B 3REJB 2R9WA 3MKFA 3IBJA 1D06A 1S66L 4E44A 3KUYB 1MWUA 2IWCA 3OOVA 4H9OA 3DW0A 4L9FA 3AV2B 4OP5A 5B0ZA 4X6TA 4GHIA 2OWHA 1YUEA 1TDLA 1OTIA 4MN5A 4QHCA 1O6IA 3EEHA 3N8LA 3QP6A 4IJGA 2V9AA 1AOIC 1BTLA 2L0WA 3QP4A 3BEBA 5DJUA 1GHMA 5CP6C 1BLCA 4WZ4A 1CI9A 3U2AA 4HESA 5AV6B 4A5RA 2WADA 1M18A 3N8RA 1P3FB 5DTTA 1W8YA 3C4PA 4WU8C 4OP8A 5HAQA 4LD9A 3O87A 3BFFA 3D4FA 4JXWA 3O62D 1PI4A 4XZQB 1H8MA 4BLMA 2HDUA 5FQKA 2XF3A 3QP8A 5F69A 3AZFB 3VH6W 5FATA 4Z5TA 2Q0OA 1K6SA 5F6AA 3AZNA 1PWDA 3V67A 4XT2B 3WA9D 2ZY5A 3IT9A 4IBDA 1S1ZA 1MC0A 3HSHA 2F8NA 3S7PA 1WE4A 4NE5A 4NE3A 1P3LC 3LJAC 2FJ7B 3X1VD 3H0RC 4JGQA 3IXGA 4WEJA 2VKSA 2CWEA 4GS9A 2ZM0A 1PZOA 3T1RA 3LZ1B 4S2NA 2JKRM 1P3MD 3Q81A 5F1GA 1NZOA 4BWIA 2C5WB 1YT4A 5AV8A 3KWQA 4J8WC 3A0RA 5B33C 3GDIA 5CPID 3T4JA 5JRGD 4H9SC 3OPLA 3GRJA 5B2IB 4X53A 4HY8A 4EQ1A 4OOYA 2ZL1B 1E3UA 5GT3D 1A0KA 3CMZA 5GHXA 2K2NA 2Y79A 4H8RA 2W1TA 5EVIA 5BT1D 1AXBA 3FV7A 4ZRRA 3PYPA 4G3WA 4E3KA 1TEMA 5DNMB 2V1BA 2ZQ7A 3P98A 1XGIA 1BT5A 3GV9A 4GDBA 5L2FA 1KOUA 2W3DA 4PM5A 4R0QA 4U0XA 1LHYA 3WD4A 4FTXA 3LELD 5FQQA 1J9MA 3AZGB 4LV2A 1TZYC 3T50A 2PDRA 2P08A 2ACGA 3G34A 1UWNX 4ME4A 1S0WA 4XUXA 4F3LB 4JJNC 5HAIA 3WWXA 3P5JB 3DTKA 4XUJB 3MGSA 2IO5B 3C1CC 3ZYTA 3W99D 1MWRA 1PW1A 3MGQB 5C3IB 5TJJA 4GHAA 3V5MA 3V50A 5AY8D 1CEFA 1GCEA 1TS0A 3GECA 3UTBA 2PBDP 4Y0OA 4AFIA 3KS4A 5G49B 3NC8A 3NDGA 1P3GC 5A92A 1MZUA 5I5LA 3LZ0C 4KGCD 1N9BA 3HUMA 1MKIA 3AFAA 3CUEA 5DJTA 2PYOC 3REJC 3LUQA 4EXOA 3B0DB 3PAGA 5EV0A 3KUYC 3AZLD 2NQBC 1XA7A 3NULA 3AV2C 3ICYA 3WKJB 3UTAD 1P34D 1EROA 3T1QB 4WYYA 3E2LA 1ED7A 5I94A 2F2AC 2P9VA 3W97B 4R3JA 5E2HA 1ID3A 2I72A 2A3UA 3KSHA 1PWCA 3IHAA 5AV6C 4C6YA 2WZZA 5DF8A 1P3AA 1TVFA 1O7EA 3UNWA 3KXBD 1P3FC 1MPLA 1F2KA 5F1FA 3W4PA 1XFNA 1JTGA 1P3LA 3LJAA 3NHQA 3PR6A 2AROD 4JKTA 3B6FD 2P7JA 1EI5A 4NXEA 2PYPA 2W3HA 1P3ID 2LY8A 3AZFC 5GSUD 4KUDD 1N9LA 3AZED 5F68A 4IBCA 1JVJA 4BBVA 5EUAA 4MMNA 3ZHHA 4QPRA 4J8WA 4O7DA 4IBJA 5B33A 2YFVA 4UUZA 1M19B 4PHTA 2FJ7C 5AV5A 1L0DA 5MC7A 5BNVA 2VGJA 1GSWA 1IYOA 4QLCB 4R8PA 3WTPD 3GTCA 5CHLB 3U4LP 3V39A 1C3BA 3MKEA 2RVQD 5AVBD 3LZ1C 4CAYB 1L2SA 3FWLA 1P3PA 4MBKA 5F99D 4P87A 5CX7A 3P7NA 3KS8A 2K7SA 5FQIA 2ZM8A 3AN2D 1XXMA 5U47A 4H9OB 1F66A 3A3DA 5B0ZB 1TZYA 3PXPA 4EUVA 1KX4A 3A3EA 3RXXA 4MEZA 1WA9A 2WZXA 5KZHA 4Y0UA 2VV8A 5EVEA 4Y2FA 2Y2KA 4JJNA 1S32A 3LIEA 4OOLA 1BYWA 2ZBBA 5B1MD 4Y13A 5DNMC 1F5MA 4EBLA 5HZHA 1ZKJA 1M18B 3PAEA 4WZ5C 4HP4A 3AZGC 3H9WA 1P3GA 3K3DA 4MN6A 4NXFA 3CAXA 1ZG4A 3ZVTA 3WS2A 4LD9B 3H82B 4DE0A 4EU0A 3IBRA 2PYOA 3REJA 4JF6A 3UMDA 3MQ0A 2J3TD 5GT0D 3OCNA 3AZHD 1MY8A 3OPHA 2NQBA 4Z2HA 1E6RA 1H8YA 3WAAA 4XUJC 3FZCA 2IO5C 3R45B 4Z5TB 3MGQC 5C3IC 2VGLS 1T19A 3AZNB 4OJ5A 3KSGA 4DRBA 2PT7A 3L9KA 3MGRD 4NZ3A 1BH8A 4EQIA 4GDNA 2F8NB 1YMSA 3LELB 3C1BD 5AQAA 3T4QA 2CMNA 2WKIA 5HDSA 1XP4A 5J3WA 3C5AA 4M3KA 4NFTA 3B0DC 2Y4AA 1PWGA 3S7QA 1JFIA 4Z2JA 2B95A 3BLSA 3MSHA 3ZG5A 4DE3A 1H8ZA 4GS9B 3WKJC 2HP6A 4PAUA 4EESA 5B40D 1IKGA 3CHWP 3SS4A 4WL9A 4BENA 5AV8B 3KWQB 3T4OA 5B31A 2OOLA 2EXBA 4TX8A 2JKTI 3MQQA 4S2IA 3W97C 1EQZA 5DKKA 3CZDA 1FQGA 2I9VA 4J8VD 1KGGA 3AZKD 1K57C 1QO6A 4N9LA 5C5KA 2ZMAA 4XT2A 5EOOA 4GJ4A 1IEMA 4I38A 2B18A 3S1YA 2DCFA 2HGVA 4YS3D 1L0EA 1HQ3D 4N9KA 5CPKD 2FJ7A 4O0PA 2UV0E 3UTAB 2ZJ9A 3JYIA 3T1SA 4ZJ2A 1YLZA 3AGFA 3B6GA 1FSWA 2Z6CA 3KYEA 1OTEA 4MLLA 1CI8A 1LL9A 1K56D 3MVDD 1Q9CA 2FFYA 4B88A 2F8NG 3A6NA 2VEAA 3KSYA 1X0OA 5B24A 3A1IA 5E2FA 1M19C 3TJZC 1ULYA 5A8BA 3MXSA 3MGSB 3SZTA 4WU9D 4QLCC 3B6FB 4JPMA 1P3BD 1ONHA 5DNNA 5AV9D 2Z2LB 1VEUA 3UTBB 3QNCA 4PPRA 3E98A 5KDMA 2ZC5B 3UB7A 2C6WB 1E25A 2HF6A 3IX4A 3AFAB 4X68A 3A0VA 3REID 1BZAA 1M1AD 5FAOA 3HUNA 5HWTA 2O9CA 3UPNA 3SS3A 5B0ZC 3B33A 3W2ZA 3GVBA 3MF0A 5FL3A 4P6ZM 4R38A 4E3JA 4XXRA 1MWSA 1PZRA 4DKIA 1PFLA 2P9VB 1ID3B 3PTEA 3LEQA 1SCWA 4UA7A 1P3OD 5G4YA 3Q07A 1YU1A 4I3IA 1IYSA 4N1HA 3VP3A 2XROA 3N3FA 1PIOA 1P3AB 1M18C 1S4RA 3L27A 2H5SA 2PU4A 1W1VA 1J3WA 4GW9A 4LD9C 1TD5A 4CLCD 2Q9NA 5GT3C 5E5AD 4DXCA 2KLIA 3V9RA 3O5YA 5GXQD 3LCEA 3GQZA 2H0YA 1A7WA 4UA9A 4Z5TC 1ZHHB 5CGXA 4K91A 3AZNC 5AQ7A 3AYWD 4J8WB 4UHUA 2L5AA 4UUZB 3TW8A 5TFQA 2JKGA 3LELC 2W0NA 2F8NK 1ALQA 4HEFA 4IUHA 3MFXA 5AV5B 2R78A 5BNVB 3P09A 1P3KD 4YM6D 4JGPA 4R8PB 3KSIA 4HHDA 3UE1A 5CGSA 3ZG7B 1N9OA 5B1LD 4DQYB 3LI8A 3B47A 4S2NC 1P3PB 5AV8C 1E88A 3G31A 3KWQC 4BBUA 3UE6A 1L0FA 4R4SA 3MGRB 3LIDA 4I39A 4IBGA 3V3RA 2X02A 3E4PA 4J8XD 3VH5A 5DFXA 1F66B 1H8PA 3IX8A 4L0LA 4GB7A 4BL3A 1KX4B 1W2EA 3NDEA 3ZCZA 3X1UD 3UTAC 3AZMD 3N4IA 1S32B 1LSVA 1E6PA 3DWZA 3CG5A 3O62A 2X01A 4BL2A 1W63Q 2J9PA 5GLBA 3A3JA 1GA9A 3PBNA 1LSXA 4OVDA 1JWVA 2V1AA 1OGBA 2ZOHA 3EOIA 2V8FA 3MZFA 5FAQA 3AZID 4GNUA 4FSFA 3T4TA 3WA9A 3MQLA 2L1MA 3LFVA 1KGFA 4DN0A 4X23D 2PYOB 4S2LA 3ZFZA 3HLGA 4NXGA 4O01A 1HLUP 3X1VA 2NQBB 5L8MA 3VV4A 3WAAB 3MGSC 2DF4C 1DJAA 3DTIA 3B6FC 1J7MA 2G5IC 2ZC4B 4MB4A 5EECA 4GCZA 3UTBC 4E3NA 1N9NA 1BH8B 3H0LC 1P3MA 3HJIA 5DTKA 4DJ3A 3VH5W 3G30A 4KG2A 4MN7A 4IUKA 3AFAC 3CUEC 5B2JD 2Y59A 1KX3D 4OOMA 3IHBA 1DJBA 5CPIA 1VETA 5JRGA 1JFIB 4MB3A 4NYUA 4X25A 3AV1D 4IBBA 3UB9A 1HZOA 2E8JA 3PBSA 5DF9A 3WTPC 3H82A 5B0YD 5GT3A 3ZNYA 4KZ8A 1TS7A 4EW7A 5B31B 2CV5D 2QJ7A 5EOEA 3WS1A 1EQZB 3OLOA 2HIOD 5FQMA 4BMWA 1ID3C 4DE2A 5JA4A 5HWWA 3R45A 1H0IA 4UPKA 4RA7A 4PM7A 3TU4D 5AVFA 4I3JA 1YPRA 1P3AC 2VGKA 4KENB 4MDZA 4K0XA 2M7UA 4EERA 4HOIA 3NOUC 1K4FA 2Y2MA 4H9NA 1YLPA 2W3GA 3JVVA 3LELA 4HP9A 4GD8A 2KX6A 3AZJD 1KE4A 2Y8HA 4DDSA 1OT9A 3K2NA 1GOIA 4B4XA 3C4OA 2Y2QA 3B6GB 4RVAA 1STZA 2Y91A 2VJWA 3REKD 4HH2A 4S2PA 3W99A 3IQAA 2EWWA 5AY8A 1YLTA 4OPQA 2HP9A 3ZG8B 3A6NB 1VB6A 1SKOB 5B24B 5AV5C 1NRFA 4KZAA 4KGCA 3VFFA 4CLCB 2G2WA 2EX9A 5E5AB 1CQAA 4S2MA 1SKFA 4M6BA 3EPLA 4R8PC 5B32D 1AIWA 5AQ9A 5DNNB 2XFSA 3AZLA 1WYBA 1VEUB 1ZLAD 5BS7C 4LLOB 3UTAA 1SDEA 1P34A 5B31G 3OBFA 1FILA 1P3PC 2OLUA 1Y54A 5KDMB 5DVAA 1D1JA 4FCFA 2V2FF 4ZBEA 1S4SA 3MGRC 4N1XA 1K6RA 3IF6A 3G4PA 4KQRA 1W5DA 4OLGA 4PM9A 1LSWA 3HUOA 4Y7PA 4Z2MG 1F66C 1YU4A 3L2AA 1YMXA 4Z66D 1EAKA 3VSLA 1M40A 1KX4C 1D7EA 1S6RA 3UPOA 2LB5A 3KXBA 5L07A 2ZOIA 3MZDA 2OAP1 1RP5A 1S32C 4UEYA 4GOGA 5CRFA 5FDHA 3W98D 4KZ7A 2AROA 3CI6A 4KZ9A 3B6FA 3FDDA 1YU0A 1T3UA 1P3IA 5GSUA 2XDMA 4KUDA 3CLOA 4X56A 3C8CA 1FCOA 1WYCA 4HJ6A 3AZEA 2VLGA 1K0KA 1MBLA 1HTAA 4WNNA 5CXWA 2QYBA 4Z2IA 1FOFA 1Z6FA 3O88A 3IP4C 1PI5A 5CECA 3V9RB 2RTSA 1YLWA 2V1ZA 1U35D 2WUQA 3BECA 1KS0A 4NY2A 3WAAC 3NIAA 2J8YA 3UPPA 1PRQA 4ZUXD 3WTPA 1KX5D 1BSGA 5AVCD 4CSRA 4X69A 5GL9A 3X1TD 5AVBA 4KG6A 3UN7A 4QNLA 3AZIB 4J8UD 4MNRA 1CJFA 5F99A 3B3XA 3AN2A 5TR7A 3W96D 2ZQCA 3S4XA 3BWLA 4HBTA 4IHQA 3RELD 3VMAA 3G32A 5EM0A 2G5HC 2VQRA 1YSPA 2V20A 4OQIA 5B31C 3L25A 4G92B 3QP2A 5FEGA 5HPIA 2WGVA 4WELA 3UMEA 1EQZC 1OJ5A 3H0MC 1NLZA 4IVKA 4C3QA 5B1MA 2CC1A 3D9YA 3ZGAB 3MNND 4KZ5A 1W79A 1M1AC 3ITBA 2K31A 2G2UA 2KOIA 3VFHA 4Y3IA 3ZNTA 4HH3A 2O0YA 2FFFB 4UQIM 4QY5A 1H3OA 1R4VA 3O62B 2ZLYA 1NYMA 4WBGA 2WKEA 5GT0A 2ZY2A 3B6GC 3UO9A 3AZHA 1AOID 2ZQDA 5GLCA 5CPJD 5BS7A 2HDSA 5HL6A 4LENA 4NE6A 5CP6D 1GSXA 5E2GA 2J8PA 3A6NC 4KG5A 5HARA 2QHKA 3WA9B 3MGRA 5B24C 4NKPA 5FQJA 5GHZA 3S22A 3C1BA 3IXDA 3LIAA 4WU8D 4CLCC 3AGEA 3X1VB 3E4OA 5E5AC 3IWIA 4NG2A 3F6TA 4GZBA 4QJGA 5JYOA 2V5OA 4U3TA 2Y2OA 5DNNC 3T4KA 3LO7A 1TF1A 1CXWA 4R23A 4LV0A 5B40A 1P3MB 4X1MA 1G28A 4WMCD 1MXOA 1PDCA 3AL0C 5FSRA 2EX2A 2P74A 5EPHA 5CPIB 4WF0A 4U0TA 1VETB 5JRGB 1V9ZA 1YLJA 4J8VA 1K54A 1ZC2A 3AZKA 1E15A 4YM6C 4LPZA 2NZDD 5JYPA 3D72A 4E3LA 3A1KA 5GT3B 4Z2LA 2ZY4A 1TS6A 4HQAA 4YS3A 3Q7VB 1HQ3A 3NJAA 5CPKA 2ZC6B 3G2YA 2EX6A 4IBFA 1K55A 3W4OA 5JA4B 5BPVA 3TE8A 2IWBA 2VA0A 5IU1A 5KMWA 4OQGA 5FDSA 2WKQA 5A93A 3NOPC 1L6JA 4KQQA 4DRAA 3NECA 4WJ3C 3Q82A 2Y2NA 4H9NB 3MVDA 1K56A 2XLNA 2OV5A 3WD3A 2H10A 3LIBA 2ZQAA 4EO5B 4HI4A 3UE3A 1XJ2A 4YNRA 2A49A 4OKPA 1YM1A 4KQOA 2DRWA 1G6AA 2HUEB 4WU9A 4E6WA 1BH9A 1Z2CB 3W99B 1P3BA 4KZ6A 5AV9A 3FPVA 4JXVA 5AY8B 5IS1A 2GNXA 1TDGA 1LI0A 2XD5A 1W1TA 1TZYD 2JKRI 1P0ZA 3AZIC 2EFUA 3KO6A 4KGCB 3E4QA 3Q7ZA 5IT5A 4D2OA 3X1SD 3REIA 3GR2A 1U60A 3LEZA 3LR5A 4IBRA 5E2EA 1M1AA 1CK3A 2ZMFA 5M19A 3AZLB 3VH6T 5DTSA 3AGDA 2OAQ1 4YWZA 3C1CD 1P34B 4G92C 3HREA 1KX5B 1I2SA 2VV6A 1E6NA 3C38A 5FASA 1OTAA 3NY4A 2PD8A 4Z9QA 4LRYC 3IF6B 4NZ5A 3MBZA 3LZ0D 1VM1A 3PBQA 1ONGA 2ZM2A 1Z09A 3VP4A 3S7OA 4J8UB 5HFOA 5FI6A 1XJ3A 1WWIA 2F8NH 1JNUA 1KDWA 5HSQA 2PAVP 2W27A 3KUYD 3W96B 3ITAA 2JBFA 1SKOA 3AV2D 2WKHA 3KXBB 5CHMA 3T12B 1G68A 4CLCA 4X55A 3SH7A 5E5AA 2AROB 3O62C 1HVBA 4JXSA 5GXQA 3NI9A 4E3IA 2HDRA 1P3IB 5GSUB 4KUDB 3WD1A 4ZAMA 1BLHA 1F9IA 1W1PA 3AZEB 1B67A 1K4EA 2Y2GA 4WNNB 4WN5A 5AV6D 3AYWA 2WGIA 3WA9C 1ACFA 4D60A 2Y2JA 2XH9A 5D3OA 1P3FD 1KE0A 3Q1FA 2WK0A 3DTEA 4II7A 2YFWB 3X1VC 3W4QA 1OGGA 1P3KA 4XZQD 4YM6A 3RFBA 5FUGA 3JVUA 3TG9A 3AZFD 3WTPB 3T4SA 5HW3A 1P9RA 5GLDA 2NUPC 4CSRB 4IBIA 4F94A 5B1LA 5AVBB 1B6WA 3OPRA 1P3MC 1CF0A 4Q0IA 3BY8A 3LYXA 3G6OA 2BYKA 2RIQA 5F99B 2HZ5A 3C7UA 2HJEA 3LI9A 4ARZB 3SS5A 3AN2B 5CPIC 1DP8A 5FI7A 2ZQ9A 5JRGC 2M7VA 3M2KA 3MGPD 1NZUA 4JXGA 4J8XA 1YQSA 4ETXA 4ID4A 3KYZA 2XFTA 5DFYA 4DRTA 5HDCA 3F1OA 3X1UA 3WS5A 3LZ1D 3M2JA 1XFQA 3R7WA 3OC2A 3AZMA 1Y28A 1KVLA 1VQQA 3UB6A 3A3IA 5CEBA 5BT1C 1NYYA 5B1MB 4Z2GA 3SH8A
