4IBGA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibgA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibgA02
5BPVA 3L26A 4GHAA 3L25A 4LG2A 3KS8A 3L27A 4IBGA 4IBJA 4IBIA 4IBEA 4GHLA 4IJFA 3FKEA 3KS4A 3L29A 4IBBA 4GH9A 4IBKA 4IBCA 4IBDA 4IBFA 3L28A 4IJEA 3L2AA
chains in the Genus database with same CATH superfamily
3GLHE 5FTMA 2JY6B 4FCTA 1G3IA 1OAOC 2LTUA 3MHVC 4GEWA 2QBYB 2WSCF 1Z5CA 3WD2A 1IY0A 3AV0A 4G4OA 1SG9A 1IFYA 1F4IA 2M60A 4AZFA 2CUZA 4EIWA 2Y20A 1GO5A 1GJSA 1V34A 4D80A 5JI2E 4NZ4A 1VEKA 3SASA 4FCVA 3D8LA 2DAEA 5ITUA 4X64M 1H0IA 2K9DA 2O01F 3LQQA 2R4JA 4LJAA 1E6ZA 3VFDA 3EIEA 1QAOA 2UUAM 1OTRA 5EXPA 4KLNA 2Y2KA 2QSFX 2AHMA 3TL4X 4Z2KA 2P5TA 3VLFB 4QOZC 4LF7M 4GKKM 4CIZA 3FUWA 3WHLA 1NVMA 2X8AA 1YUEA 4BB9A 2Y0TA 3HGIA 4DUYM 2CE7A 3L2AA 4MGZE 4WW0A 4Z8XA 3U6MA 1GPFA 1R7RA 4OJOA 4AQYM 3OTOM 4NZ5A 2FS1A 2QCUA 1PJIA 2DAGA 2DI0A 2BG1A 2Z8YM 2Y21A 2FOIC 3UGJA 3EIHA 1YE9A 1E9SA 4Q7JA 3TWLA 4DR3M 2LHCA 4LJ9A 1IQPA 4PT5A 4FWDA 2CV0A 3VKGA 1EAKA 3U6QA 3M7PA 3GLIB 5FTNA 5EJCA 2CFOA 3T38A 5KQDA 3AKZA 4ITQA 4GH9A 4NL4H 3FD9A 2V5OA 2F5NA 2YFQA 3DFZA 1HQYE 3UK6A 3JAMS 1N75A 3H4JA 1HJPA 3LCUA 3HJSA 1R5LA 3HX3A 3KDSE 4NXNM 3ZC7B 2EKKA 4GITA 3FUXA 2HL7A 2RGOA 1N77A 7CATA 2C96A 2OOAA 4QNMA 2KRUA 4L8RC 4Z2HA 1UR8A 3FTFA 3FYCA 1GLNA 4X65M 3L25A 2C98A 2F4VM 5F3WA 3UMMA 2VQFM 4JI2M 2QBYA 1Z59A 4I4LA 3B9PA 2DVWB 2DZLA 2GNOA 3CF6E 4R3DA 1E6PA 3KW6A 1KS0A 3GLFB 3SYLA 3T1HM 3MK6A 1DGHB 2Z7JA 2L7HA 3U5ZB 2RTSA 4ANRA 1UM8A 2FFJA 4F2LA 5EXSA 2Z4SA 3LW5F 5KPRA 1JQJC 1YU2A 3DOAA 1IBMM 3WX7A 3GPUA 1L1ZA 2J7OA 3HU2A 4KO8A 2WSEF 4PCZA 2HCBA 3L26A 3WD0A 2JZ0A 4LCBA 3TWMA 4L4UA 5DYIA 3E4RA 2XZUA 3LMMA 4B3MM 3E21A 1QDRA 5EP3A 5JI3E 4X62M 1O6IA 2Z3XA 4LF9M 1DGBA 2QQ8A 3B74A 5DYGA 1T3TA 4HLQA 3GRYA 3H4MA 2XLJA 2XH9A 5FTJA 3I51A 2VQEM 2ERCA 4I81A 1C7YA 4DV1M 1QZMA 1QQWA 3BBZA 1WXQA 2QHOB 4HL4A 1UFZA 4L16A 2R65A 4HMEA 1ZMWA 2JWSA 2L4FA 3GLIA 1HNXM 3B89A 2D49A 3I4YA 3GRVA 1QZEA 1K3WA 2ZAMA 3SHFA 4NYYA 4QHSA 5FLXS 2BJWA 2CRUA 2Y2GA 5ITQA 2UXBM 5IREB 4LFAM 4OJLA 4D81A 3GQ5A 3LVWA 2XFTA 4AKIA 1QO6A 2XSZA 3U6PA 3J2PB 3T6PA 4CJ6A 2BJVA 1Z5AA 3C3DA 3D8BA 3B7NA 1Z6TA 4B7GA 2C9OA 4JI4M 2BWEA 1D0MA 4M0WA 4IBEA 4G4QA 4FD2A 1JB0F 3KS4A 3U6SA 1H6UA 2CP8A 1ZQ9A 5C1BA 4LZJA 2LWXA 1IN7A 1MJGM 1QUSA 1YLAA 2ZTCA 3AOGA 8CATA 3GLFA 3WD3A 2ZANA 1L2BA 3QAUA 1AIWA 1DGHA 3KOXE 2XZFA 3C3EA 1KYIA 3ILKA 2O5RA 5EP2A 3U5ZA 1XMOM 1TDZA 2I7PA 3K8ZA 2YR0A 3K1JA 4PDIA 1E8BA 1PJQA 1T6OA 4MB5A 3HSHA 2HWJA 1E15A 4LJ7A 1AIPC 4K0KM 2R18A 4LZZA 3W67A 2MROB 4REZA 2VF7A 4NRWA 1XHBA 2UUCM 2CWBA 3SC3A 3HZJA 4KODA 4M9SA 1K82A 5KQ8A 2HHHM 3L27A 4IBJA 3T15A 3R8FA 2EO2A 4OU7A 1FJGM 5EXTA 3CTWB 4LRTA 3GO8A 2JY8A 3SFZA 1JR3A 1MN3A 1MX0A 4JI3M 2L2DA 4LFBM 1SXJC 4JI1M 4NY2A 4UN2B 4IBFA 2LH0A 2G8LA 4NSRA 4LJ6A 4B08A 3W68A 4FVMA 4FW9A 3BXWA 2DXIA 3QWLA 4Y28F 3VDUA 1G4AE 2I7NA 3SARA 1Q3BA 3I04M 3PFIA 1W5TA 1J7MA 1TGUA 2JP7A 4JN6A 4GRIA 4WP2A 1NNJA 4OX9M 2ZTDA 1MU5A 1Y8GA 3I01M 4OW0A 3TQSA 2C99A 3U6LA 2DNAA 5H37D 4OJ6A 3RFWA 3TPZA 3GRRA 4GIPA 2CEAA 4MM3B 1GKIA 2Y2NA 3PVSA 3LQRA 2F5PA 3AJIB 3U6CA 3J80S 3U6DA 1NY5A 2Y0QA 2KHHA 1TH2A 3RE8A 1TDHA 4WURA 3CGWA 4W5WA 5E6JA 5ITTA 5ITXA 4M9ZA 3W0LB 2Y2OA 2LBCA 2H1RA 2Y2MA 5EP1A 1WHCA 3Q8GA 1PRBA 4MGHA 4PDGA 4TX8A 2L09A 3A45A 3KP0E 1OKSA 5C18A 3GLIE 1OAIA 5BR8M 1HT2E 1J7KA 2Q2EB 3SYKA 2LVOC 2WSFF 3AFHA 1ZAEA 4DR7M 2KNVA 4M0DA 3N3FA 1ORYB 2KW0A 2RGHA 1SXJB 4MGIE 4OJPA 3GLGB 1XXHB 4II7A 3B7QA 4DUZM 1QVRA 2XD5A 4LG2A 3HONA 1D2NA 4B3SM 1OGGA 2V1CA 3KOWE 2DWLA 2HAKA 3GPPA 2O25A 1NHGC 3CF0A 2K6BA 3L29A 3KOZE 2FE8A 1GXDA 1GOIA 4DV2M 2LVAA 4NSOB 4GC9A 3GLHA 2LVNC 1CK7A 3GLFE 3CF2A 3FYDA 3HY5A 2UU9M 1IXZA 3FTCA 1GL6A 3HKPA 4PD2A 3J7AS 2Y2PA 3ZCBB 1W1TA 2KRKA 2ZM6M 5DNYA 1EFUB 1WJ7A 4Z2GA 4AG5A 4RF1A 4MGYE 1PM5A 4CISA 2CHVA 1G59A 4RF0A 3KP1E 4I8OA 1XWIA 3W0FA 4GC5A 2DWNA 4LGMA 2N35A 4MB3A 3AOEC 1T43A 3K2LA 2X4AA 4D82A 2JXNA 1DGFA 3IG8A 3K9OA 3KVWA 1VQ1A 3QYBA 2DAKA 5IWAM 2XSZD 4FWGA 1YUBA 2ZBKB 1WR1B 1OGBA 2Y2QA 2R4EA 1N32M 1YU0A 2D7HA 2J7NA 2RRUA 1JR3E 2CHGA 4IBDA 4X66M 4KT0F 1KSFX 3SBJA 2QP9X 4P16A 3A98B 4QOSA 1PDCA 1DGGA 1QUTA 1QYRA 4NZ3A 3B7ZA 3BOSA 2IOUA 1TF0B 1CXWA 1J09A 2DHYA 3E46A 1PJJA 3J81S 4LFCM 4JXJA 4TUWA 1PGYA 1OFHA 2QENA 4P17A 2QPAA 4B3TM 2Y2LA 4R71A 1OJLA 3GPYA 5LMNM 4XBOA 4JV5M 2YQZA 3RGPA 4AKGA 2UWXA 1YSYA 2Z4RA 5FSWA 2Y2IA 1D0KA 1N34M 2DENA 1SXJA 1VDDA 4LGYA 2VF8A 3C9PA 2KZUA 1L6JA 4IIWA 1XXHA 3GLGA 4LJ5A 2D7GA 4I5SA 2BWBA 2B3TA 2APLA 2VIIA 4F1IA 3GQ3A 4DV7M 1I94M 1QAMA 4YY3M 1IY1A 3HHYA 4JI0M 1L1TA 4JI8M 3KFUG 1DV0A 4IJEA 2KNZA 2R45A 1G8PA 1JR3D 2JUJA 3HWSA 3NBXX 5KO3A 2M5ZA 1TTEA 4AI6A 3U61A 1E88A 3HJQA 1C1KA 1L2DA 2EJSA 2JA2A 2DZOB 4OVZB 1GABA 1NY6A 