chains in the Genus database with same CATH topology
3VOZA 2EX8A 1I5QA 5B2ID 3BFGA 3AZIA 4DXBA 4PM8A 1GA0A 1H3OB 4X23A 4KZ3A 4EO5C 2HDQA 4QY6A 5GT0B 4IEDA 3AZHB 4ZJ1A 2HUEC 5DNMD 3W99C 3N7WA 2BYMA 5AY8C 5FQ9A 4ZJ3A 3M6BA 3AZGD 3C1BB 1PYYA 4KGCC 4OJ6A 3NQJA 1ES5A 5B2JA 1KX3A 2JE5A 1LI9A 4QB8A 3AZLC 3AV1A 4XUJD 2WGWB 1P34C 3MGQD 1BFMA 5B40B 5B0YA 1KX5C 4EUZA 4GD6A 2CV5A 1E4DA 5F82A 3IF6C 2PU2A 3EQVA 2HIOA 3RXWA 1OMEA 4J8UC 4J8VB 3AZKB 1ES3A 3X1SB 3TU4A 4DE1A 3PBTA 5E43A 1K25A 3MFDA 3W96C 4WEKA 5M1AA 3IWOA 1QMEA 3KXBC 3O3VA 1IELA 3WKJD 4IBEA 4YS3B 3V3SA 1HQ3B 3AZJA 5CPKB 2AROC 1YLYA 5BO0A 4IVIA 1P3IC 5GSUC 4KUDC 3W97D 3EQUA 1HD8A 3GMWA 2EXAA 4ZBJB 3AZEC 3REKA 1KU5A 3MNNC 4BQMA 3MVDB 1N4OA 3HLEA 4WM9A 1BLSA 1W7FA 4BD0A 3ZG0A 4LV1A 3B0CT 1KDSA 4WU9B 1BH9B 1P3BB 5B32A 4JBFA 3IXBA 3QHYA 3ISGA 3REHD 5AV9B 1WWSA 4EWFA 2RVQC 5AVBC 5CPJC 1ZLAA 1JTDA 3Q7VA 1N1JA 3L29A 4G91B 4S2JA 3BYDA 5F99C 4OUIA 1H5XA 3AN2C 3REIB 1M19D 3ZVWA 1M1AB 3SOIA 3VP1A 4AWLB 2Y55A 4Z66A 4QLCD 2Y2LA 3UT9D 4GKUA 3FKEA 2ZD8A 4DF6A 1RCJA 3W98A 4S2OA 5B1MC 1I2WA 1P3OB 1XKZA 3MGPB 4ZTKA 4OLDA 2Z2MB 5B0ZD 4LG2A 1RGYA 5IHVA 2NZDC 4P0MA 1BLPA 5GXQB 3WRTA 5GT0C 3FYZA 1U35A 3AZHC 4E3OA 2H0TA 2E8IA 4N92A 3RJUA 4ZUXA 3HLBA 3AYWB 1KX5A 5AVCA 1M18D 3OPPA 3X1TA 2XR0A 4Z2MH 3C1BC 5AQBA 4GHLA 4LD9D 5CGWA 4MBHA 4J8UA 4Y0TA 1NXYA 4JLFA 1P3KB 4Q8IA 4YM6B 5FUGB 3HLWA 3W96A 5TGFA 3BRMA 4FH4A 4OJPA 3W8KA 3RELA 1ESIA 3DTMA 1L0GA 4Z5TD 4UAAA 5B1LB 1TAFA 5B40C 3AZND 4R1GA 1XGJA 2BYKB 2JSSA 4JF4A 4OQHA 4ZDXA 3VSKA 2F8ND 1PW8A 4OONA 4BJPA 4IJFA 1K38A 5A91A 4J8VC 1K54C 4WZSB 4J8XB 3MNNA 3AZKC 3X1SC 4CJNA 4E45A 4OQ0A 1KVMA 4NK3A 2DQNC 2BLSA 3NCKA 3X1UB 4YS3C 1HQ3C 4LV3A 5CPKC 3AZMB 2YFWA 1K55C 4BD1A 5AV8D 4KHAA 3KWQD 2WYXA 3SH9A 1IYPA 1W8QA 1ES4A 3HLCA 1AOIA 4ZBJC 4OJLA 5CPJA 3VOYA 3MVDC 5CP6A 3N8SA 4H9PA 1E3UD 1YU3A 1HTZA 2BG1A 4X23B 5EVID 2XQZA 4WU8A 4H9RA 1JWPA 4EV4A 3UY6A 4WU9C 4PM6A 5GHYA 1P3BC 5AV9C 2BYMB 2EFXA 1JWZA 1ZG6A 3G2ZA 4G91C 3HLFA 4WMCA 3NQJB 3IXHA 4IBXA 4YINA 5B2JB 3REIC 1KX3B 4PMAA 3EPJA 4AWLC 2UWXA 3OCLA 3AV1B 1O07A 4EBNA 2ZM5A 3MGSD 4XZQC 2NZDA 5B0YB 3REHB 2Q9MA 3UTBD 2HPBA 4XUZA 2CV5B 3BFDA 4YFMA 3HL9A 3BM6A 3NQUA 2HIOB 3AFAD 1P3OC 1ESUA 4EBPA 5HL1A 3E2KA 5M18A 3TU4B 5BNXB 4H9SA 3MGPC 4R4RA 3BLMA 4B4ZA 3AZJB 5G18A 4KZ4A 4C75A 3UT9B 3PBRA 2B5RA 5BO0B 5GXQC 4H9QB 1KGEA 3HONA 3IWQA 3UDXA 1ID3D 4OPRA 2WGWA 3REKB 5FI2A 4MBFA 3HLDA 3AYWC 4HBUA 1P3AD 5B2IC 4FD8A 2RL3A 4P6BA 1P3LD 3LJAD 5CTMA 1RGZA 3G35A 3HVFA 1P3KC 1SHVA 3X1SA 4GN2A 3BFCA 3DWKA 2WAEA 5B32B 3B0CW 4NYYA 5B1LC 3KFUG 1DY6A 1ZLAB 4E3MA 3C1CA 3UDIA 1N1JB 2ZC3B 2J7VA 4J8WD 4OJOA 4NZ4A 5B33D 2GDNA 1EWZA 5AV5D 2QZ6A 4E6XA 3LZ0A 4J8XC 3VP2A 1LLBA 4Z66B 4R8PD 3KUYA 5CEDA 3UE0A 3AV2A 3X1UC 5BOHA 3AZMC 3IH9A 1P3PD 3L28A 3W98B 3WS0A 5J8XA 3VH5T 3M6HA 1XPBA 3ZDJA 1F66D 5EE8A 1KX4D 2J9OA 5AV6A 5FAPA 1FR6A 4X23C 4QD4A 1P3FA 1NY0A 4K0WA 4JJND 1S32D 3QNBA 3UDFA 1U35B 5CTNA 3EPKA 5B32G 3GSGA 4XZQA 1QMFA 3WTPE 4ZUXB 3AZFA 4GH9A 5AVCB 1BULA 4RYEA 3X1TB 1P3GD 2DNSA 1P3OA 5B2JC 3L26A 2PYOD 1KX3C 1FSYA 4HGAB 3REJD 5EVIB 3MGPA 2NQBD 3AV1C 3RELB 3WAAD 2HP5A 1XX2A 1TAFB 1CEGA 2XGNA 5B0YC 2XD1A 3REHC 2CV5C 3LZ1A 2QPNA 4LCLA 4P85A 5KSCA 2HIOC 2XK1A 3LY4A 3CJMA 1GHIA 2W8SA 3MNNB 5DF7A 3TU4C 4CPKA 2XEPA 4FH2A 3B0BA 3O86A 3EPHA 3HBRA 5B2IA 2RCXA 5A90A 1BUEA 3AZJC 3TOIA 4JF5A 3NBLA 4KHAB 3UT9C 5B31D 2R9XA 2IWDA 2OSUA 2QMIA 3A3FA 1EQZD 1DJCA 1XA1A 1AOIB 4IJEA 3PBOA 4DDYA 3FKWA 3REKC 3IF5A 5CPJB 5DNMA 2PBYA 3WRZA 5CP6B 4H9PB 2WAFA 5GLAA 4WZ5A 3AZGA 2FJ7D 4WU8B 4OPYA 1KE3A 4H9RB 2Y2IA 3FKVA 5CHUA 2ZY3A 5B32C 1FCNA 1IYQA 3B6GD 1FR1A 3VP0A 4XUJA 1ZLAC 1MWTA 2Y2PA 2ZC7A 4IBKA 3MGQA 5CHJA 4NETA 5CERA 3A6ND 5G49A 5B24D 4QU3A 3EG5B 1P3LB 3LJAB 3I7JA 4Z66C 5KSHA 3LY3A 4RX2A 2NZDB 5DNND 4UA6A 3C7VA 3WKJA 3WX7A 3IH8A 3MXRA 3OZHA 3NQUB 3W98C 3MZEA 4R3BA 4OPZA 3TSGA 5B33B 2YFVB 1NJ4A 5F83A 3N6IA 3W97A 2IOUA 3BFEA 1K57A 1YU2A 1Q2PA 1IKIA 1PZPA 1LL5A 1U35C 1ERMA 2X71A 4S2KA 2Y2HA 4ZUXC 1FCMA 3ZG9B 3REHA 5AVCC 4OH0A 5EVLA 3X1TC 5HX9A 1ES2A 1TZYB 4NZ1A 5HAPA 1SDNA 1Q2QA 4HGAC 1M19A 5EVIC 5BNXA 4JJNB 2ZQ8A 3RELC 3WS4A 5FA7A 1GHPA 2JCHA 4QLCA 3C1CB 1M6KA 2OLVA 4LCMA 2JC7A 3UT9A 3VH6A 4H9QA 4CAYA 1ERQA 4RX3A 1P3GB 4KZBA 3LZ0B 1F1EA 4WV4B 3REJB 2R9WA 3MKFA 4E44A 3KUYB 1MWUA 2IWCA 4H9OA 3DW0A 3AV2B 4OP5A 5B0ZA 4X6TA 1YUEA 1TDLA 4QHCA 3N8LA 1AOIC 1BTLA 3BEBA 1GHMA 5CP6C 1BLCA 4WZ4A 1CI9A 4HESA 5AV6B 4A5RA 2WADA 1M18A 3N8RA 1P3FB 5DTTA 1W8YA 3C4PA 4WU8C 4OP8A 5HAQA 4LD9A 3O87A 3BFFA 3D4FA 4JXWA 3O62D 1PI4A 4XZQB 4BLMA 2HDUA 5FQKA 2XF3A 3AZFB 3VH6W 5FATA 4Z5TA 1K6SA 3AZNA 1PWDA 3WA9D 2ZY5A 3IT9A 4IBDA 3HSHA 2F8NA 1WE4A 4NE5A 4NE3A 1P3LC 3LJAC 2FJ7B 3X1VD 3H0RC 3IXGA 4WEJA 2CWEA 2ZM0A 1PZOA 3LZ1B 4S2NA 1P3MD 3Q81A 5F1GA 1NZOA 2C5WB 1YT4A 5AV8A 3KWQA 4J8WC 5B33C 5CPID 5JRGD 4H9SC 3OPLA 3GRJA 5B2IB 4X53A 4OOYA 1E3UA 5GT3D 3CMZA 5GHXA 4H8RA 5EVIA 5BT1D 1AXBA 3FV7A 4E3KA 1TEMA 5DNMB 2ZQ7A 3P98A 1XGIA 1BT5A 3GV9A 4GDBA 5L2FA 4PM5A 4R0QA 4U0XA 1LHYA 3LELD 5FQQA 1J9MA 3AZGB 4LV2A 1TZYC 3G34A 1S0WA 4XUXA 4JJNC 5HAIA 3WWXA 3P5JB 4XUJB 3MGSA 2IO5B 3C1CC 3W99D 1MWRA 1PW1A 3MGQB 5C3IB 4GHAA 3V5MA 3V50A 5AY8D 1CEFA 1GCEA 3UTBA 4Y0OA 3KS4A 5G49B 3NC8A 3NDGA 1P3GC 5A92A 3LZ0C 4KGCD 1N9BA 3HUMA 1MKIA 3AFAA 2PYOC 3REJC 3B0DB 3PAGA 3KUYC 3AZLD 2NQBC 1XA7A 3AV2C 3WKJB 3UTAD 1P34D 1EROA 4WYYA 3E2LA 5I94A 2F2AC 2P9VA 3W97B 4R3JA 5E2HA 1ID3A 2I72A 2A3UA 1PWCA 3IHAA 5AV6C 4C6YA 2WZZA 5DF8A 1P3AA 1TVFA 1O7EA 3UNWA 3KXBD 1P3FC 1MPLA 5F1FA 3W4PA 1JTGA 1P3LA 3LJAA 2AROD 4JKTA 3B6FD 1EI5A 1P3ID 2LY8A 3AZFC 5GSUD 4KUDD 3AZED 4IBCA 1JVJA 5EUAA 3ZHHA 4J8WA 4O7DA 4IBJA 5B33A 2YFVA 4UUZA 1M19B 2FJ7C 5AV5A 1L0DA 5BNVA 2VGJA 1IYOA 4QLCB 4R8PA 3WTPD 3GTCA 5CHLB 3V39A 1C3BA 3MKEA 2RVQD 5AVBD 3LZ1C 4CAYB 1L2SA 3FWLA 1P3PA 4MBKA 5F99D 4P87A 3KS8A 5FQIA 2ZM8A 3AN2D 1XXMA 5U47A 4H9OB 1F66A 3A3DA 5B0ZB 1TZYA 1KX4A 3A3EA 3RXXA 4MEZA 2WZXA 5KZHA 4Y0UA 2Y2KA 4JJNA 1S32A 4OOLA 5B1MD 5DNMC 4EBLA 1ZKJA 1M18B 3PAEA 4WZ5C 3AZGC 1P3GA 1ZG4A 3ZVTA 3WS2A 4LD9B 4DE0A 2PYOA 3REJA 4JF6A 5GT0D 3OCNA 3AZHD 1MY8A 3OPHA 2NQBA 1H8YA 3WAAA 4XUJC 3FZCA 2IO5C 3R45B 4Z5TB 3MGQC 5C3IC 3AZNB 4OJ5A 4DRBA 3MGRD 4NZ3A 1BH8A 4EQIA 4GDNA 2F8NB 1YMSA 3LELB 3C1BD 5AQAA 2WKIA 1XP4A 3C5AA 4M3KA 4NFTA 3B0DC 2Y4AA 1PWGA 1JFIA 3BLSA 4DE3A 3ZG5A 1H8ZA 3WKJC 2HP6A 5B40D 1IKGA 3SS4A 4BENA 5AV8B 3KWQB 5B31A 2EXBA 4S2IA 3W97C 1EQZA 3CZDA 1FQGA 4J8VD 1KGGA 3AZKD 1K57C 4N9LA 2ZMAA 5EOOA 1IEMA 3S1YA 2DCFA 4YS3D 1L0EA 1HQ3D 4N9KA 5CPKD 2FJ7A 3UTAB 2ZJ9A 3JYIA 4ZJ2A 1YLZA 3AGFA 3B6GA 1FSWA 4MLLA 1CI8A 1LL9A 1K56D 3MVDD 1Q9CA 2FFYA 4B88A 2F8NG 3A6NA 3KSYA 5B24A 3A1IA 5E2FA 1M19C 1ULYA 3MXSA 3MGSB 4WU9D 4QLCC 3B6FB 4JPMA 1P3BD 1ONHA 5DNNA 5AV9D 2Z2LB 3UTBB 3QNCA 4PPRA 5KDMA 2ZC5B 2C6WB 1E25A 3AFAB 4X68A 3REID 1BZAA 1M1AD 5FAOA 3HUNA 3UPNA 3SS3A 5B0ZC 3GVBA 4E3JA 4XXRA 1MWSA 1PZRA 4DKIA 2P9VB 1ID3B 3PTEA 1SCWA 4UA7A 1P3OD 3Q07A 1YU1A 1IYSA 4N1HA 3VP3A 3N3FA 1PIOA 1P3AB 1M18C 3L27A 2H5SA 2PU4A 4LD9C 2Q9NA 5GT3C 5E5AD 4DXCA 3V9RA 5GXQD 3LCEA 3GQZA 2H0YA 1A7WA 4UA9A 4Z5TC 5CGXA 4K91A 3AZNC 5AQ7A 3AYWD 4J8WB 4UHUA 2L5AA 4UUZB 5TFQA 3LELC 2F8NK 1ALQA 4HEFA 5AV5B 5BNVB 3P09A 1P3KD 4YM6D 4R8PB 3UE1A 5CGSA 3ZG7B 5B1LD 4DQYB 4S2NC 1P3PB 5AV8C 3G31A 3KWQC 1L0FA 4R4SA 3MGRB 4IBGA 3V3RA 2X02A 4J8XD 3VH5A 1F66B 4L0LA 4GB7A 4BL3A 1KX4B 1W2EA 3NDEA 3ZCZA 3X1UD 3UTAC 3AZMD 3N4IA 1S32B 3DWZA 3CG5A 3O62A 2X01A 4BL2A 2J9PA 5GLBA 3A3JA 1GA9A 3PBNA 4OVDA 1JWVA 3MZFA 5FAQA 3AZID 4GNUA 4FSFA 3WA9A 1KGFA 4X23D 2PYOB 4S2LA 3ZFZA 3HLGA 3X1VA 2NQBB 3WAAB 3MGSC 2DF4C 1DJAA 3B6FC 2G5IC 2ZC4B 5EECA 3UTBC 4E3NA 1BH8B 3H0LC 1P3MA 5DTKA 3VH5W 3G30A 4KG2A 3AFAC 5B2JD 2Y59A 1KX3D 4OOMA 3IHBA 1DJBA 5CPIA 5JRGA 1JFIB 4NYUA 3AV1D 4IBBA 1HZOA 3PBSA 5DF9A 3WTPC 5B0YD 5GT3A 3ZNYA 4KZ8A 5B31B 2CV5D 5EOEA 3WS1A 1EQZB 2HIOD 5FQMA 4DE2A 1ID3C 5JA4A 3R45A 4UPKA 4RA7A 4PM7A 3TU4D 1P3AC 2VGKA 4KENB 4K0XA 1K4FA 2Y2MA 4H9NA 1YLPA 3LELA 4GD8A 3AZJD 1KE4A 4DDSA 4B4XA 3C4OA 2Y2QA 3B6GB 4RVAA 2Y91A 3REKD 4S2PA 3W99A 3IQAA 5AY8A 1YLTA 4OPQA 2HP9A 3ZG8B 3A6NB 5B24B 5AV5C 1NRFA 4KZAA 4KGCA 3VFFA 2G2WA 2EX9A 5E5AB 4S2MA 1SKFA 4M6BA 3EPLA 4R8PC 5B32D 5AQ9A 5DNNB 2XFSA 3AZLA 1WYBA 1ZLAD 5BS7C 3UTAA 1SDEA 1P34A 5B31G 1P3PC 2OLUA 1Y54A 5KDMB 5DVAA 4FCFA 2V2FF 4ZBEA 3MGRC 4N1XA 1K6RA 3IF6A 3G4PA 4KQRA 1W5DA 4OLGA 4PM9A 3HUOA 4Y7PA 4Z2MG 1F66C 1YU4A 3L2AA 1YMXA 4Z66D 3VSLA 1M40A 1KX4C 1S6RA 3UPOA 3KXBA 3MZDA 1RP5A 1S32C 4GOGA 5CRFA 5FDHA 3W98D 4KZ7A 2AROA 4KZ9A 3B6FA 3FDDA 1YU0A 1T3UA 1P3IA 5GSUA 2XDMA 4KUDA 4X56A 1FCOA 1WYCA 3AZEA 1MBLA 1HTAA 4WNNA 5CXWA 1FOFA 1Z6FA 3O88A 3IP4C 1PI5A 5CECA 3V9RB 2V1ZA 1YLWA 1U35D 2WUQA 3BECA 4NY2A 3WAAC 3NIAA 2J8YA 3UPPA 4ZUXD 3WTPA 1KX5D 1BSGA 5AVCD 4CSRA 4X69A 5GL9A 3X1TD 5AVBA 4KG6A 3UN7A 4QNLA 3AZIB 4J8UD 4MNRA 3B3XA 5F99A 3AN2A 5TR7A 3W96D 2ZQCA 3S4XA 4HBTA 3RELD 3VMAA 3G32A 2G5HC 2VQRA 2V20A 4OQIA 5B31C 3L25A 4G92B 2WGVA 4WELA 1EQZC 3H0MC 4IVKA 4C3QA 5B1MA 2CC1A 3ZGAB 3MNND 4KZ5A 1W79A 1M1AC 3ITBA 2G2UA 3VFHA 3ZNTA 2FFFB 4QY5A 1H3OA 1R4VA 3O62B 2ZLYA 1NYMA 4WBGA 2WKEA 5GT0A 2ZY2A 3B6GC 3UO9A 3AZHA 1AOID 2ZQDA 5GLCA 5CPJD 5BS7A 2HDSA 4LENA 4NE6A 5CP6D 5E2GA 2J8PA 3A6NC 4KG5A 5HARA 3WA9B 3MGRA 5B24C 5FQJA 5GHZA 3S22A 3C1BA 3IXDA 4WU8D 3AGEA 3X1VB 3IWIA 5E5AC 3F6TA 4GZBA 4QJGA 5JYOA 4U3TA 2Y2OA 5DNNC 3LO7A 4R23A 4LV0A 5B40A 1P3MB 4WMCD 1MXOA 3AL0C 5FSRA 2EX2A 2P74A 5EPHA 5CPIB 4U0TA 5JRGB 1YLJA 4J8VA 1K54A 1ZC2A 3AZKA 4YM6C 2NZDD 5JYPA 4E3LA 3A1KA 5GT3B 2ZY4A 4YS3A 3Q7VB 1HQ3A 5CPKA 2ZC6B 3G2YA 2EX6A 4IBFA 1K55A 3W4OA 5JA4B 5BPVA 2IWBA 5KMWA 4OQGA 5A93A 4KQQA 4DRAA 4WJ3C 3Q82A 2Y2NA 4H9NB 3MVDA 1K56A 2XLNA 2OV5A 2H10A 2ZQAA 4EO5B 3UE3A 2A49A 4OKPA 1YM1A 4KQOA 2DRWA 1G6AA 2HUEB 4WU9A 4E6WA 1BH9A 1Z2CB 3W99B 1P3BA 4KZ6A 5AV9A 4JXVA 5AY8B 1TDGA 1LI0A 2XD5A 1TZYD 3AZIC 2EFUA 4KGCB 3Q7ZA 4D2OA 3X1SD 3GR2A 3REIA 1U60A 3LEZA 4IBRA 5E2EA 1M1AA 1CK3A 5M19A 3AZLB 3VH6T 5DTSA 3AGDA 3C1CD 1P34B 4G92C 3HREA 1KX5B 1I2SA 5FASA 4Z9QA 3NY4A 3IF6B 4NZ5A 3MBZA 3LZ0D 1VM1A 3PBQA 1ONGA 2ZM2A 3VP4A 4J8UB 5HFOA 5FI6A 1WWIA 2F8NH 1KDWA 3KUYD 3W96B 3ITAA 2JBFA 3AV2D 2WKHA 3KXBB 5CHMA 1G68A 4X55A 3SH7A 5E5AA 2AROB 3O62C 1HVBA 4JXSA 5GXQA 3NI9A 4E3IA 2HDRA 1P3IB 5GSUB 4KUDB 4ZAMA 1BLHA 3AZEB 1B67A 1K4EA 2Y2GA 4WNNB 5AV6D 3AYWA 2WGIA 3WA9C 2Y2JA 2XH9A 5D3OA 1P3FD 1KE0A 3Q1FA 2WK0A 2YFWB 3X1VC 3W4QA 1P3KA 4XZQD 4YM6A 5FUGA 3TG9A 3AZFD 3WTPB 5HW3A 5GLDA 4CSRB 4IBIA 4F94A 5B1LA 5AVBB 1B6WA 3OPRA 1P3MC 2BYKA 2RIQA 5F99B 3C7UA 3SS5A 3AN2B 5CPIC 5FI7A 2ZQ9A 5JRGC 3M2KA 3MGPD 1NZUA 4JXGA 4J8XA 1YQSA 4ID4A 2XFTA 4DRTA 3X1UA 3WS5A 3LZ1D 3M2JA 3OC2A 3AZMA 1KVLA 1VQQA 5CEBA 3A3IA 5BT1C 1NYYA 5B1MB 3SH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6H A;  2I72 A;  1XPB A;  4RA7 A;  3VOZ A;  2EX8 A;  4PM7 A;  2A3U A;  3ZDJ A;  1I5Q A;  5EE8 A;  1PWC A;  3IHA A;  2VGK A;  4KEN B;  4C6Y A;  2WZZ A;  4K0X A;  5DF8 A;  2J9O A;  1TVF A;  1O7E A;  3BFG A;  1K4F A;  2Y2M A;  1YLP A;  5FAP A;  3UNW A;  4GD8 A;  1MPL A;  1FR6 A;  4DXB A;  4PM8 A;  5F1F A;  1KE4 A;  4QD4 A;  3W4P A;  4DDS A;  1GA0 A;  1JTG A;  1NY0 A;  4KZ3 A;  4B4X A;  4K0W A;  3QNB A;  3UDF A;  2HDQ A;  4QY6 A;  3C4O A;  5CTN A;  4JKT A;  4IED A;  2Y2Q A;  1EI5 A;  3GSG A;  1QMF A;  4RVA A;  4ZJ1 A;  2Y91 A;  3N7W A;  4S2P A;  3IQA A;  1BUL A;  4RYE A;  5FQ9 A;  4ZJ3 A;  3M6B A;  1JVJ A;  1YLT A;  4OPQ A;  2HP9 A;  5EUA A;  3ZG8 B;  3ZHH A;  4O7D A;  2DNS A;  1PYY A;  1FSY A;  1NRF A;  1ES5 A;  4KZA A;  3VFF A;  2G2W A;  2EX9 A;  1L0D A;  5EVI B;  2JE5 A;  1LI9 A;  1SKF A;  4S2M A;  2VGJ A;  4QB8 A;  1IYO A;  5AQ9 A;  2HP5 A;  2XFS A;  3GTC A;  3V39 A;  1XX2 A;  1CEG A;  2WGW B;  2XGN A;  1WYB A;  1C3B A;  3MKE A;  2XD1 A;  1SDE A;  1L2S A;  2OLU A;  1Y54 A;  4EUZ A;  5DVA A;  3FWL A;  4LCL A;  2QPN A;  4FCF A;  2V2F F;  4GD6 A;  4P85 A;  4ZBE A;  1E4D A;  5KSC A;  5F82 A;  3IF6 C;  2XK1 A;  4N1X A;  4MBK A;  1K6R A;  2PU2 A;  3EQV A;  3IF6 A;  3G4P A;  4KQR A;  4P87 A;  1W5D A;  4OLG A;  5FQI A;  2ZM8 A;  3LY4 A;  3RXW A;  4PM9 A;  3CJM A;  1GHI A;  1XXM A;  1OME A;  3HUO A;  5DF7 A;  4Y7P A;  5U47 A;  1ES3 A;  4CPK A;  4DE1 A;  3PBT A;  1YMX A;  3VSL A;  2XEP A;  1K25 A;  1M40 A;  3MFD A;  4FH2 A;  5E43 A;  3A3D A;  3O86 A;  4WEK A;  5M1A A;  3HBR A;  3IWO A;  1QME A;  1S6R A;  3A3E A;  2RCX A;  3RXX A;  3O3V A;  5A90 A;  1BUE A;  1IEL A;  3UPO A;  4MEZ A;  3TOI A;  3V3S A;  2WZX A;  5KZH A;  4JF5 A;  3NBL A;  4Y0U A;  3MZD A;  1RP5 A;  4GOG A;  5CRF A;  5FDH A;  2Y2K A;  2R9X A;  1YLY A;  2IWD A;  4IVI A;  2OSU A;  2QMI A;  4KZ7 A;  3A3F A;  4OOL A;  4KZ9 A;  1DJC A;  1XA1 A;  3PBO A;  4DDY A;  2XDM A;  3FKW A;  3EQU A;  3IF5 A;  1HD8 A;  3GMW A;  2EXA A;  2PBY A;  3WRZ A;  4X56 A;  4EBL A;  1FCO A;  1WYC A;  4BQM A;  1MBL A;  2WAF A;  1ZKJ A;  5CXW A;  1FOF A;  3PAE A;  4WZ5 C;  5GLA A;  1Z6F A;  1N4O A;  3O88 A;  4WZ5 A;  1ZG4 A;  1PI5 A;  3ZVT A;  3WS2 A;  4DE0 A;  5CEC A;  4OPY A;  3HLE A;  1KE3 A;  2V1Z A;  1YLW A;  4WM9 A;  2Y2I A;  1BLS A;  3FKV A;  2WUQ A;  1W7F A;  3BEC A;  4JF6 A;  5CHU A;  4BD0 A;  3ZG0 A;  3OCN A;  4LV1 A;  1MY8 A;  3OPH A;  1KDS A;  3NIA A;  1FCN A;  1IYQ A;  1H8Y A;  2J8Y A;  1FR1 A;  3UPP A;  3FZC A;  4JBF A;  3IXB A;  3VP0 A;  3QHY A;  3ISG A;  4EWF A;  1MWT A;  2Y2P A;  1BSG A;  2ZC7 A;  1JTD A;  3Q7V A;  5CHJ A;  4X69 A;  5GL9 A;  4KG6 A;  3UN7 A;  4NET A;  5CER A;  4EQI A;  4GDN A;  4S2J A;  3BYD A;  1YMS A;  5AQA A;  1H5X A;  4MNR A;  3B3X A;  4QU3 A;  2WKI A;  3ZVW A;  1XP4 A;  3SOI A;  3I7J A;  3C5A A;  4M3K A;  3VP1 A;  5TR7 A;  2ZQC A;  3S4X A;  2Y4A A;  4HBT A;  1PWG A;  3LY3 A;  5KSH A;  2Y55 A;  4RX2 A;  3BLS A;  4DE3 A;  3ZG5 A;  3VMA A;  1H8Z A;  2HP6 A;  3G32 A;  4UA6 A;  2Y2L A;  3C7V A;  1IKG A;  4GKU A;  2V20 A;  4OQI A;  3SS4 A;  4BEN A;  2ZD8 A;  3IH8 A;  3MXR A;  4DF6 A;  3OZH A;  3MZE A;  1RCJ A;  2EXB A;  2WGV A;  4WEL A;  4R3B A;  4OPZ A;  4S2I A;  3TSG A;  4S2O A;  1I2W A;  1NJ4 A;  5F83 A;  3CZD A;  1FQG A;  4IVK A;  4C3Q A;  3N6I A;  2CC1 A;  3ZGA B;  1XKZ A;  4KZ5 A;  3BFE A;  1KGG A;  1W79 A;  1K57 C;  4N9L A;  3ITB A;  4ZTK A;  1K57 A;  2ZMA A;  4OLD A;  2Z2M B;  5EOO A;  1IEM A;  1RGY A;  5IHV A;  3S1Y A;  2G2U A;  1Q2P A;  2DCF A;  3VFH A;  3ZNT A;  4P0M A;  1IKI A;  1L0E A;  1PZP A;  4N9K A;  1LL5 A;  2FFF B;  4QY5 A;  1BLP A;  2ZJ9 A;  3WRT A;  2ZLY A;  3FYZ A;  3JYI A;  1NYM A;  1ERM A;  4WBG A;  4ZJ2 A;  2X71 A;  2WKE A;  4E3O A;  2H0T A;  3UO9 A;  4S2K A;  2Y2H A;  1YLZ A;  3AGF A;  2ZQD A;  1FSW A;  1FCM A;  2E8I A;  4N92 A;  5GLC A;  3RJU A;  2HDS A;  3HLB A;  3ZG9 B;  4LEN A;  4MLL A;  1CI8 A;  1LL9 A;  4OH0 A;  5EVL A;  1K56 D;  5E2G A;  3OPP A;  5HX9 A;  4KG5 A;  1ES2 A;  5HAR A;  2FFY A;  4B88 A;  2XR0 A;  5FQJ A;  5AQB A;  5GHZ A;  5HAP A;  1SDN A;  1Q2Q A;  3S22 A;  3IXD A;  5CGW A;  5E2F A;  4MBH A;  4Y0T A;  1NXY A;  3AGE A;  4JLF A;  3IWI A;  5EVI C;  4Q8I A;  3HLW A;  4GZB A;  3MXS A;  2ZQ8 A;  4QJG A;  5TGF A;  5JYO A;  3BRM A;  4FH4 A;  3W8K A;  4U3T A;  2Y2O A;  4JPM A;  1GHP A;  5FA7 A;  1ESI A;  3WS4 A;  3DTM A;  1L0G A;  2JCH A;  3LO7 A;  1ONH A;  4UAA A;  1M6K A;  2Z2L B;  2OLV A;  4R23 A;  4LCM A;  4LV0 A;  2JC7 A;  3QNC A;  4PPR A;  4R1G A;  1XGJ A;  1ERQ A;  4JF4 A;  4OQH A;  4RX3 A;  2ZC5 B;  4WMC D;  4ZDX A;  1MXO A;  3VSK A;  1PW8 A;  4OON A;  5FSR A;  2C6W B;  2EX2 A;  4BJP A;  1E25 A;  1K38 A;  2P74 A;  4KZB A;  4X68 A;  5EPH A;  5A91 A;  4U0T A;  1BZA A;  5FAO A;  1K54 C;  1YLJ A;  2R9W A;  1K54 A;  3HUN A;  3MKF A;  1ZC2 A;  4CJN A;  1MWU A;  2IWC A;  3UPN A;  4OQ0 A;  3SS3 A;  1KVM A;  4NK3 A;  3DW0 A;  3GVB A;  2BLS A;  4OP5 A;  5JYP A;  4E3L A;  4X6T A;  3NCK A;  4LV3 A;  1TDL A;  4E3J A;  4XXR A;  4QHC A;  1K55 C;  3Q7V B;  4BD1 A;  2ZC6 B;  3G2Y A;  2EX6 A;  1MWS A;  2WYX A;  1K55 A;  4DKI A;  3N8L A;  3W4O A;  2P9V B;  3SH9 A;  1IYP A;  2IWB A;  3PTE A;  1W8Q A;  1SCW A;  4UA7 A;  1ES4 A;  3HLC A;  5KMW A;  1BTL A;  4OQG A;  3Q07 A;  5A93 A;  1IYS A;  3BEB A;  4N1H A;  1GHM A;  3VOY A;  3VP3 A;  4KQQ A;  1BLC A;  1PIO A;  3Q82 A;  2Y2N A;  1CI9 A;  4WZ4 A;  