4M9XA 1AUAA 1IBKM 1L8QA 2UXDM 3HHZA 2G5GX 1FNNA 1S3SA 3LCVB 1PJTA 2XD1A 5EXXA 4B7FA 3HHXA 3I4VA 1P3QQ 2WZJA 4G6ZA 1DO0A 1NV8A 2MGWA 3KXEC 4IBGA 5KPZA 3J7BA 1V33A 2JY7A 3HJ8A 1TR8A 3GLHB 1G41A 2EUCA 5DFLA 1R4GA 3U60B 2DHRA 1J5EM 1W1VA 4IBKA 1QAQA 1GL7A 1NJFA 1ZV1A 2OOBA 3AL0C 2JNHA 4Z2IA 3FRIA 4XGIA 5FTLA 4Z2JA 2X49A 1XB2B 4NC6A 4DV6M 1QDTA 1ZMVA 4GKJM 1PJSA 1RU3A 1WGNA 2EA0A 2FFFB 1IBLM 4DV5M 5BPVA 4Z2LA 2G3QA 3C58A 1VG5A 3F92A 4NXMM 2HKJA 4LF8M 4DV0M 1LV7A 3PNYA 2J5YA 4L78A 4NOOB 4LF5M 3SMPA 1TH4A 2R62A 1Q39A 4LJ4A 2XGNA 4FCWA 5IZ7D 2C9CA 3FUUA 2ZAOA 1NHWC 3THGA 2DWMA 4MB7A 2YNMD 2R46A 3SATA 1YU3A 4IJFA 1E9RA 2MH8A 1HT1E 4GMQA 2F5QA 3FTEA 1A5TA 4B7HA 2CV1A 1VEJA 1CUKA 3HU1A 1IN4A 2VDBB 3HHWA 1E32A 2L4EA 4XK8F 3T1YM 1NV9A 4DR4M 1N33M 5EQTA 2OPFA 4CHTB 3DA1A 3M0EA 2XF3A 3FTDA 1W5SA 3K92A 4LY6A 3LVVA 5ITRA 1QANA 3PXGA 2F5SA 2DWZB 2DZNB 2MR9A 2QNJA 3JR4A 3AOEA 3HU3A 4RNAA 1GVNA 1VEGA 1N36M 4GHAA 4MGKE 4LJ8A 2QZ4A 4R7GA 4DR6M 3TE6A 3FUVA 5KPTA 3KOYE 4OVZA 3VK7A 3E9SA 1OIPA 3NBIA 4CGYB 1H0GA 4HMCA 3ZQJA 1SXJE 3SHGB 4DR5M 3WD4A 1KFVA 2LXEA 4NYUA 5A2QS 3R9XB 3GLGE 1XXHE 4IBCA 4LRSA 2K0BX 1IN8A 3U61B 1LTMA 2UUBM 3FRHA 2V1UA 2V6ZM 2KZSA 4BLCA 2UXCM 1EE8A 3U6EA 1EIJA 3U60A 4NRVA 1WGLA 4KHPM 2R0IA 3J27B 3PNVA 4AKHA 2Y2JA 2JZ1A 5GKNA 4RKUF 4QNRA 3UJNA 1R6BX 4G4NA 2GQFA 3IHPA 4QNLA 2R6FA 1OIZA 3KSXA 3WD1A 5ITYA 3MMPA 4HMDA 1G71A 4MH0E 1NNUC 3IG5A 3A46A 3SAUA 4L15A 1HR0M 2E5LM 2Y2HA 3ZH9B 3SAWA 2C5RA 3GPXA 4JI5M 1D0LA 1IXSB 2LHGA 2FH0A 2R44A 2EKFA 2LVQD 4YHHM 3KS8A 4G4RA 4GHLA 1W1PA 2OO9A 3FKEA 4A3VB 4JYAM 1OFIA 3QYEA 4LF4M 3K9PA 1Q02A 3MQLA 3V76A 1XNQM 1SXJD 2D7EA 2JCHA 2NQ8C 1NO1A 3L28A 3U6OA 2KA6B 4LF6M 5LMUM 4B3RM 4AW4A 1Z5BA 3DZDA 3NWLA 1ED7A 1UR9A 1GJTA 2DKLA 1H8PA 3UZUA 4AG6A 1N78A 1K3XA 1IN5A 3TWKA 3SMSA 4S12A 1HNWM 1YU1A 3VDPA 4NZ1A 2JY5A 3A42A 2L6OA 4DV4M 3FE3A 4G3OA 2FNAA 3M6AA 4HEOA 4IBIA 2MJ5B 2OQ4A 4JI6M 5IT9S 1E94E 2DAMA 1DO2A 1WIVA 1YU4A 5L8RF 5EP4A 5FTKA 3RGSA 2K47A 4BBAA 4QHTA 1TH3A 2XFSA 5ITXE 3GP1A 4DR1M 3MJ5A 4Z6YA 1V92A 3VK8A 2KEBA 2KXEA 4MB4A 1ZMUA 1W1YA 4OUIA 4OJ5A 1XNRM 1E6NA 1E6RA 4DBGB 4DV3M 2CHQA 2LVPC 3GRUA 3VKHA 1BVSA 5E26A 1IY2A 4FWHA 1XC8A 1IN6A 2XEPA 1XMQM 2RKOA 2CV2A 1HNZM 2H5XA 1VDLA 1OQYA 2KDLA 2BNKA 1R2ZA 2JE5A 2FN2A 2DAIA 1Q3CA 1L2CA 1NSFA 4L6V6 2A5YB 1IXRC 4IBBA 4DR2M 2L7IA 1IM2A 3JR5A 2LNHC 3KSJA 3Q8XA 1IXSA 3WHKA 2F5OA 1I4WA 4JI7M 3GQ4A 1X37A 3IECA 3M7GA 3SAVA 1R2YA 3FUTA 1HQCA 2W82A 2KNAA 1NJGA 4ZPXA
chains in the Genus database with same CATH topology
5FTMA 4FCTA 1G3IA 3MHVC 2QBYB 1Z5CA 1IY0A 3AV0A 4G4OA 2M60A 4AZFA 2CUZA 4EIWA 2Y20A 4D80A 5JI2E 4NZ4A 3SASA 4FCVA 3D8LA 5ITUA 4X64M 3LQQA 2R4JA 4LJAA 3VFDA 3EIEA 1QAOA 2UUAM 5EXPA 2Y2KA 4KLNA 3TL4X 2AHMA 2P5TA 3VLFB 4QOZC 4LF7M 4GKKM 3FUWA 3WHLA 1NVMA 2X8AA 1YUEA 4BB9A 2Y0TA 3HGIA 4DUYM 2CE7A 3L2AA 4MGZE 4WW0A 4Z8XA 3U6MA 4OJOA 1R7RA 4AQYM 3OTOM 4NZ5A 2QCUA 1PJIA 2BG1A 2Y21A 2FOIC 3UGJA 3EIHA 1YE9A 1E9SA 3TWLA 4DR3M 4LJ9A 1IQPA 4PT5A 4FWDA 2CV0A 3VKGA 3U6QA 3GLIB 5FTNA 5EJCA 2CFOA 3T38A 5KQDA 3AKZA 4ITQA 4GH9A 4NL4H 3FD9A 2F5NA 2YFQA 3DFZA 1HQYE 3UK6A 3JAMS 1N75A 3HJSA 3ZC7B 3KDSE 4NXNM 4GITA 3FUXA 2HL7A 2RGOA 1N77A 7CATA 2C96A 4QNMA 4L8RC 2KRUA 3FTFA 3FYCA 1GLNA 4X65M 3L25A 2C98A 2F4VM 5F3WA 3UMMA 2VQFM 4JI2M 2QBYA 1Z59A 4I4LA 3B9PA 2DVWB 3CF6E 4R3DA 3KW6A 3GLFB 3SYLA 3T1HM 3MK6A 1DGHB 2Z7JA 2L7HA 3U5ZB 1UM8A 2FFJA 5EXSA 2Z4SA 5KPRA 1JQJC 1YU2A 3DOAA 1IBMM 3WX7A 3GPUA 1L1ZA 2J7OA 3HU2A 4KO8A 4PCZA 2HCBA 3L26A 4LCBA 3TWMA 4L4UA 5DYIA 3E4RA 2XZUA 3LMMA 4B3MM 5EP3A 5JI3E 4X62M 2Z3XA 4LF9M 1DGBA 5DYGA 1T3TA 4HLQA 3GRYA 3H4MA 2XLJA 2XH9A 5FTJA 3I51A 2VQEM 2ERCA 4I81A 4DV1M 1QZMA 1QQWA 1WXQA 4L16A 4HL4A 2R65A 1HNXM 3GLIA 3I4YA 3GRVA 1K3WA 2ZAMA 3SHFA 4NYYA 4QHSA 5FLXS 2BJWA 2Y2GA 5ITQA 2UXBM 5IREB 4LFAM 4OJLA 4D81A 3GQ5A 3LVWA 2XFTA 4AKIA 2XSZA 3U6PA 3J2PB 2BJVA 1Z5AA 3D8BA 1Z6TA 4B7GA 2C9OA 4JI4M 4M0WA 4IBEA 4G4QA 4FD2A 3U6SA 3KS4A 1H6UA 1ZQ9A 5C1BA 4LZJA 2LWXA 1IN7A 3AOGA 3GLFA 8CATA 2ZANA 1L2BA 3QAUA 1DGHA 3KOXE 2XZFA 3ILKA 1KYIA 3U5ZA 2O5RA 5EP2A 1XMOM 1TDZA 2I7PA 3K8ZA 2YR0A 3K1JA 4PDIA 3HSHA 4LJ7A 4K0KM 2R18A 4LZZA 4REZA 4NRWA 1XHBA 2UUCM 1K82A 3SC3A 4KODA 4M9SA 2Y2NA 5KQ8A 2HHHM 3L27A 4IBJA 3T15A 3R8FA 2EO2A 4OU7A 1FJGM 5EXTA 3CTWB 4LRTA 3GO8A 3SFZA 1JR3A 4JI3M 1MX0A 4NY2A 4LFBM 1SXJC 4JI1M 4IBFA 2LH0A 2G8LA 4NSRA 4LJ6A 4B08A 4FVMA 4FW9A 2DXIA 3QWLA 3VDUA 3SARA 1G4AE 2I7NA 1Q3BA 3PFIA 1W5TA 1TGUA 4JN6A 4GRIA 4OX9M 1NNJA 4OW0A 1MU5A 3TQSA 2C99A 3U6LA 5H37D 4OJ6A 3RFWA 3TPZA 3GRRA 4GIPA 2CEAA 4MM3B 1GKIA 3PVSA 3LQRA 2F5PA 3AJIB 3U6CA 3J80S 3U6DA 1NY5A 2Y0QA 1TH2A 3RE8A 1TDHA 4WURA 4W5WA 5E6JA 5ITTA 5ITXA 4M9ZA 3W0LB 2Y2OA 2H1RA 2Y2MA 5EP1A 4PDGA 4MGHA 2L09A 