4HES A;  1K56 A;  4A5R A;  2XLN A;  2OV5 A;  3N8S A;  1E3U D;  2WAD A;  2H10 A;  2H5S A;  2PU4 A;  3N8R A;  1HTZ A;  5DTT A;  2BG1 A;  1W8Y A;  2Q9N A;  3C4P A;  4OP8 A;  5EVI D;  5HAQ A;  4DXC A;  2XQZ A;  3O87 A;  2ZQA A;  3BFF A;  3D4F A;  4JXW A;  1JWP A;  3UE3 A;  4EV4 A;  3LCE A;  1PI4 A;  2A49 A;  4BLM A;  3GQZ A;  2HDU A;  4OKP A;  2H0Y A;  5FQK A;  3UY6 A;  1YM1 A;  2XF3 A;  4KQO A;  2DRW A;  4PM6 A;  5GHY A;  1G6A A;  4UA9 A;  4E6W A;  4KZ6 A;  2EFX A;  5CGX A;  4K91 A;  1JWZ A;  5FAT A;  4JXV A;  1K6S A;  1ZG6 A;  5AQ7 A;  1TDG A;  1PWD A;  1LI0 A;  3G2Z A;  4UHU A;  2XD5 A;  5TFQ A;  3IT9 A;  3HLF A;  4WMC A;  1ALQ A;  4HEF A;  2EFU A;  3IXH A;  4IBX A;  4YIN A;  1WE4 A;  3Q7Z A;  4D2O A;  3P09 A;  3GR2 A;  4IBR A;  1U60 A;  3LEZ A;  4PMA A;  5E2E A;  2UWX A;  1CK3 A;  3OCL A;  1O07 A;  3IXG A;  3UE1 A;  4EBN A;  5M19 A;  5DTS A;  3AGD A;  4WEJ A;  5CGS A;  3ZG7 B;  4S2N C;  2Q9M A;  1PZO A;  2ZM0 A;  2HPB A;  4XUZ A;  4S2N A;  3HRE A;  1I2S A;  3G31 A;  3BFD A;  3Q81 A;  4YFM A;  1NZO A;  5F1G A;  5FAS A;  2C5W B;  1YT4 A;  3HL9 A;  3NY4 A;  4Z9Q A;  1L0F A;  3BM6 A;  3IF6 B;  4R4S A;  3MBZ A;  1VM1 A;  3PBQ A;  1ONG A;  2ZM2 A;  3V3R A;  2X02 A;  3VP4 A;  1ESU A;  4EBP A;  5HL1 A;  3E2K A;  5M18 A;  5HFO A;  5FI6 A;  3OPL A;  1KDW A;  3GRJ A;  4L0L A;  4R4R A;  4GB7 A;  3ITA A;  4BL3 A;  2JBF A;  4X53 A;  3BLM A;  4OOY A;  3NDE A;  4B4Z A;  1E3U A;  2WKH A;  3ZCZ A;  3CMZ A;  5GHX A;  5G18 A;  4H8R A;  5CHM A;  4KZ4 A;  1G68 A;  4X55 A;  3SH7 A;  4C75 A;  5EVI A;  3N4I A;  3PBR A;  2B5R A;  1HVB A;  4JXS A;  1KGE A;  3DWZ A;  3NI9 A;  1AXB A;  3CG5 A;  3FV7 A;  2HDR A;  2X01 A;  4BL2 A;  4E3I A;  3IWQ A;  2J9P A;  5GLB A;  3UDX A;  4OPR A;  4E3K A;  1TEM A;  3A3J A;  1GA9 A;  2WGW A;  3PBN A;  2ZQ7 A;  1JWV A;  3P98 A;  4OVD A;  4ZAM A;  1BLH A;  1XGI A;  4MBF A;  5FI2 A;  1BT5 A;  3GV9 A;  4GDB A;  1K4E A;  3HLD A;  5L2F A;  2Y2G A;  4HBU A;  4PM5 A;  4R0Q A;  4U0X A;  1LHY A;  2WGI A;  5FQQ A;  1J9M A;  3MZF A;  4LV2 A;  5FAQ A;  4GNU A;  2Y2J A;  4FSF A;  2XH9 A;  5D3O A;  4FD8 A;  1KGF A;  2RL3 A;  4P6B A;  5CTM A;  1KE0 A;  3G34 A;  1S0W A;  4S2L A;  1RGZ A;  3G35 A;  2WK0 A;  3HVF A;  3HLG A;  3Q1F A;  4XUX A;  3ZFZ A;  1SHV A;  4GN2 A;  3W4Q A;  3BFC A;  3DWK A;  5HAI A;  2WAE A;  3WWX A;  1DJA A;  3TG9 A;  5HW3 A;  5GLD A;  1MWR A;  1PW1 A;  1DY6 A;  2ZC4 B;  4E3M A;  4F94 A;  3V5M A;  5EEC A;  3UDI A;  3V50 A;  1GCE A;  1CEF A;  4E3N A;  2ZC3 B;  2J7V A;  3OPR A;  4Y0O A;  3NC8 A;  5DTK A;  3NDG A;  2GDN A;  3G30 A;  5A92 A;  3C7U A;  4KG2 A;  1N9B A;  1EWZ A;  2QZ6 A;  3SS5 A;  4E6X A;  2Y59 A;  3HUM A;  1MKI A;  2ZQ9 A;  4OOM A;  5FI7 A;  3IHB A;  1DJB A;  3M2K A;  3VP2 A;  1NZU A;  4JXG A;  1LLB A;  3PAG A;  1YQS A;  1HZO A;  1XA7 A;  4ID4 A;  5CED A;  3UE0 A;  2XFT A;  4DRT A;  3PBS A;  5DF9 A;  1ERO A;  3ZNY A;  5BOH A;  4KZ8 A;  3WS5 A;  3IH9 A;  3M2J A;  4WYY A;  3OC2 A;  3E2L A;  5I94 A;  1KVL A;  1VQQ A;  5EOE A;  3A3I A;  3WS0 A;  3WS1 A;  5CEB A;  5J8X A;  5FQM A;  1NYY A;  4DE2 A;  2P9V A;  4R3J A;  5E2H A;  3SH8 A; 
#chains in the Genus database with same CATH topology
 3VOZ A;  2EX8 A;  2KDK A;  2MJ6 A;  1I5Q A;  5B2I D;  4O8G A;  3BFG A;  1NWZ A;  3AZI A;  4DXB A;  4PM8 A;  4HJ4 A;  4E04 A;  1GA0 A;  1H3O B;  4X23 A;  4KZ3 A;  4EO5 C;  3KSF A;  1GXD A;  2HDQ A;  4QY6 A;  5GT0 B;  3EWK A;  4IED A;  3AZH B;  4L9G A;  1H0G A;  5J7E A;  3T1X A;  4ZJ1 A;  3D3O A;  1T18 A;  2HUE C;  5DNM D;  4HNB A;  3W99 C;  2PR5 A;  3N7W A;  2BYM A;  5AY8 C;  5FQ9 A;  4ZJ3 A;  1NLY A;  3M6B A;  4CQH A;  2V0U A;  3AZG D;  2W1R A;  3C1B B;  1PYY A;  4KGC C;  4OJ6 A;  3NQJ A;  1ES5 A;  5B2J A;  3E0Y A;  1KX3 A;  1T1A A;  1UR8 A;  2JE5 A;  1LI9 A;  1IOU A;  1GSV A;  4QB8 A;  2YKH A;  3AZL C;  4QWO A;  3AV1 A;  2EWV A;  4XUJ D;  2WGW B;  4YOF A;  1P34 C;  3MGQ D;  1BFM A;  5B40 B;  5B0Y A;  1KX5 C;  3MR0 A;  4EUZ A;  4GD6 A;  2CV5 A;  1E4D A;  5F82 A;  3IF6 C;  3F1P A;  5AVE A;  2PU2 A;  3EQV A;  3IS2 A;  2HIO A;  3RXW A;  3VOL A;  1OME A;  4HIA A;  4J8U C;  4J8V B;  2HJ9 C;  3AZK B;  1ES3 A;  3X1S B;  3TU4 A;  4DE1 A;  3PBT A;  5E43 A;  1K25 A;  3MFD A;  3W96 C;  4WEK A;  5M1A A;  2W3E A;  2QJ5 A;  3IWO A;  1QME A;  3KXB C;  3O3V A;  1IEL A;  3WKJ D;  4IBE A;  4YS3 B;  4Y17 A;  3V3S A;  1HQ3 B;  3AZJ A;  5CPK B;  2OWJ A;  3DBA A;  2ARO C;  1LL8 A;  1YLY A;  5BO0 A;  4IVI A;  4Z1W A;  1P3I C;  5GSU C;  3LR4 A;  4KUD C;  3W97 D;  3EQU A;  2J3W A;  1HD8 A;  3GMW A;  2EXA A;  4ZBJ B;  3AZE C;  3REK A;  1KU5 A;  3MNN C;  4BQM A;  3MVD B;  2PD7 A;  4EEU A;  1N4O A;  3HLE A;  4MCW A;  4WM9 A;  1BLS A;  4CLC E;  1W7F A;  3F1N A;  4BD0 A;  3ZG0 A;  4LV1 A;  3B0C T;  1KDS A;  4WU9 B;  1BH9 B;  1UGU A;  1P3B B;  5B32 A;  2FN2 A;  3IXB A;  4JBF A;  3QHY A;  3ISG A;  3REH D;  5AV9 B;  1WWS A;  4EWF A;  2RVQ C;  2Z6D A;  1E6Z A;  5AVB C;  5CPJ C;  1ZLA A;  1JTD A;  3Q7V A;  2LB9 A;  2HV1 A;  1N1J A;  3MJQ A;  3L29 A;  4G91 B;  4S2J A;  2JKF A;  3BYD A;  5F99 C;  4OUI A;  1H5X A;  3AN2 C;  3REI B;  1M19 D;  3ZVW A;  1M1A B;  2VGL M;  3SOI A;  3VP1 A;  4AWL B;  5HPF A;  2Y55 A;  4Z66 A;  1AWI A;  3LGO A;  4QLC D;  4EET B;  4I5S A;  3C2W A;  2Y2L A;  3UT9 D;  1IFQ A;  1GPF A;  4GKU A;  2XA7 S;  3FKE A;  2ZD8 A;  4DF6 A;  4H6J A;  2JHE A;  1RCJ A;  2FH5 A;  3W98 A;  4S2O A;  5B1M C;  1I2W A;  1P3O B;  1XKZ A;  3T4L A;  2J80 A;  3MGP B;  4ZTK A;  4OLD A;  2Z2M B;  1SZV A;  4Y5F A;  4LRX C;  5B0Z D;  4LG2 A;  4JGO A;  1RGY A;  5IHV A;  2NZD C;  1F98 A;  4P0M A;  2JKT M;  1BLP A;  1H3Q A;  5GXQ B;  3WRT A;  2J3T C;  5GT0 C;  3FYZ A;  1U35 A;  3AZH C;  4E3O A;  2H0T A;  5L09 A;  2E8I A;  4N92 A;  3RJU A;  4KUO A;  4ZUX A;  3HLB A;  4WUJ A;  3AYW B;  1KX5 A;  5AVC A;  1M18 D;  3OPP A;  3X1T A;  4B9O A;  1T1B A;  4Z2M H;  3C1B C;  2XR0 A;  5AQB A;  2D02 A;  4GHL A;  4LD9 D;  5CGW A;  4MBH A;  4J8U A;  1S1Y A;  4Y0T A;  1NXY A;  4JLF A;  1P3K B;  1V9Y A;  2FZ0 A;  4YM6 B;  4Q8I A;  5FUG B;  3HLW A;  3VE3 A;  3W96 A;  5TGF A;  4R70 A;  3BRM A;  4FH4 A;  4OJP A;  3W8K A;  3REL A;  2G7U A;  1ESI A;  3RTY A;  3DTM A;  1L0G A;  2WKP A;  4Z5T D;  2ZMV A;  1XJ6 A;  5B1L B;  4UAA A;  1TAF A;  5B40 C;  3AZN D;  5EM1 A;  4R1G A;  1XGJ A;  1DP6 A;  2BYK B;  2D49 A;  4FUW A;  2JSS A;  4JF4 A;  4OQH A;  4ZDX A;  3BQA A;  3VSK A;  2F8N D;  1P9W A;  1PW8 A;  4OON A;  4BJP A;  4IJF A;  2M1C A;  1K38 A;  4P6Z S;  3QP5 A;  5A91 A;  4J8V C;  1K54 C;  4WZS B;  4J8X B;  3MNN A;  3AZK C;  3X1S C;  4CJN A;  4E45 A;  4OQ0 A;  1KVM A;  4NK3 A;  2DQN C;  2BLS A;  2BTF P;  3NCK A;  3F1O B;  3X1U B;  4YS3 C;  1HQ3 C;  4LV3 A;  5CPK C;  3R7W B;  3AZM B;  2YFW A;  1K55 C;  3CPT B;  4BD1 A;  5AV8 D;  3HJK A;  4KHA A;  3KWQ D;  2WYX A;  1VHM A;  3SH9 A;  1IYP A;  1L3L A;  1W8Q A;  1ES4 A;  1MKM A;  3HLC A;  1YAX A;  1AOI A;  2VZW A;  4ZBJ C;  4OJL A;  5CPJ A;  4PKY G;  4WLA A;  3VOY A;  3MVD C;  5J4E A;  5CP6 A;  3N8S A;  4H9P A;  1E3U D;  1YU3 A;  1HTZ A;  4ARZ A;  2BG1 A;  4X23 B;  4MB5 A;  5EVI D;  2P04 A;  2XQZ A;  4WU8 A;  4H9R A;  1JWP A;  4EV4 A;  3UY6 A;  4WU9 C;  3KYQ A;  3EGX C;  4PM6 A;  5DKL A;  1P3B C;  5GHY A;  5AV9 C;  2BYM B;  2EFX A;  3IX3 A;  1JWZ A;  1ZG6 A;  3TRC A;  1EW0 A;  3G2Z A;  4G91 C;  4HME A;  4KQD A;  3HLF A;  3MS6 A;  4WMC A;  3NQJ B;  3IXH A;  4IBX A;  4YIN A;  5B2J B;  3REI C;  1KX3 B;  4LGW A;  4PMA A;  3EPJ A;  4AWL C;  2UWX A;  3OCL A;  3AV1 B;  1O07 A;  4EBN A;  2ZM5 A;  3MGS D;  4GLQ A;  4XZQ C;  2O9B A;  2NZD A;  5B0Y B;  3REH B;  2Q9M A;  3FG8 A;  3UTB D;  2HPB A;  4XUZ A;  3MQO A;  2CV5 B;  3UB8 A;  3BFD A;  4YFM A;  4X1L A;  3HL9 A;  3F1P B;  3BM6 A;  4EEP A;  3NQU A;  3IS2 B;  2HIO B;  1P97 A;  3AFA D;  1P3O C;  1ESU A;  4EBP A;  5HL1 A;  3E2K A;  4BBT A;  5M18 A;  3TU4 B;  3C30 A;  3VE4 A;  5BNX B;  1TS8 A;  3RH8 B;  4H9S A;  5KIZ A;  3MGP C;  4R4R A;  3BLM A;  3LR3 A;  4B4Z A;  3AZJ B;  5G18 A;  2XRN A;  3FPW A;  4KZ4 A;  4C75 A;  3UT9 B;  3PBR A;  2B5R A;  5BO0 B;  5GXQ C;  2XSS A;  4H9Q B;  1ODV A;  5F5Y A;  1KGE A;  4JGR A;  3HON A;  3IWQ A;  3UDX A;  1ID3 D;  4OPR A;  2WGW A;  3REK B;  2VV7 A;  5FI2 A;  4MBF A;  2O99 A;  5AJG A;  3HLD A;  3UB5 P;  3AYW C;  4G3K A;  4HBU A;  2PRF A;  1P3A D;  5TBM A;  4G3V A;  2GX5 A;  5B2I C;  3BW6 A;  1FIK A;  1OT6 A;  2V8C A;  4FD8 A;  2RL3 A;  