3A45A 3KP0E 5C18A 5BR8M 1HT2E 1J7KA 2Q2EB 3SYKA 3AFHA 4DR7M 2Y2HA 1ZAEA 3N3FA 4M0DA 1ORYB 2KW0A 2RGHA 1SXJB 4MGIE 4OJPA 3GLGB 1XXHB 4II7A 4DUZM 1QVRA 2XD5A 4LG2A 3HONA 1D2NA 4B3SM 2V1CA 3KOWE 2DWLA 3GPPA 1NHGC 3CF0A 3L29A 3KOZE 2FE8A 4DV2M 4NSOB 4GC9A 3GLHA 3CF2A 3FYDA 2UU9M 1IXZA 3FTCA 1GL6A 3HKPA 4PD2A 3J7AS 2Y2PA 3ZCBB 2KRKA 2ZM6M 5DNYA 4AG5A 4RF1A 4MGYE 1PM5A 4CISA 2CHVA 1G59A 4RF0A 3KP1E 4I8OA 1XWIA 3W0FA 4GC5A 2DWNA 4LGMA 3AOEC 3K2LA 2X4AA 4D82A 3KVWA 1DGFA 3IG8A 5IWAM 2XSZD 4FWGA 1YUBA 2ZBKB 2Y2QA 2R4EA 1N32M 1YU0A 2D7HA 2J7NA 4IBDA 2CHGA 4X66M 1KSFX 3SBJA 2QP9X 4P16A 3A98B 4QOSA 1DGGA 4NZ3A 1QYRA 3BOSA 2IOUA 1J09A 1PJJA 3J81S 4LFCM 4JXJA 4TUWA 1OFHA 2QENA 4B3TM 2QPAA 2Y2LA 1OJLA 3GPYA 5LMNM 4XBOA 4JV5M 2YQZA 3RGPA 4AKGA 2UWXA 1YSYA 2Z4RA 5FSWA 2Y2IA 1N34M 1SXJA 1VDDA 4LGYA 2KZUA 4IIWA 1XXHA 3GLGA 4LJ5A 2D7GA 4I5SA 2VIIA 4DV7M 1I94M 3GQ3A 1QAMA 4YY3M 1IY1A 3HHYA 4JI0M 1L1TA 4JI8M 3KFUG 4IJEA 2R45A 1G8PA 1JR3D 3HWSA 4AI6A 5KO3A 2M5ZA 3U61A 3HJQA 1C1KA 1L2DA 2JA2A 2DZOB 4OVZB 1NY6A 4M9XA 1IBKM 1L8QA 2UXDM 3HHZA 2G5GX 1FNNA 1S3SA 2XD1A 5EXXA 4B7FA 3HHXA 3I4VA 4G6ZA 1DO0A 4IBGA 3KXEC 5KPZA 3J7BA 3HJ8A 3GLHB 1G41A 2EUCA 3U60B 1J5EM 2DHRA 4IBKA 1QAQA 1GL7A 1NJFA 3AL0C 4XGIA 5FTLA 2X49A 4DV6M 4GKJM 2FFFB 2EA0A 1IBLM 4DV5M 5BPVA 3C58A 4NXMM 2HKJA 4LF8M 4DV0M 1LV7A 3PNYA 4L78A 4LF5M 4NOOB 3SMPA 1TH4A 2R62A 1Q39A 4LJ4A 2XGNA 4FCWA 5IZ7D 2C9CA 3FUUA 2ZAOA 1NHWC 3THGA 2DWMA 4MB7A 2YNMD 2R46A 3SATA 1YU3A 4IJFA 1E9RA 4GMQA 1HT1E 2F5QA 3FTEA 4B7HA 2CV1A 3HU1A 1IN4A 3HHWA 1E32A 3T1YM 4DR4M 1N33M 5EQTA 2OPFA 4CHTB 3DA1A 3M0EA 2XF3A 3FTDA 1W5SA 3K92A 4LY6A 3LVVA 5ITRA 1QANA 3PXGA 2F5SA 2DWZB 2DZNB 3JR4A 3AOEA 3HU3A 4RNAA 1GVNA 4GHAA 1N36M 4MGKE 4LJ8A 2QZ4A 4R7GA 4DR6M 3TE6A 3FUVA 5KPTA 3KOYE 4OVZA 3VK7A 3E9SA 3NBIA 4CGYB 1SXJE 3SHGB 4DR5M 1KFVA 2LXEA 4NYUA 5A2QS 3R9XB 4IBCA 4LRSA 1IN8A 3U61B 2UUBM 2V1UA 2V6ZM 2KZSA 4BLCA 2UXCM 1EE8A 3U6EA 3U60A 4NRVA 4KHPM 3J27B 3PNVA 4AKHA 2Y2JA 5GKNA 3UJNA 4QNRA 4G4NA 1R6BX 4QNLA 3KSXA 5ITYA 4MH0E 3A46A 1NNUC 3IG5A 3SAUA 2E5LM 4L15A 1HR0M 3ZH9B 3SAWA 2C5RA 3GPXA 4JI5M 4YHHM 1IXSB 3KS8A 4GHLA 4G4RA 3FKEA 4A3VB 4JYAM 1OFIA 4LF4M 1XNQM 1SXJD 2D7EA 2JCHA 2NQ8C 3L28A 3U6OA 2KA6B 4LF6M 5LMUM 4B3RM 4AW4A 1Z5BA 3DZDA 3NWLA 3UZUA 4AG6A 1N78A 1K3XA 1IN5A 3TWKA 3SMSA 4S12A 1HNWM 1YU1A 3VDPA 4NZ1A 3A42A 