4GHI B;  4P6B A;  1P3L D;  3LJA D;  5CTM A;  5HWV A;  1RGZ A;  3F1N B;  3G35 A;  3HVF A;  3SW1 A;  1P3K C;  1SHV A;  3X1S A;  4GN2 A;  4R6L A;  3MXQ A;  4NEE D;  3BFC A;  3DWK A;  2WAE A;  5B32 B;  3CWF A;  3BY9 A;  3B0C W;  4NYY A;  4B93 A;  5B1L C;  3KFU G;  1DY6 A;  1ZLA B;  3ULF A;  4E3M A;  3C1C A;  5HD5 A;  3UDI A;  3H7W A;  1N1J B;  2O9A A;  2J7V A;  2ZC3 B;  4J8W D;  4OJO A;  2WKR A;  4NZ4 A;  5B33 D;  2GDN A;  2V0W A;  1EWZ A;  5AV5 D;  2QZ6 A;  4E6X A;  2A24 A;  3LZ0 A;  4J8X C;  2BAS A;  4FOF A;  3VP2 A;  1LLB A;  4Z66 B;  4R8P D;  5HD3 A;  1H0M A;  3KUY A;  4KUK A;  5CED A;  3UE0 A;  3AV2 A;  1PNE A;  3X1U C;  1UWP X;  5BOH A;  3AZM C;  3IH9 A;  4H6J B;  1P3P D;  3L28 A;  2DMW A;  2PR6 A;  4M4X A;  3W98 B;  3WS0 A;  5J8X A;  3VH5 T;  4DMZ A;  3FC7 A;  3A0S A;  3M6H A;  1XPB A;  3K3C A;  5EFW A;  3ZDJ A;  1F66 D;  5EE8 A;  2VK3 A;  1DP9 A;  1KX4 D;  2J9O A;  5AV6 A;  5FAP A;  4NXB A;  3MMH A;  4I3A A;  1FR6 A;  4X23 C;  4QD4 A;  1P3F A;  3NOT C;  1NY0 A;  4K0W A;  4JJN D;  1S32 D;  3P01 A;  3QNB A;  1U35 B;  3UDF A;  5CTN A;  3M7P A;  1W63 M;  3EPK A;  5B32 G;  3GSG A;  4XZQ A;  1QMF A;  3WTP E;  4ZUX B;  3AZF A;  4GH9 A;  5AVC B;  1BUL A;  3BQ8 A;  4RYE A;  3X1T B;  3WD0 A;  4R3A A;  1P3G D;  2XA7 M;  3WD2 A;  4HMC A;  2DNS A;  3HCY A;  1P3O A;  1T1C A;  5B2J C;  3L26 A;  2PYO D;  1KX3 C;  1FSY A;  4HGA B;  3REJ D;  3CIT A;  2W1T B;  5EVI B;  3MGP A;  2NQB D;  3AV1 C;  3REL B;  3WAA D;  4Z2K A;  1S67 L;  2HP5 A;  1XX2 A;  1TAF B;  1CEG A;  2XGN A;  5B0Y C;  2XD1 A;  3REH C;  2GZA A;  5K5B A;  2CV5 C;  3LZ1 A;  2QPN A;  4LCL A;  4P85 A;  1G5U A;  5KSC A;  3R4K A;  2HIO C;  2XK1 A;  2GJ3 A;  2NUT C;  5HDD A;  1ZTU A;  3LY4 A;  3CJM A;  1Y4O A;  1GHI A;  2W8S A;  3MNN B;  2D01 A;  3TU4 C;  5DF7 A;  4PKY A;  4CPK A;  1YSQ A;  3EGD C;  2XEP A;  4FH2 A;  3B0B A;  3B42 A;  3O86 A;  3EPH A;  3HBR A;  5B2I A;  3PHY A;  2RCX A;  5A90 A;  1BUE A;  1E8B A;  3AZJ C;  2ZL1 A;  4Q0J A;  1OTD A;  3TOI A;  4JF5 A;  3NBL A;  4KHA B;  3EEA A;  3LIC A;  3UT9 C;  3JPU A;  5B31 D;  2R9X A;  2IWD A;  2OSU A;  2QMI A;  2YKF A;  3A3F A;  1EQZ D;  1DJC A;  1XA1 A;  1AOI B;  4IJE A;  3PBO A;  4DDY A;  3FKW A;  3REK C;  3IF5 A;  5CPJ B;  2QWS A;  5DNM A;  2PBY A;  3WRZ A;  2IA2 A;  5CP6 B;  4H9P B;  2WAF A;  1XJ4 A;  3S7N A;  5GLA A;  3L7H A;  4WZ5 A;  3AZG A;  2FJ7 D;  4WU8 B;  4OPY A;  4Q0H A;  2INW A;  1KE3 A;  1OPX A;  4H9R B;  2Y2I A;  4K08 A;  3FKV A;  1OJG A;  5CHU A;  2QKP A;  2ZY3 A;  3BJN A;  4F3L A;  2W3F A;  5B32 C;  1FCN A;  1IYQ A;  3B6G D;  1FR1 A;  2PYR A;  3VP0 A;  4XUJ A;  1ZLA C;  1MWT A;  4DJ2 A;  2Y2P A;  2ZC7 A;  4IBK A;  3MGQ A;  3ZQ5 A;  3CPT A;  5CHJ A;  4NET A;  5CER A;  3A6N D;  5G49 A;  5B24 D;  2EA9 A;  4QU3 A;  3EG5 B;  1P3L B;  3LJA B;  3I7J A;  4Z66 C;  4ETZ A;  3LY3 A;  5KSH A;  4RX2 A;  2NZD B;  3DAV A;  5DNN D;  4UA6 A;  3C7V A;  3WKJ A;  1LT0 A;  3WX7 A;  3IH8 A;  3MXR A;  3OZH A;  2VX8 A;  3NQU B;  3W98 C;  3MZE A;  4R3B A;  1UR9 A;  3LR0 A;  4OPZ A;  2PHY A;  3TSG A;  5B33 B;  2YFV B;  1NJ4 A;  5F83 A;  3LIF A;  1DRM A;  3W97 A;  3N6I A;  2IOU A;  4UQI S;  3BFE A;  1YKD A;  1K57 A;  1YU2 A;  1Q2P A;  1IKI A;  1PZP A;  2JN7 A;  1LL5 A;  5FEF A;  1U35 C;  5L10 A;  1ERM A;  1G6O A;  2X71 A;  4S2K A;  4HJ3 A;  2Y2H A;  4ZUX C;  1FCM A;  3KX0 X;  3ZG9 B;  3REH A;  5LBR A;  5AVC C;  5TBM B;  4OH0 A;  5EVL A;  3X1T C;  5HX9 A;  1ES2 A;  2H28 A;  2B02 A;  1CK7 A;  1TZY B;  4NZ1 A;  4L9E A;  5G4Z A;  5HAP A;  1SDN A;  1Q2Q A;  4HMD A;  4HGA C;  3QP1 A;  1M19 A;  5EVI C;  5BNX A;  4JJN B;  2ZQ8 A;  3REL C;  2A2L A;  3WS4 A;  2AVX A;  5FA7 A;  1GHP A;  1NRJ A;  2JCH A;  4QLC A;  3C1C B;  1M6K A;  3H7W B;  4LRZ E;  2OLV A;  1W1Y A;  4LCM A;  2JC7 A;  3UT9 A;  3VH6 A;  2L4R A;  4H9Q A;  4CAY A;  1ERQ A;  4RX3 A;  4Y15 A;  1P3G B;  2A24 B;  4KZB A;  3LZ0 B;  4ESP A;  1OTB A;  4RQ9 A;  1F1E A;  4LFU A;  4WV4 B;  3REJ B;  2R9W A;  3MKF A;  3IBJ A;  1D06 A;  1S66 L;  4E44 A;  3KUY B;  1MWU A;  2IWC A;  3OOV A;  4H9O A;  3DW0 A;  4L9F A;  3AV2 B;  4OP5 A;  5B0Z A;  4X6T A;  4GHI A;  2OWH A;  1YUE A;  1TDL A;  1OTI A;  4MN5 A;  4QHC A;  1O6I A;  3EEH A;  3N8L A;  3QP6 A;  4IJG A;  2V9A A;  1AOI C;  1BTL A;  2L0W A;  3QP4 A;  3BEB A;  5DJU A;  1GHM A;  5CP6 C;  1BLC A;  4WZ4 A;  1CI9 A;  3U2A A;  4HES A;  5AV6 B;  4A5R A;  2WAD A;  1M18 A;  3N8R A;  1P3F B;  5DTT A;  1W8Y A;  3C4P A;  4WU8 C;  4OP8 A;  5HAQ A;  4LD9 A;  3O87 A;  3BFF A;  3D4F A;  4JXW A;  3O62 D;  1PI4 A;  4XZQ B;  1H8M A;  4BLM A;  2HDU A;  5FQK A;  2XF3 A;  3QP8 A;  5F69 A;  3AZF B;  3VH6 W;  5FAT A;  4Z5T A;  2Q0O A;  1K6S A;  5F6A A;  3AZN A;  1PWD A;  3V67 A;  4XT2 B;  3WA9 D;  2ZY5 A;  3IT9 A;  4IBD A;  1S1Z A;  1MC0 A;  3HSH A;  2F8N A;  3S7P A;  1WE4 A;  4NE5 A;  4NE3 A;  1P3L C;  3LJA C;  2FJ7 B;  3X1V D;  3H0R C;  4JGQ A;  3IXG A;  4WEJ A;  2VKS A;  2CWE A;  4GS9 A;  2ZM0 A;  1PZO A;  3T1R A;  3LZ1 B;  4S2N A;  2JKR M;  1P3M D;  3Q81 A;  5F1G A;  1NZO A;  4BWI A;  2C5W B;  1YT4 A;  5AV8 A;  3KWQ A;  4J8W C;  3A0R A;  5B33 C;  3GDI A;  5CPI D;  3T4J A;  5JRG D;  4H9S C;  3OPL A;  3GRJ A;  5B2I B;  4X53 A;  4HY8 A;  4EQ1 A;  4OOY A;  2ZL1 B;  1E3U A;  5GT3 D;  1A0K A;  3CMZ A;  5GHX A;  2K2N A;  2Y79 A;  4H8R A;  2W1T A;  5EVI A;  5BT1 D;  1AXB A;  3FV7 A;  4ZRR A;  3PYP A;  4G3W A;  4E3K A;  1TEM A;  5DNM B;  2V1B A;  2ZQ7 A;  3P98 A;  1XGI A;  1BT5 A;  3GV9 A;  4GDB A;  5L2F A;  1KOU A;  2W3D A;  4PM5 A;  4R0Q A;  4U0X A;  1LHY A;  3WD4 A;  4FTX A;  3LEL D;  5FQQ A;  1J9M A;  3AZG B;  4LV2 A;  1TZY C;  3T50 A;  2PDR A;  2P08 A;  2ACG A;  3G34 A;  1UWN X;  4ME4 A;  1S0W A;  4XUX A;  4F3L B;  4JJN C;  5HAI A;  3WWX A;  3P5J B;  3DTK A;  4XUJ B;  3MGS A;  2IO5 B;  3C1C C;  3ZYT A;  3W99 D;  1MWR A;  1PW1 A;  3MGQ B;  5C3I B;  5TJJ A;  4GHA A;  3V5M A;  3V50 A;  5AY8 D;  1CEF A;  1GCE A;  1TS0 A;  3GEC A;  3UTB A;  2PBD P;  4Y0O A;  4AFI A;  3KS4 A;  5G49 B;  3NC8 A;  3NDG A;  1P3G C;  5A92 A;  1MZU A;  5I5L A;  3LZ0 C;  4KGC D;  1N9B A;  3HUM A;  1MKI A;  3AFA A;  3CUE A;  5DJT A;  2PYO C;  3REJ C;  3LUQ A;  4EXO A;  3B0D B;  3PAG A;  5EV0 A;  3KUY C;  3AZL D;  2NQB C;  1XA7 A;  3NUL A;  3AV2 C;  3ICY A;  3WKJ B;  3UTA D;  1P34 D;  1ERO A;  3T1Q B;  4WYY A;  3E2L A;  1ED7 A;  5I94 A;  2F2A C;  2P9V A;  3W97 B;  4R3J A;  5E2H A;  1ID3 A;  2I72 A;  2A3U A;  3KSH A;  1PWC A;  3IHA A;  5AV6 C;  4C6Y A;  2WZZ A;  5DF8 A;  1P3A A;  1TVF A;  1O7E A;  3UNW A;  3KXB D;  1P3F C;  1MPL A;  1F2K A;  5F1F A;  3W4P A;  1XFN A;  1JTG A;  1P3L A;  3LJA A;  3NHQ A;  3PR6 A;  2ARO D;  4JKT A;  3B6F D;  2P7J A;  1EI5 A;  4NXE A;  2PYP A;  2W3H A;  1P3I D;  2LY8 A;  3AZF C;  5GSU D;  4KUD D;  1N9L A;  3AZE D;  5F68 A;  4IBC A;  1JVJ A;  4BBV A;  5EUA A;  4MMN A;  3ZHH A;  4QPR A;  4J8W A;  4O7D A;  4IBJ A;  5B33 A;  2YFV A;  4UUZ A;  1M19 B;  4PHT A;  2FJ7 C;  5AV5 A;  1L0D A;  5MC7 A;  5BNV A;  2VGJ A;  1GSW A;  1IYO A;  4QLC B;  4R8P A;  3WTP D;  3GTC A;  5CHL B;  3U4L P;  3V39 A;  1C3B A;  3MKE A;  2RVQ D;  5AVB D;  3LZ1 C;  4CAY B;  1L2S A;  3FWL A;  1P3P A;  4MBK A;  5F99 D;  4P87 A;  5CX7 A;  3P7N A;  3KS8 A;  2K7S A;  5FQI A;  2ZM8 A;  3AN2 D;  1XXM A;  5U47 A;  4H9O B;  1F66 A;  3A3D A;  5B0Z B;  1TZY A;  3PXP A;  4EUV A;  1KX4 A;  3A3E A;  3RXX A;  4MEZ A;  1WA9 A;  2WZX A;  5KZH A;  4Y0U A;  2VV8 A;  5EVE A;  4Y2F A;  2Y2K A;  4JJN A;  1S32 A;  3LIE A;  4OOL A;  1BYW A;  2ZBB A;  5B1M D;  4Y13 A;  5DNM C;  1F5M A;  4EBL A;  5HZH A;  1ZKJ A;  1M18 B;  3PAE A;  4WZ5 C;  4HP4 A;  3AZG C;  3H9W A;  1P3G A;  3K3D A;  4MN6 A;  4NXF A;  3CAX A;  1ZG4 A;  3ZVT A;  3WS2 A;  4LD9 B;  3H82 B;  4DE0 A;  4EU0 A;  3IBR A;  2PYO A;  3REJ A;  4JF6 A;  3UMD A;  3MQ0 A;  2J3T D;  5GT0 D;  3OCN A;  3AZH D;  1MY8 A;  3OPH A;  2NQB A;  4Z2H A;  1E6R A;  1H8Y A;  3WAA A;  4XUJ C;  3FZC A;  2IO5 C;  3R45 B;  4Z5T B;  3MGQ C;  5C3I C;  2VGL S;  1T19 A;  3AZN B;  4OJ5 A;  3KSG A;  4DRB A;  2PT7 A;  3L9K A;  3MGR D;  4NZ3 A;  1BH8 A;  4EQI A;  4GDN A;  2F8N B;  1YMS A;  3LEL B;  3C1B D;  5AQA A;  3T4Q A;  2CMN A;  2WKI A;  5HDS A;  1XP4 A;  5J3W A;  3C5A A;  4M3K A;  4NFT A;  3B0D C;  2Y4A A;  1PWG A;  3S7Q A;  1JFI A;  4Z2J A;  2B95 A;  3BLS A;  3MSH A;  3ZG5 A;  4DE3 A;  1H8Z A;  4GS9 B;  3WKJ C;  2HP6 A;  4PAU A;  4EES A;  5B40 D;  1IKG A;  