2L6OA 4DV4M 4IBIA 2FNAA 3M6AA 2OQ4A 4JI6M 5IT9S 1E94E 1DO2A 1YU4A 5EP4A 5FTKA 3RGSA 2K47A 4BBAA 4QHTA 1TH3A 2XFSA 5ITXE 3GP1A 4DR1M 3MJ5A 4Z6YA 3VK8A 2KEBA 2KXEA 4OUIA 4OJ5A 1XNRM 4DV3M 2CHQA 3GRUA 3VKHA 5E26A 1IY2A 4FWHA 1XC8A 1IN6A 2XEPA 1XMQM 2RKOA 2CV2A 1HNZM 2BNKA 1R2ZA 2JE5A 1L2CA 1Q3CA 1NSFA 2A5YB 1IXRC 4IBBA 4DR2M 2L7IA 1IM2A 3JR5A 2LNHC 3KSJA 3Q8XA 3WHKA 2F5OA 4JI7M 1I4WA 3GQ4A 1X37A 3SAVA 3M7GA 1R2YA 3FUTA 1HQCA 2W82A 1NJGA 4ZPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPV A;  3L26 A;  4GHA A;  3L25 A;  4LG2 A;  3KS8 A;  3L27 A;  4IBG A;  4IBJ A;  4IBI A;  4IBE A;  4GHL A;  4IJF A;  3FKE A;  3KS4 A;  3L29 A;  4IBB A;  4GH9 A;  4IBK A;  4IBC A;  4IBD A;  4IBF A;  3L28 A;  4IJE A;  3L2A A; 
#chains in the Genus database with same CATH topology
 3GLH E;  5FTM A;  2JY6 B;  4FCT A;  1G3I A;  1OAO C;  2LTU A;  3MHV C;  4GEW A;  2QBY B;  2WSC F;  1Z5C A;  3WD2 A;  1IY0 A;  3AV0 A;  4G4O A;  1SG9 A;  1IFY A;  1F4I A;  2M60 A;  4AZF A;  2CUZ A;  4EIW A;  2Y20 A;  1GO5 A;  1GJS A;  1V34 A;  4D80 A;  5JI2 E;  4NZ4 A;  1VEK A;  3SAS A;  4FCV A;  3D8L A;  2DAE A;  5ITU A;  4X64 M;  1H0I A;  2K9D A;  2O01 F;  3LQQ A;  2R4J A;  4LJA A;  1E6Z A;  3VFD A;  3EIE A;  1QAO A;  2UUA M;  1OTR A;  5EXP A;  4KLN A;  2Y2K A;  2QSF X;  2AHM A;  3TL4 X;  4Z2K A;  2P5T A;  3VLF B;  4QOZ C;  4LF7 M;  4GKK M;  4CIZ A;  3FUW A;  3WHL A;  1NVM A;  2X8A A;  1YUE A;  4BB9 A;  2Y0T A;  3HGI A;  4DUY M;  2CE7 A;  3L2A A;  4MGZ E;  4WW0 A;  4Z8X A;  3U6M A;  1GPF A;  1R7R A;  4OJO A;  4AQY M;  3OTO M;  4NZ5 A;  2FS1 A;  2QCU A;  1PJI A;  2DAG A;  2DI0 A;  2BG1 A;  2Z8Y M;  2Y21 A;  2FOI C;  3UGJ A;  3EIH A;  1YE9 A;  1E9S A;  4Q7J A;  3TWL A;  4DR3 M;  2LHC A;  4LJ9 A;  1IQP A;  4PT5 A;  4FWD A;  2CV0 A;  3VKG A;  1EAK A;  3U6Q A;  3M7P A;  3GLI B;  5FTN A;  5EJC A;  2CFO A;  3T38 A;  5KQD A;  3AKZ A;  4ITQ A;  4GH9 A;  4NL4 H;  3FD9 A;  2V5O A;  2F5N A;  2YFQ A;  3DFZ A;  1HQY E;  3UK6 A;  3JAM S;  1N75 A;  3H4J A;  1HJP A;  3LCU A;  3HJS A;  1R5L A;  3HX3 A;  3KDS E;  4NXN M;  3ZC7 B;  2EKK A;  4GIT A;  3FUX A;  2HL7 A;  2RGO A;  1N77 A;  7CAT A;  2C96 A;  2OOA A;  4QNM A;  2KRU A;  4L8R C;  4Z2H A;  1UR8 A;  3FTF A;  3FYC A;  1GLN A;  4X65 M;  3L25 A;  2C98 A;  2F4V M;  5F3W A;  3UMM A;  2VQF M;  4JI2 M;  2QBY A;  1Z59 A;  4I4L