3CHW P;  3SS4 A;  4WL9 A;  4BEN A;  5AV8 B;  3KWQ B;  3T4O A;  5B31 A;  2OOL A;  2EXB A;  4TX8 A;  2JKT I;  3MQQ A;  4S2I A;  3W97 C;  1EQZ A;  5DKK A;  3CZD A;  1FQG A;  2I9V A;  4J8V D;  1KGG A;  3AZK D;  1K57 C;  1QO6 A;  4N9L A;  5C5K A;  2ZMA A;  4XT2 A;  5EOO A;  4GJ4 A;  1IEM A;  4I38 A;  2B18 A;  3S1Y A;  2DCF A;  2HGV A;  4YS3 D;  1L0E A;  1HQ3 D;  4N9K A;  5CPK D;  2FJ7 A;  4O0P A;  2UV0 E;  3UTA B;  2ZJ9 A;  3JYI A;  3T1S A;  4ZJ2 A;  1YLZ A;  3AGF A;  3B6G A;  1FSW A;  2Z6C A;  3KYE A;  1OTE A;  4MLL A;  1CI8 A;  1LL9 A;  1K56 D;  3MVD D;  1Q9C A;  2FFY A;  4B88 A;  2F8N G;  3A6N A;  2VEA A;  3KSY A;  1X0O A;  5B24 A;  3A1I A;  5E2F A;  1M19 C;  3TJZ C;  1ULY A;  5A8B A;  3MXS A;  3MGS B;  3SZT A;  4WU9 D;  4QLC C;  3B6F B;  4JPM A;  1P3B D;  1ONH A;  5DNN A;  5AV9 D;  2Z2L B;  1VEU A;  3UTB B;  3QNC A;  4PPR A;  3E98 A;  5KDM A;  2ZC5 B;  3UB7 A;  2C6W B;  1E25 A;  2HF6 A;  3IX4 A;  3AFA B;  4X68 A;  3A0V A;  3REI D;  1BZA A;  1M1A D;  5FAO A;  3HUN A;  5HWT A;  2O9C A;  3UPN A;  3SS3 A;  5B0Z C;  3B33 A;  3W2Z A;  3GVB A;  3MF0 A;  5FL3 A;  4P6Z M;  4R38 A;  4E3J A;  4XXR A;  1MWS A;  1PZR A;  4DKI A;  1PFL A;  2P9V B;  1ID3 B;  3PTE A;  3LEQ A;  1SCW A;  4UA7 A;  1P3O D;  5G4Y A;  3Q07 A;  1YU1 A;  4I3I A;  1IYS A;  4N1H A;  3VP3 A;  2XRO A;  3N3F A;  1PIO A;  1P3A B;  1M18 C;  1S4R A;  3L27 A;  2H5S A;  2PU4 A;  1W1V A;  1J3W A;  4GW9 A;  4LD9 C;  1TD5 A;  4CLC D;  2Q9N A;  5GT3 C;  5E5A D;  4DXC A;  2KLI A;  3V9R A;  3O5Y A;  5GXQ D;  3LCE A;  3GQZ A;  2H0Y A;  1A7W A;  4UA9 A;  4Z5T C;  1ZHH B;  5CGX A;  4K91 A;  3AZN C;  5AQ7 A;  3AYW D;  4J8W B;  4UHU A;  2L5A A;  4UUZ B;  3TW8 A;  5TFQ A;  2JKG A;  3LEL C;  2W0N A;  2F8N K;  1ALQ A;  4HEF A;  4IUH A;  3MFX A;  5AV5 B;  2R78 A;  5BNV B;  3P09 A;  1P3K D;  4YM6 D;  4JGP A;  4R8P B;  3KSI A;  4HHD A;  3UE1 A;  5CGS A;  3ZG7 B;  1N9O A;  5B1L D;  4DQY B;  3LI8 A;  3B47 A;  4S2N C;  1P3P B;  5AV8 C;  1E88 A;  3G31 A;  3KWQ C;  4BBU A;  3UE6 A;  1L0F A;  4R4S A;  3MGR B;  3LID A;  4I39 A;  4IBG A;  3V3R A;  2X02 A;  3E4P A;  4J8X D;  3VH5 A;  5DFX A;  1F66 B;  1H8P A;  3IX8 A;  4L0L A;  4GB7 A;  4BL3 A;  1KX4 B;  1W2E A;  3NDE A;  3ZCZ A;  3X1U D;  3UTA C;  3AZM D;  3N4I A;  1S32 B;  1LSV A;  1E6P A;  3DWZ A;  3CG5 A;  3O62 A;  2X01 A;  4BL2 A;  1W63 Q;  2J9P A;  5GLB A;  3A3J A;  1GA9 A;  3PBN A;  1LSX A;  4OVD A;  1JWV A;  2V1A A;  1OGB A;  2ZOH A;  3EOI A;  2V8F A;  3MZF A;  5FAQ A;  3AZI D;  4GNU A;  4FSF A;  3T4T A;  3WA9 A;  3MQL A;  2L1M A;  3LFV A;  1KGF A;  4DN0 A;  4X23 D;  2PYO B;  4S2L A;  3ZFZ A;  3HLG A;  4NXG A;  4O01 A;  1HLU P;  3X1V A;  2NQB B;  5L8M A;  3VV4 A;  3WAA B;  3MGS C;  2DF4 C;  1DJA A;  3DTI A;  3B6F C;  1J7M A;  2G5I C;  2ZC4 B;  4MB4 A;  5EEC A;  4GCZ A;  3UTB C;  4E3N A;  1N9N A;  1BH8 B;  3H0L C;  1P3M A;  3HJI A;  5DTK A;  4DJ3 A;  3VH5 W;  3G30 A;  4KG2 A;  4MN7 A;  4IUK A;  3AFA C;  3CUE C;  5B2J D;  2Y59 A;  1KX3 D;  4OOM A;  3IHB A;  1DJB A;  5CPI A;  1VET A;  5JRG A;  1JFI B;  4MB3 A;  4NYU A;  4X25 A;  3AV1 D;  4IBB A;  3UB9 A;  1HZO A;  2E8J A;  3PBS A;  5DF9 A;  3WTP C;  3H82 A;  5B0Y D;  5GT3 A;  3ZNY A;  4KZ8 A;  1TS7 A;  4EW7 A;  5B31 B;  2CV5 D;  2QJ7 A;  5EOE A;  3WS1 A;  1EQZ B;  3OLO A;  2HIO D;  5FQM A;  4BMW A;  1ID3 C;  4DE2 A;  5JA4 A;  5HWW A;  3R45 A;  1H0I A;  4UPK A;  4RA7 A;  4PM7 A;  3TU4 D;  5AVF A;  4I3J A;  1YPR A;  1P3A C;  2VGK A;  4KEN B;  4MDZ A;  4K0X A;  2M7U A;  4EER A;  4HOI A;  3NOU C;  1K4F A;  2Y2M A;  4H9N A;  1YLP A;  2W3G A;  3JVV A;  3LEL A;  4HP9 A;  4GD8 A;  2KX6 A;  3AZJ D;  1KE4 A;  2Y8H A;  4DDS A;  1OT9 A;  3K2N A;  1GOI A;  4B4X A;  3C4O A;  2Y2Q A;  3B6G B;  4RVA A;  1STZ A;  2Y91 A;  2VJW A;  3REK D;  4HH2 A;  4S2P A;  3W99 A;  3IQA A;  2EWW A;  5AY8 A;  1YLT A;  4OPQ A;  2HP9 A;  3ZG8 B;  3A6N B;  1VB6 A;  1SKO B;  5B24 B;  5AV5 C;  1NRF A;  4KZA A;  4KGC A;  3VFF A;  4CLC B;  2G2W A;  2EX9 A;  5E5A B;  1CQA A;  4S2M A;  1SKF A;  4M6B A;  3EPL A;  4R8P C;  5B32 D;  1AIW A;  5AQ9 A;  5DNN B;  2XFS A;  3AZL A;  1WYB A;  1VEU B;  1ZLA D;  5BS7 C;  4LLO B;  3UTA A;  1SDE A;  1P34 A;  5B31 G;  3OBF A;  1FIL A;  1P3P C;  2OLU A;  1Y54 A;  5KDM B;  5DVA A;  1D1J A;  4FCF A;  2V2F F;  4ZBE A;  1S4S A;  3MGR C;  4N1X A;  1K6R A;  3IF6 A;  3G4P A;  4KQR A;  1W5D A;  4OLG A;  4PM9 A;  1LSW A;  3HUO A;  4Y7P A;  4Z2M G;  1F66 C;  1YU4 A;  3L2A A;  1YMX A;  4Z66 D;  1EAK A;  3VSL A;  1M40 A;  1KX4 C;  1D7E A;  1S6R A;  3UPO A;  2LB5 A;  3KXB A;  5L07 A;  2ZOI A;  3MZD A;  2OAP 1;  1RP5 A;  1S32 C;  4UEY A;  4GOG A;  5CRF A;  5FDH A;  3W98 D;  4KZ7 A;  2ARO A;  3CI6 A;  4KZ9 A;  3B6F A;  3FDD A;  1YU0 A;  1T3U A;  1P3I A;  5GSU A;  2XDM A;  4KUD A;  3CLO A;  4X56 A;  3C8C A;  1FCO A;  1WYC A;  4HJ6 A;  3AZE A;  2VLG A;  1K0K A;  1MBL A;  1HTA A;  4WNN A;  5CXW A;  2QYB A;  4Z2I A;  1FOF A;  1Z6F A;  3O88 A;  3IP4 C;  1PI5 A;  5CEC A;  3V9R B;  2RTS A;  1YLW A;  2V1Z A;  1U35 D;  2WUQ A;  3BEC A;  1KS0 A;  4NY2 A;  3WAA C;  3NIA A;  2J8Y A;  3UPP A;  1PRQ A;  4ZUX D;  3WTP A;  1KX5 D;  1BSG A;  5AVC D;  4CSR A;  4X69 A;  5GL9 A;  3X1T D;  5AVB A;  4KG6 A;  3UN7 A;  4QNL A;  3AZI B;  4J8U D;  4MNR A;  1CJF A;  5F99 A;  3B3X A;  3AN2 A;  5TR7 A;  3W96 D;  2ZQC A;  3S4X A;  3BWL A;  4HBT A;  4IHQ A;  3REL D;  3VMA A;  3G32 A;  5EM0 A;  2G5H C;  2VQR A;  1YSP A;  2V20 A;  4OQI A;  5B31 C;  3L25 A;  4G92 B;  3QP2 A;  5FEG A;  5HPI A;  2WGV A;  4WEL A;  3UME A;  1EQZ C;  1OJ5 A;  3H0M C;  1NLZ A;  4IVK A;  4C3Q A;  5B1M A;  2CC1 A;  3D9Y A;  3ZGA B;  3MNN D;  4KZ5 A;  1W79 A;  1M1A C;  3ITB A;  2K31 A;  2G2U A;  2KOI A;  3VFH A;  4Y3I A;  3ZNT A;  4HH3 A;  2O0Y A;  2FFF B;  4UQI M;  4QY5 A;  1H3O A;  1R4V A;  3O62 B;  2ZLY A;  1NYM A;  4WBG A;  2WKE A;  5GT0 A;  2ZY2 A;  3B6G C;  3UO9 A;  3AZH A;  1AOI D;  2ZQD A;  5GLC A;  5CPJ D;  5BS7 A;  2HDS A;  5HL6 A;  4LEN A;  4NE6 A;  5CP6 D;  1GSX A;  5E2G A;  2J8P A;  3A6N C;  4KG5 A;  5HAR A;  2QHK A;  3WA9 B;  3MGR A;  5B24 C;  4NKP A;  5FQJ A;  5GHZ A;  3S22 A;  3C1B A;  3IXD A;  3LIA A;  4WU8 D;  4CLC C;  3AGE A;  3X1V B;  3E4O A;  5E5A C;  3IWI A;  4NG2 A;  3F6T A;  4GZB A;  4QJG A;  5JYO A;  2V5O A;  4U3T A;  2Y2O A;  5DNN C;  3T4K A;  3LO7 A;  1TF1 A;  1CXW A;  4R23 A;  4LV0 A;  5B40 A;  1P3M B;  4X1M A;  1G28 A;  4WMC D;  1MXO A;  1PDC A;  3AL0 C;  5FSR A;  2EX2 A;  2P74 A;  5EPH A;  5CPI B;  4WF0 A;  4U0T A;  1VET B;  5JRG B;  1V9Z A;  1YLJ A;  4J8V A;  1K54 A;  1ZC2 A;  3AZK A;  1E15 A;  4YM6 C;  4LPZ A;  2NZD D;  5JYP A;  3D72 A;  4E3L A;  3A1K A;  5GT3 B;  4Z2L A;  2ZY4 A;  1TS6 A;  4HQA A;  4YS3 A;  3Q7V B;  1HQ3 A;  3NJA A;  5CPK A;  2ZC6 B;  3G2Y A;  2EX6 A;  4IBF A;  1K55 A;  3W4O A;  5JA4 B;  5BPV A;  3TE8 A;  2IWB A;  2VA0 A;  5IU1 A;  5KMW A;  4OQG A;  5FDS A;  2WKQ A;  5A93 A;  3NOP C;  1L6J A;  4KQQ A;  4DRA A;  3NEC A;  4WJ3 C;  3Q82 A;  2Y2N A;  4H9N B;  3MVD A;  1K56 A;  2XLN A;  2OV5 A;  3WD3 A;  2H10 A;  3LIB A;  2ZQA A;  4EO5 B;  4HI4 A;  3UE3 A;  1XJ2 A;  4YNR A;  2A49 A;  4OKP A;  1YM1 A;  4KQO A;  2DRW A;  1G6A A;  2HUE B;  4WU9 A;  4E6W A;  1BH9 A;  1Z2C B;  3W99 B;  1P3B A;  4KZ6 A;  5AV9 A;  3FPV A;  4JXV A;  5AY8 B;  5IS1 A;  2GNX A;  1TDG A;  1LI0 A;  2XD5 A;  1W1T A;  1TZY D;  2JKR I;  1P0Z A;  3AZI C;  2EFU A;  3KO6 A;  4KGC B;  3E4Q A;  3Q7Z A;  5IT5 A;  4D2O A;  3X1S D;  3REI A;  3GR2 A;  1U60 A;  3LEZ A;  3LR5 A;  4IBR A;  5E2E A;  1M1A A;  1CK3 A;  2ZMF A;  5M19 A;  3AZL B;  3VH6 T;  5DTS A;  3AGD A;  2OAQ 1;  4YWZ A;  3C1C D;  1P34 B;  4G92 C;  3HRE A;  1KX5 B;  1I2S A;  2VV6 A;  1E6N A;  3C38 A;  5FAS A;  1OTA A;  3NY4 A;  2PD8 A;  4Z9Q A;  4LRY C;  3IF6 B;  4NZ5 A;  3MBZ A;  3LZ0 D;  1VM1 A;  3PBQ A;  1ONG A;  2ZM2 A;  1Z09 A;  3VP4 A;  3S7O A;  4J8U B;  5HFO A;  5FI6 A;  1XJ3 A;  1WWI A;  2F8N H;  1JNU A;  1KDW A;  5HSQ A;  2PAV P;  2W27 A;  3KUY D;  3W96 B;  3ITA A;  2JBF A;  1SKO A;  3AV2 D;  2WKH A;  3KXB B;  5CHM A;  3T12 B;  1G68 A;  4CLC A;  4X55 A;  3SH7 A;  5E5A A;  2ARO B;  3O62 C;  1HVB A;  4JXS A;  5GXQ A;  3NI9 A;  4E3I A;  2HDR A;  1P3I B;  5GSU B;  4KUD B;  3WD1 A;  4ZAM A;  1BLH A;  1F9I A;  1W1P A;  3AZE B;  1B67 A;  1K4E A;  2Y2G A;  4WNN B;  4WN5 A;  5AV6 D;  3AYW A;  2WGI A;  3WA9 C;  1ACF A;  4D60 A;  2Y2J A;  2XH9 A;  5D3O A;  1P3F D;  1KE0 A;  3Q1F A;  2WK0 A;  3DTE A;  4II7 A;  2YFW B;  3X1V C;  3W4Q A;  1OGG A;  1P3K A;  4XZQ D;  4YM6 A;  3RFB A;  5FUG A;  3JVU A;  3TG9 A;  3AZF D;  3WTP B;  3T4S A;  5HW3 A;  1P9R A;  5GLD A;  2NUP C;  4CSR B;  4IBI A;  4F94 A;  5B1L A;  5AVB B;  1B6W A;  3OPR A;  1P3M C;  1CF0 A;  4Q0I A;  3BY8 A;  3LYX A;  3G6O A;  2BYK A;  2RIQ A;  5F99 B;  2HZ5 A;  3C7U A;  2HJE A;  3LI9 A;  4ARZ B;  3SS5 A;  3AN2 B;  5CPI C;  1DP8 A;  5FI7 A;  2ZQ9 A;  5JRG C;  2M7V A;  3M2K A;  3MGP D;  1NZU A;  4JXG A;  4J8X A;  1YQS A;  4ETX A;  4ID4 A;  3KYZ A;  2XFT A;  5DFY A;  4DRT A;  5HDC A;  3F1O A;  3X1U A;  3WS5 A;  3LZ1 D;  3M2J A;  1XFQ A;  3R7W A;  3OC2 A;  3AZM A;  1Y28 A;  1KVL A;  1VQQ A;  3UB6 A;  3A3I A;  5CEB A;  5BT1 C;  1NYY A;  5B1M B;  4Z2G A;  3SH8 A; 
#chains in the Genus database with same CATH homology
 3VOZ A;  2EX8 A;  1I5Q A;  5B2I D;  3BFG A;  3AZI A;  4DXB A;  4PM8 A;  1GA0 A;  1H3O B;  4X23 A;  4KZ3 A;  4EO5 C;  2HDQ A;  4QY6 A;  5GT0 B;  4IED A;  3AZH B;  4ZJ1 A;  2HUE C;  5DNM D;  3W99 C;  3N7W A;  2BYM A;  5AY8 C;  5FQ9 A;  4ZJ3 A;  3M6B A;  3AZG D;  3C1B B;  1PYY A;  4KGC C;  4OJ6 A;  3NQJ A;  1ES5 A;  5B2J A;  1KX3 A;  2JE5 A;  1LI9 A;  4QB8 A;  3AZL C;  3AV1 A;  4XUJ D;  2WGW B;  1P34 C;  3MGQ D;  1BFM A;  5B40 B;  5B0Y A;  1KX5 C;  4EUZ A;  4GD6 A;  2CV5 A;  1E4D A;  5F82 A;  3IF6 C;  2PU2 A;  3EQV A;  2HIO A;  3RXW A;  1OME A;  4J8U C;  4J8V B;  3AZK B;  1ES3 A;  3X1S B;  3TU4 A;  4DE1 A;  3PBT A;  5E43 A;  1K25 A;  3MFD A;  3W96 C;  4WEK A;  5M1A A;  3IWO A;  1QME A;  3KXB C;  3O3V A;  1IEL A;  3WKJ D;  4IBE A;  4YS3 B;  3V3S A;  1HQ3 B;  3AZJ A;  5CPK B;  2ARO C;  1YLY A;  5BO0 A;  4IVI A;  1P3I C;  5GSU C;  4KUD C;  3W97 D;  3EQU A;  1HD8 A;  3GMW A;  2EXA A;  4ZBJ B;  3AZE C;  3REK A;  1KU5 A;  3MNN C;  4BQM A;  3MVD B;  1N4O A;  3HLE A;  4WM9 A;  1BLS A;  1W7F A;  4BD0 A;  3ZG0 A;  4LV1 A;  3B0C T;  1KDS A;  4WU9 B;  1BH9 B;  1P3B B;  5B32 A;  4JBF A;  3IXB A;  3QHY A;  3ISG A;  3REH D;  5AV9 B;  1WWS A;  4EWF A;  2RVQ C;  5AVB C;  5CPJ C;  1ZLA A;  1JTD A;  3Q7V A;  1N1J A;  3L29 A;  4G91 B;  4S2J A;  3BYD A;  5F99 C;  4OUI A;  1H5X A;  3AN2 C;  3REI B;  1M19 D;  3ZVW A;  1M1A B;  3SOI A;  3VP1 A;  4AWL B;  2Y55 A;  4Z66 A;  4QLC D;  2Y2L A;  3UT9 D;  4GKU A;  3FKE A;  2ZD8 A;  4DF6 A;  1RCJ A;  3W98 A;  4S2O A;  5B1M C;  1I2W A;  1P3O B;  1XKZ A;  3MGP B;  4ZTK A;  4OLD A;  2Z2M B;  5B0Z D;  4LG2 A;  1RGY A;  5IHV A;  2NZD C;  4P0M A;  1BLP A;  5GXQ B;  3WRT A;  5GT0 C;  3FYZ A;  1U35 A;  3AZH C;  4E3O A;  2H0T A;  2E8I A;  4N92 A;  3RJU A;  4ZUX A;  3HLB A;  3AYW B;  1KX5 A;  5AVC A;  1M18 D;  3OPP A;  3X1T A;  2XR0 A;  4Z2M H;  3C1B C;  5AQB A;  4GHL A;  4LD9 D;  5CGW A;  4MBH A;  4J8U A;  4Y0T A;  1NXY A;  4JLF A;  1P3K B;  4Q8I A;  4YM6 B;  5FUG B;  3HLW A;  3W96 A;  5TGF A;  3BRM A;  4FH4 A;  4OJP A;  3W8K A;  3REL A;  1ESI A;  3DTM A;  1L0G A;  4Z5T D;  4UAA A;  5B1L B;  1TAF A;  5B40 C;  3AZN D;  4R1G A;  1XGJ A;  2BYK B;  2JSS A;  4JF4 A;  4OQH A;  4ZDX A;  3VSK A;  2F8N D;  1PW8 A;  4OON A;  4BJP A;  4IJF A;  1K38 A;  5A91 A;  4J8V C;  1K54 C;  4WZS B;  4J8X B;  3MNN A;  3AZK C;  3X1S C;  4CJN A;  4E45 A;  4OQ0 A;  1KVM A;  4NK3 A;  2DQN C;  2BLS A;  3NCK A;  3X1U B;  4YS3 C;  1HQ3 C;  4LV3 A;  5CPK C;  3AZM B;  2YFW A;  1K55 C;  4BD1 A;  5AV8 D;  4KHA A;  3KWQ D;  2WYX A;  3SH9 A;  1IYP A;  1W8Q A;  1ES4 A;  3HLC A;  1AOI A;  4ZBJ C;  4OJL A;  5CPJ A;  3VOY A;  3MVD C;  5CP6 A;  3N8S A;  4H9P A;  1E3U D;  1YU3 A;  1HTZ A;  2BG1 A;  4X23 B;  5EVI D;  2XQZ A;  4WU8 A;  4H9R A;  1JWP A;  4EV4 A;  3UY6 A;  4WU9 C;  4PM6 A;  5GHY A;  1P3B C;  5AV9 C;  2BYM B;  2EFX A;  1JWZ A;  1ZG6 A;  3G2Z A;  4G91 C;  3HLF A;  4WMC A;  3NQJ B;  3IXH A;  4IBX A;  4YIN A;  5B2J B;  3REI C;  1KX3 B;  4PMA A;  3EPJ A;  4AWL C;  2UWX A;  3OCL A;  3AV1 B;  1O07 A;  4EBN A;  2ZM5 A;  3MGS D;  4XZQ C;  2NZD A;  5B0Y B;  3REH B;  2Q9M A;  3UTB D;  2HPB A;  4XUZ A;  2CV5 B;  3BFD A;  4YFM A;  3HL9 A;  3BM6 A;  3NQU A;  2HIO B;  3AFA D;  1P3O C;  1ESU A;  4EBP A;  5HL1 A;  3E2K A;  5M18 A;  3TU4 B;  5BNX B;  4H9S A;  3MGP C;  4R4R A;  3BLM A;  4B4Z A;  3AZJ B;  5G18 A;  4KZ4 A;  4C75 A;  3UT9 B;  3PBR A;  2B5R A;  5BO0 B;  5GXQ C;  4H9Q B;  1KGE A;  3HON A;  3IWQ A;  3UDX A;  1ID3 D;  4OPR A;  2WGW A;  3REK B;  5FI2 A;  4MBF A;  3HLD A;  3AYW C;  4HBU A;  1P3A D;  5B2I C;  4FD8 A;  2RL3 A;  4P6B A;  1P3L D;  3LJA D;  5CTM A;  1RGZ A;  3G35 A;  3HVF A;  1P3K C;  1SHV A;  3X1S A;  4GN2 A;  3BFC A;  3DWK A;  2WAE A;  5B32 B;  3B0C W;  4NYY A;  5B1L C;  3KFU G;  1DY6 A;  1ZLA B;  4E3M A;  3C1C A;  3UDI A;  1N1J B;  2ZC3 B;  2J7V A;  4J8W D;  4OJO A;  4NZ4 A;  5B33 D;  2GDN A;  1EWZ A;  5AV5 D;  2QZ6 A;  4E6X A;  3LZ0 A;  4J8X C;  3VP2 A;  1LLB A;  4Z66 B;  4R8P D;  3KUY A;  5CED A;  3UE0 A;  3AV2 A;  3X1U C;  5BOH A;  3AZM C;  3IH9 A;  1P3P D;  3L28 A;  3W98 B;  3WS0 A;  5J8X A;  3VH5 T;  3M6H A;  1XPB A;  3ZDJ A;  1F66 D;  5EE8 A;  1KX4 D;  2J9O A;  5AV6 A;  5FAP A;  1FR6 A;  4X23 C;  4QD4 A;  1P3F A;  1NY0 A;  4K0W A;  4JJN D;  1S32 D;  3QNB A;  3UDF A;  1U35 B;  5CTN A;  3EPK A;  5B32 G;  3GSG A;  4XZQ A;  1QMF A;  3WTP E;  4ZUX B;  3AZF A;  4GH9 A;  5AVC B;  1BUL A;  4RYE A;  3X1T B;  1P3G D;  2DNS A;  1P3O A;  5B2J C;  3L26 A;  2PYO D;  1KX3 C;  1FSY A;  4HGA B;  3REJ D;  5EVI B;  3MGP A;  2NQB D;  3AV1 C;  3REL B;  3WAA D;  2HP5 A;  1XX2 A;  1TAF B;  1CEG A;  2XGN A;  5B0Y C;  2XD1 A;  3REH C;  2CV5 C;  3LZ1 A;  2QPN A;  4LCL A;  4P85 A;  5KSC A;  2HIO C;  2XK1 A;  3LY4 A;  3CJM A;  1GHI A;  2W8S A;  3MNN B;  5DF7 A;  3TU4 C;  4CPK A;  2XEP A;  4FH2 A;  3B0B A;  3O86 A;  3EPH A;  3HBR A;  5B2I A;  2RCX A;  5A90 A;  1BUE A;  3AZJ C;  3TOI A;  4JF5 A;  3NBL A;  4KHA B;  3UT9 C;  5B31 D;  2R9X A;  2IWD A;  2OSU A;  2QMI A;  3A3F A;  1EQZ D;  1DJC A;  1XA1 A;  1AOI B;  4IJE A;  3PBO A;  4DDY A;  3FKW A;  3REK C;  3IF5 A;  5CPJ B;  5DNM A;  2PBY A;  3WRZ A;  5CP6 B;  4H9P B;  2WAF A;  5GLA A;  4WZ5 A;  3AZG A;  2FJ7 D;  4WU8 B;  4OPY A;  1KE3 A;  4H9R B;  2Y2I A;  3FKV A;  5CHU A;  2ZY3 A;  5B32 C;  1FCN A;  1IYQ A;  3B6G D;  1FR1 A;  3VP0 A;  4XUJ A;  1ZLA C;  1MWT A;  2Y2P A;  2ZC7 A;  4IBK A;  3MGQ A;  5CHJ A;  4NET A;  5CER A;  3A6N D;  5G49 A;  5B24 D;  4QU3 A;  3EG5 B;  1P3L B;  3LJA B;  3I7J A;  4Z66 C;  5KSH A;  3LY3 A;  4RX2 A;  2NZD B;  5DNN D;  4UA6 A;  3C7V A;  3WKJ A;  3WX7 A;  3IH8 A;  3MXR A;  3OZH A;  3NQU B;  3W98 C;  3MZE A;  4R3B A;  4OPZ A;  3TSG A;  5B33 B;  2YFV B;  1NJ4 A;  5F83 A;  3N6I A;  3W97 A;  2IOU A;  3BFE A;  1K57 A;  1YU2 A;  1Q2P A;  1IKI A;  1PZP A;  1LL5 A;  1U35 C;  1ERM A;  2X71 A;  4S2K A;  2Y2H A;  4ZUX C;  1FCM A;  3ZG9 B;  3REH A;  5AVC C;  4OH0 A;  5EVL A;  3X1T C;  5HX9 A;  1ES2 A;  1TZY B;  4NZ1 A;  5HAP A;  1SDN A;  1Q2Q A;  4HGA C;  1M19 A;  5EVI C;  5BNX A;  4JJN B;  2ZQ8 A;  3REL C;  3WS4 A;  5FA7 A;  1GHP A;  2JCH A;  4QLC A;  3C1C B;  1M6K A;  2OLV A;  4LCM A;  2JC7 A;  3UT9 A;  3VH6 A;  4H9Q A;  4CAY A;  1ERQ A;  4RX3 A;  1P3G B;  4KZB A;  3LZ0 B;  1F1E A;  4WV4 B;  3REJ B;  2R9W A;  3MKF A;  4E44 A;  3KUY B;  1MWU A;  2IWC A;  4H9O A;  3DW0 A;  3AV2 B;  4OP5 A;  5B0Z A;  4X6T A;  1YUE A;  1TDL A;  4QHC A;  3N8L A;  1AOI C;  1BTL A;  3BEB A;  1GHM A;  5CP6 C;  1BLC A;  4WZ4 A;  1CI9 A;  4HES A;  5AV6 B;  4A5R A;  2WAD A;  1M18 A;  3N8R A;  1P3F B;  5DTT A;  1W8Y A;  3C4P A;  4WU8 C;  4OP8 A;  5HAQ A;  4LD9 A;  3O87 A;  3BFF A;  3D4F A;  4JXW A;  3O62 D;  1PI4 A;  4XZQ B;  4BLM A;  2HDU A;  5FQK A;  2XF3 A;  3AZF B;  3VH6 W;  5FAT A;  4Z5T A;  1K6S A;  3AZN A;  1PWD A;  3WA9 D;  2ZY5 A;  3IT9 A;  4IBD A;  3HSH A;  2F8N A;  1WE4 A;  4NE5 A;  4NE3 A;  1P3L C;  3LJA C;  2FJ7 B;  3X1V D;  3H0R C;  3IXG A;  4WEJ A;  2CWE A;  2ZM0 A;  1PZO A;  3LZ1 B;  4S2N A;  1P3M D;  3Q81 A;  5F1G A;  1NZO A;  2C5W B;  1YT4 A;  5AV8 A;  3KWQ A;  4J8W C;  5B33 C;  5CPI D;  5JRG D;  4H9S C;  3OPL A;  3GRJ A;  5B2I B;  4X53 A;  4OOY A;  1E3U A;  5GT3 D;  3CMZ A;  5GHX A;  4H8R A;  5EVI A;  5BT1 D;  1AXB A;  3FV7 A;  4E3K A;  1TEM A;  5DNM B;  2ZQ7 A;  3P98 A;  1XGI A;  1BT5 A;  3GV9 A;  4GDB A;  5L2F A;  4PM5 A;  4R0Q A;  4U0X A;  1LHY A;  3LEL D;  5FQQ A;  1J9M A;  3AZG B;  4LV2 A;  1TZY C;  3G34 A;  1S0W A;  4XUX A;  4JJN C;  5HAI A;  3WWX A;  3P5J B;  4XUJ B;  3MGS A;  2IO5 B;  3C1C C;  3W99 D;  1MWR A;  1PW1 A;  3MGQ B;  5C3I B;  4GHA A;  3V5M A;  3V50 A;  5AY8 D;  1CEF A;  1GCE A;  3UTB A;  4Y0O A;  3KS4 A;  5G49 B;  3NC8 A;  3NDG A;  1P3G C;  5A92 A;  3LZ0 C;  4KGC D;  1N9B A;  3HUM A;  1MKI A;  3AFA A;  2PYO C;  3REJ C;  3B0D B;  3PAG A;  3KUY C;  3AZL D;  2NQB C;  1XA7 A;  3AV2 C;  3WKJ B;  3UTA D;  1P34 D;  1ERO A;  4WYY A;  3E2L A;  5I94 A;  2F2A C;  2P9V A;  3W97 B;  4R3J A;  5E2H A;  1ID3 A;  2I72 A;  2A3U A;  1PWC A;  3IHA A;  5AV6 C;  4C6Y A;  2WZZ A;  5DF8 A;  1P3A A;  1TVF A;  1O7E A;  3UNW A;  3KXB D;  1P3F C;  1MPL A;  5F1F A;  3W4P A;  1JTG A;  1P3L A;  3LJA A;  2ARO D;  4JKT A;  3B6F D;  1EI5 A;  1P3I D;  2LY8 A;  3AZF C;  5GSU D;  4KUD D;  3AZE D;  4IBC A;  1JVJ A;  5EUA A;  3ZHH A;  4J8W A;  4O7D A;  4IBJ A;  5B33 A;  2YFV A;  4UUZ A;  1M19 B;  2FJ7 C;  5AV5 A;  1L0D A;  5BNV A;  2VGJ A;  1IYO A;  4QLC B;  4R8P A;  3WTP D;  3GTC A;  5CHL B;  3V39 A;  1C3B A;  3MKE A;  2RVQ D;  5AVB D;  3LZ1 C;  4CAY B;  1L2S A;  3FWL A;  1P3P A;  4MBK A;  5F99 D;  4P87 A;  3KS8 A;  5FQI A;  2ZM8 A;  3AN2 D;  1XXM A;  5U47 A;  4H9O B;  1F66 A;  3A3D A;  5B0Z B;  1TZY A;  1KX4 A;  3A3E A;  3RXX A;  4MEZ A;  2WZX A;  5KZH A;  4Y0U A;  2Y2K A;  4JJN A;  1S32 A;  4OOL A;  5B1M D;  5DNM C;  4EBL A;  1ZKJ A;  1M18 B;  3PAE A;  4WZ5 C;  3AZG C;  1P3G A;  1ZG4 A;  3ZVT A;  3WS2 A;  4LD9 B;  4DE0 A;  2PYO A;  3REJ A;  4JF6 A;  5GT0 D;  3OCN A;  3AZH D;  1MY8 A;  3OPH A;  2NQB A;  1H8Y A;  3WAA A;  4XUJ C;  3FZC A;  2IO5 C;  3R45 B;  4Z5T B;  3MGQ C;  5C3I C;  3AZN B;  4OJ5 A;  4DRB A;  3MGR D;  4NZ3 A;  1BH8 A;  4EQI A;  4GDN A;  2F8N B;  1YMS A;  3LEL B;  3C1B D;  5AQA A;  2WKI A;  1XP4 A;  3C5A A;  4M3K A;  4NFT A;  3B0D C;  2Y4A A;  1PWG A;  1JFI A;  3BLS A;  4DE3 A;  3ZG5 A;  1H8Z A;  3WKJ C;  2HP6 A;  5B40 D;  1IKG A;  3SS4 A;  4BEN A;  5AV8 B;  3KWQ B;  5B31 A;  2EXB A;  4S2I A;  3W97 C;  1EQZ A;  3CZD A;  1FQG A;  4J8V D;  1KGG A;  3AZK D;  1K57 C;  4N9L A;  2ZMA A;  5EOO A;  1IEM A;  3S1Y A;  2DCF A;  4YS3 D;  1L0E A;  1HQ3 D;  4N9K A;  5CPK D;  2FJ7 A;  3UTA B;  2ZJ9 A;  3JYI A;  4ZJ2 A;  1YLZ A;  3AGF A;  3B6G A;  1FSW A;  4MLL A;  1CI8 A;  1LL9 A;  1K56 D;  3MVD D;  1Q9C A;  2FFY A;  4B88 A;  2F8N G;  3A6N A;  3KSY A;  5B24 A;  3A1I A;  5E2F A;  1M19 C;  1ULY A;  3MXS A;  3MGS B;  4WU9 D;  4QLC C;  3B6F B;  4JPM A;  1P3B D;  1ONH A;  5DNN A;  5AV9 D;  2Z2L B;  3UTB B;  3QNC A;  4PPR A;  5KDM A;  2ZC5 B;  2C6W B;  1E25 A;  3AFA B;  4X68 A;  3REI D;  1BZA A;  1M1A D;  5FAO A;  3HUN A;  3UPN A;  3SS3 A;  5B0Z C;  3GVB A;  4E3J A;  4XXR A;  1MWS A;  1PZR A;  4DKI A;  2P9V B;  1ID3 B;  3PTE A;  1SCW A;  4UA7 A;  1P3O D;  3Q07 A;  1YU1 A;  1IYS A;  4N1H A;  3VP3 A;  3N3F A;  1PIO A;  1P3A B;  1M18 C;  3L27 A;  2H5S A;  2PU4 A;  4LD9 C;  2Q9N A;  5GT3 C;  5E5A D;  4DXC A;  3V9R A;  5GXQ D;  3LCE A;  3GQZ A;  2H0Y A;  1A7W A;  4UA9 A;  4Z5T C;  5CGX A;  4K91 A;  3AZN C;  5AQ7 A;  3AYW D;  4J8W B;  4UHU A;  2L5A A;  4UUZ B;  5TFQ A;  3LEL C;  2F8N K;  1ALQ A;  4HEF A;  5AV5 B;  5BNV B;  3P09 A;  1P3K D;  4YM6 D;  4R8P B;  3UE1 A;  5CGS A;  3ZG7 B;  5B1L D;  4DQY B;  4S2N C;  1P3P B;  5AV8 C;  3G31 A;  3KWQ C;  1L0F A;  4R4S A;  3MGR B;  4IBG A;  3V3R A;  2X02 A;  4J8X D;  3VH5 A;  1F66 B;  4L0L A;  4GB7 A;  4BL3 A;  1KX4 B;  1W2E A;  3NDE A;  3ZCZ A;  3X1U D;  3UTA C;  3AZM D;  3N4I A;  1S32 B;  3DWZ A;  3CG5 A;  3O62 A;  2X01 A;  4BL2 A;  2J9P A;  5GLB A;  3A3J A;  1GA9 A;  3PBN A;  4OVD A;  1JWV A;  3MZF A;  5FAQ A;  3AZI D;  4GNU A;  4FSF A;  3WA9 A;  1KGF A;  4X23 D;  2PYO B;  4S2L A;  3ZFZ A;  3HLG A;  3X1V A;  2NQB B;  3WAA B;  3MGS C;  2DF4 C;  1DJA A;  3B6F C;  2G5I C;  2ZC4 B;  5EEC A;  3UTB C;  4E3N A;  1BH8 B;  3H0L C;  1P3M A;  5DTK A;  3VH5 W;  3G30 A;  4KG2 A;  3AFA C;  5B2J D;  2Y59 A;  1KX3 D;  4OOM A;  3IHB A;  1DJB A;  5CPI A;  5JRG A;  1JFI B;  4NYU A;  3AV1 D;  4IBB A;  1HZO A;  3PBS A;  5DF9 A;  3WTP C;  5B0Y D;  5GT3 A;  3ZNY A;  4KZ8 A;  5B31 B;  2CV5 D;  5EOE A;  3WS1 A;  1EQZ B;  2HIO D;  5FQM A;  4DE2 A;  1ID3 C;  5JA4 A;  3R45 A;  4UPK A;  4RA7 A;  4PM7 A;  3TU4 D;  1P3A C;  2VGK A;  4KEN B;  4K0X A;  1K4F A;  2Y2M A;  4H9N A;  1YLP A;  3LEL A;  4GD8 A;  3AZJ D;  1KE4 A;  4DDS A;  4B4X A;  3C4O A;  2Y2Q A;  3B6G B;  4RVA A;  2Y91 A;  3REK D;  4S2P A;  3W99 A;  3IQA A;  5AY8 A;  1YLT A;  4OPQ A;  2HP9 A;  3ZG8 B;  3A6N B;  5B24 B;  5AV5 C;  1NRF A;  4KZA A;  4KGC A;  3VFF A;  2G2W A;  2EX9 A;  5E5A B;  4S2M A;  1SKF A;  4M6B A;  3EPL A;  4R8P C;  5B32 D;  5AQ9 A;  5DNN B;  2XFS A;  3AZL A;  1WYB A;  1ZLA D;  5BS7 C;  3UTA A;  1SDE A;  1P34 A;  5B31 G;  1P3P C;  2OLU A;  1Y54 A;  5KDM B;  5DVA A;  4FCF A;  2V2F F;  4ZBE A;  3MGR C;  4N1X A;  1K6R A;  3IF6 A;  3G4P A;  4KQR A;  1W5D A;  4OLG A;  4PM9 A;  3HUO A;  4Y7P A;  4Z2M G;  1F66 C;  1YU4 A;  3L2A A;  1YMX A;  4Z66 D;  3VSL A;  1M40 A;  1KX4 C;  1S6R A;  3UPO A;  3KXB A;  3MZD A;  1RP5 A;  1S32 C;  4GOG A;  5CRF A;  5FDH A;  3W98 D;  4KZ7 A;  2ARO A;  4KZ9 A;  3B6F A;  3FDD A;  1YU0 A;  1T3U A;  1P3I A;  5GSU A;  2XDM A;  4KUD A;  4X56 A;  1FCO A;  1WYC A;  3AZE A;  1MBL A;  1HTA A;  4WNN A;  5CXW A;  1FOF A;  1Z6F A;  3O88 A;  3IP4 C;  1PI5 A;  5CEC A;  3V9R B;  2V1Z A;  1YLW A;  1U35 D;  2WUQ A;  3BEC A;  4NY2 A;  3WAA C;  3NIA A;  2J8Y A;  3UPP A;  4ZUX D;  3WTP A;  1KX5 D;  1BSG A;  5AVC D;  4CSR A;  4X69 A;  5GL9 A;  3X1T D;  5AVB A;  4KG6 A;  3UN7 A;  4QNL A;  3AZI B;  4J8U D;  4MNR A;  3B3X A;  5F99 A;  3AN2 A;  5TR7 A;  3W96 D;  2ZQC A;  3S4X A;  4HBT A;  3REL D;  3VMA A;  3G32 A;  2G5H C;  2VQR A;  2V20 A;  4OQI A;  5B31 C;  3L25 A;  4G92 B;  2WGV A;  4WEL A;  1EQZ C;  3H0M C;  4IVK A;  4C3Q A;  5B1M A;  2CC1 A;  3ZGA B;  3MNN D;  4KZ5 A;  1W79 A;  1M1A C;  3ITB A;  2G2U A;  3VFH A;  3ZNT A;  2FFF B;  4QY5 A;  1H3O A;  1R4V A;  3O62 B;  2ZLY A;  1NYM A;  4WBG A;  2WKE A;  5GT0 A;  2ZY2 A;  3B6G C;  3UO9 A;  3AZH A;  1AOI D;  2ZQD A;  5GLC A;  5CPJ D;  5BS7 A;  2HDS A;  4LEN A;  4NE6 A;  5CP6 D;  5E2G A;  2J8P A;  3A6N C;  4KG5 A;  5HAR A;  3WA9 B;  3MGR A;  5B24 C;  5FQJ A;  5GHZ A;  3S22 A;  3C1B A;  3IXD A;  4WU8 D;  3AGE A;  3X1V B;  3IWI A;  5E5A C;  3F6T A;  4GZB A;  4QJG A;  5JYO A;  4U3T A;  2Y2O A;  5DNN C;  3LO7 A;  4R23 A;  4LV0 A;  5B40 A;  1P3M B;  4WMC D;  1MXO A;  3AL0 C;  5FSR A;  2EX2 A;  2P74 A;  5EPH A;  5CPI B;  4U0T A;  5JRG B;  1YLJ A;  4J8V A;  1K54 A;  1ZC2 A;  3AZK A;  4YM6 C;  2NZD D;  5JYP A;  4E3L A;  3A1K A;  5GT3 B;  2ZY4 A;  4YS3 A;  3Q7V B;  1HQ3 A;  5CPK A;  2ZC6 B;  3G2Y A;  2EX6 A;  4IBF A;  1K55 A;  3W4O A;  5JA4 B;  5BPV A;  2IWB A;  5KMW A;  4OQG A;  5A93 A;  4KQQ A;  4DRA A;  4WJ3 C;  3Q82 A;  2Y2N A;  4H9N B;  3MVD A;  1K56 A;  2XLN A;  2OV5 A;  2H10 A;  2ZQA A;  4EO5 B;  3UE3 A;  2A49 A;  4OKP A;  1YM1 A;  4KQO A;  2DRW A;  1G6A A;  2HUE B;  4WU9 A;  4E6W A;  1BH9 A;  1Z2C B;  3W99 B;  1P3B A;  4KZ6 A;  5AV9 A;  4JXV A;  5AY8 B;  1TDG A;  1LI0 A;  2XD5 A;  1TZY D;  3AZI C;  2EFU A;  4KGC B;  3Q7Z A;  4D2O A;  3X1S D;  3GR2 A;  3REI A;  1U60 A;  3LEZ A;  4IBR A;  5E2E A;  1M1A A;  1CK3 A;  5M19 A;  3AZL B;  3VH6 T;  5DTS A;  3AGD A;  3C1C D;  1P34 B;  4G92 C;  3HRE A;  1KX5 B;  1I2S A;  5FAS A;  4Z9Q A;  3NY4 A;  3IF6 B;  4NZ5 A;  3MBZ A;  3LZ0 D;  1VM1 A;  3PBQ A;  1ONG A;  2ZM2 A;  3VP4 A;  4J8U B;  5HFO A;  5FI6 A;  1WWI A;  2F8N H;  1KDW A;  3KUY D;  3W96 B;  3ITA A;  2JBF A;  3AV2 D;  2WKH A;  3KXB B;  5CHM A;  1G68 A;  4X55 A;  3SH7 A;  5E5A A;  2ARO B;  3O62 C;  1HVB A;  4JXS A;  5GXQ A;  3NI9 A;  4E3I A;  2HDR A;  1P3I B;  5GSU B;  4KUD B;  4ZAM A;  1BLH A;  3AZE B;  1B67 A;  1K4E A;  2Y2G A;  4WNN B;  5AV6 D;  3AYW A;  2WGI A;  3WA9 C;  2Y2J A;  2XH9 A;  5D3O A;  1P3F D;  1KE0 A;  3Q1F A;  2WK0 A;  2YFW B;  3X1V C;  3W4Q A;  1P3K A;  4XZQ D;  4YM6 A;  5FUG A;  3TG9 A;  3AZF D;  3WTP B;  5HW3 A;  5GLD A;  4CSR B;  4IBI A;  4F94 A;  5B1L A;  5AVB B;  1B6W A;  3OPR A;  1P3M C;  2BYK A;  2RIQ A;  5F99 B;  3C7U A;  3SS5 A;  3AN2 B;  5CPI C;  5FI7 A;  2ZQ9 A;  5JRG C;  3M2K A;  3MGP D;  1NZU A;  4JXG A;  4J8X A;  1YQS A;  4ID4 A;  2XFT A;  4DRT A;  3X1U A;  3WS5 A;  3LZ1 D;  3M2J A;  3OC2 A;  3AZM A;  1KVL A;  1VQQ A;  5CEB A;  3A3I A;  5BT1 C;  1NYY A;  5B1M B;  3SH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...