A;  3B9P A;  2DVW B;  2DZL A;  2GNO A;  3CF6 E;  4R3D A;  1E6P A;  3KW6 A;  1KS0 A;  3GLF B;  3SYL A;  3T1H M;  3MK6 A;  1DGH B;  2Z7J A;  2L7H A;  3U5Z B;  2RTS A;  4ANR A;  1UM8 A;  2FFJ A;  4F2L A;  5EXS A;  2Z4S A;  3LW5 F;  5KPR A;  1JQJ C;  1YU2 A;  3DOA A;  1IBM M;  3WX7 A;  3GPU A;  1L1Z A;  2J7O A;  3HU2 A;  4KO8 A;  2WSE F;  4PCZ A;  2HCB A;  3L26 A;  3WD0 A;  2JZ0 A;  4LCB A;  3TWM A;  4L4U A;  5DYI A;  3E4R A;  2XZU A;  3LMM A;  4B3M M;  3E21 A;  1QDR A;  5EP3 A;  5JI3 E;  4X62 M;  1O6I A;  2Z3X A;  4LF9 M;  1DGB A;  2QQ8 A;  3B74 A;  5DYG A;  1T3T A;  4HLQ A;  3GRY A;  3H4M A;  2XLJ A;  2XH9 A;  5FTJ A;  3I51 A;  2VQE M;  2ERC A;  4I81 A;  1C7Y A;  4DV1 M;  1QZM A;  1QQW A;  3BBZ A;  1WXQ A;  2QHO B;  4HL4 A;  1UFZ A;  4L16 A;  2R65 A;  4HME A;  1ZMW A;  2JWS A;  2L4F A;  3GLI A;  1HNX M;  3B89 A;  2D49 A;  3I4Y A;  3GRV A;  1QZE A;  1K3W A;  2ZAM A;  3SHF A;  4NYY A;  4QHS A;  5FLX S;  2BJW A;  2CRU A;  2Y2G A;  5ITQ A;  2UXB M;  5IRE B;  4LFA M;  4OJL A;  4D81 A;  3GQ5 A;  3LVW A;  2XFT A;  4AKI A;  1QO6 A;  2XSZ A;  3U6P A;  3J2P B;  3T6P A;  4CJ6 A;  2BJV A;  1Z5A A;  3C3D A;  3D8B A;  3B7N A;  1Z6T A;  4B7G A;  2C9O A;  4JI4 M;  2BWE A;  1D0M A;  4M0W A;  4IBE A;  4G4Q A;  4FD2 A;  1JB0 F;  3KS4 A;  3U6S A;  1H6U A;  2CP8 A;  1ZQ9 A;  5C1B A;  4LZJ A;  2LWX A;  1IN7 A;  1MJG M;  1QUS A;  1YLA A;  2ZTC A;  3AOG A;  8CAT A;  3GLF A;  3WD3 A;  2ZAN A;  1L2B A;  3QAU A;  1AIW A;  1DGH A;  3KOX E;  2XZF A;  3C3E A;  1KYI A;  3ILK A;  2O5R A;  5EP2 A;  3U5Z A;  1XMO M;  1TDZ A;  2I7P A;  3K8Z A;  2YR0 A;  3K1J A;  4PDI A;  1E8B A;  1PJQ A;  1T6O A;  4MB5 A;  3HSH A;  2HWJ A;  1E15 A;  4LJ7 A;  1AIP C;  4K0K M;  2R18 A;  4LZZ A;  3W67 A;  2MRO B;  4REZ A;  2VF7 A;  4NRW A;  1XHB A;  2UUC M;  2CWB A;  3SC3 A;  3HZJ A;  4KOD A;  4M9S A;  1K82 A;  5KQ8 A;  2HHH M;  3L27 A;  4IBJ A;  3T15 A;  3R8F A;  2EO2 A;  4OU7 A;  1FJG M;  5EXT A;  3CTW B;  4LRT A;  3GO8 A;  2JY8 A;  3SFZ A;  1JR3 A;  1MN3 A;  1MX0 A;  4JI3 M;  2L2D A;  4LFB M;  1SXJ C;  4JI1 M;  4NY2 A;  4UN2 B;  4IBF A;  2LH0 A;  2G8L A;  4NSR A;  4LJ6 A;  4B08 A;  3W68 A;  4FVM A;  4FW9 A;  3BXW A;  2DXI A;  3QWL A;  4Y28 F;  3VDU A;  1G4A E;  2I7N A;  3SAR A;  1Q3B A;  3I04 M;  3PFI A;  1W5T A;  1J7M A;  1TGU A;  2JP7 A;  4JN6 A;  4GRI A;  4WP2 A;  1NNJ A;  4OX9 M;  2ZTD A;  1MU5 A;  1Y8G A;  3I01 M;  4OW0 A;  3TQS A;  2C99 A;  3U6L A;  2DNA A;  5H37 D;  4OJ6 A;  3RFW A;  3TPZ A;  3GRR A;  4GIP A;  2CEA A;  4MM3 B;  1GKI A;  2Y2N A;  3PVS A;  3LQR A;  2F5P A;  3AJI B;  3U6C A;  3J80 S;  3U6D A;  1NY5 A;  2Y0Q A;  2KHH A;  1TH2 A;  3RE8 A;  1TDH A;  4WUR A;  3CGW A;  4W5W A;  5E6J A;  5ITT A;  5ITX A;  4M9Z A;  3W0L B;  2Y2O A;  2LBC A;  2H1R A;  2Y2M A;  5EP1 A;  1WHC A;  3Q8G A;  1PRB A;  4MGH A;  4PDG A;  4TX8 A;  2L09 A;  3A45 A;  3KP0 E;  1OKS A;  5C18 A;  3GLI E;  1OAI A;  5BR8 M;  1HT2 E;  1J7K A;  2Q2E B;  3SYK A;  2LVO C;  2WSF F;  3AFH A;  1ZAE A;  4DR7 M;  2KNV A;  4M0D A;  3N3F A;  1ORY B;  2KW0 A;  2RGH A;  1SXJ B;  4MGI E;  4OJP A;  3GLG B;  1XXH B;  4II7 A;  3B7Q A;  4DUZ M;  1QVR A;  2XD5 A;  4LG2 A;  3HON A;  1D2N A;  4B3S M;  1OGG A;  2V1C A;  3KOW E;  2DWL A;  2HAK A;  3GPP A;  2O25 A;  1NHG C;  3CF0 A;  2K6B A;  3L29 A;  3KOZ E;  2FE8 A;  1GXD A;  1GOI A;  4DV2 M;  2LVA A;  4NSO B;  4GC9 A;  3GLH A;  2LVN C;  1CK7 A;  3GLF E;  3CF2 A;  3FYD A;  3HY5 A;  2UU9 M;  1IXZ A;  3FTC A;  1GL6 A;  3HKP A;  4PD2 A;  3J7A S;  2Y2P A;  3ZCB B;  1W1T A;  2KRK A;  2ZM6 M;  5DNY A;  1EFU B;  1WJ7 A;  4Z2G A;  4AG5 A;  4RF1 A;  4MGY E;  1PM5 A;  4CIS A;  2CHV A;  1G59 A;  4RF0 A;  3KP1 E;  4I8O A;  1XWI A;  3W0F A;  4GC5 A;  2DWN A;  4LGM A;  2N35 A;  4MB3 A;  3AOE C;  1T43 A;  3K2L A;  2X4A A;  4D82 A;  2JXN A;  1DGF A;  3IG8 A;  3K9O A;  3KVW A;  1VQ1 A;  3QYB A;  2DAK A;  5IWA M;  2XSZ D;  4FWG A;  1YUB A;  2ZBK B;  1WR1 B;  1OGB A;  2Y2Q A;  2R4E A;  1N32 M;  1YU0 A;  2D7H A;  2J7N A;  2RRU A;  1JR3 E;  2CHG A;  4IBD A;  4X66 M;  4KT0 F;  1KSF X;  3SBJ A;  2QP9 X;  4P16 A;  3A98 B;  4QOS A;  1PDC A;  1DGG A;  1QUT A;  1QYR A;  4NZ3 A;  3B7Z A;  3BOS A;  2IOU A;  1TF0 B;  1CXW A;  1J09 A;  2DHY A;  3E46 A;  1PJJ A;  3J81 S;  4LFC M;  4JXJ A;  4TUW A;  1PGY A;  1OFH A;  2QEN A;  4P17 A;  2QPA A;  4B3T M;  2Y2L A;  4R71 A;  1OJL A;  3GPY A;  5LMN M;  4XBO A;  4JV5 M;  2YQZ A;  3RGP A;  4AKG A;  2UWX A;  1YSY A;  2Z4R A;  5FSW A;  2Y2I A;  1D0K A;  1N34 M;  2DEN A;  1SXJ A;  1VDD A;  4LGY A;  2VF8 A;  3C9P A;  2KZU A;  1L6J A;  4IIW A;  1XXH A;  3GLG A;  4LJ5 A;  2D7G A;  4I5S A;  2BWB A;  2B3T A;  2APL A;  2VII A;  4F1I A;  3GQ3 A;  4DV7 M;  1I94 M;  1QAM A;  4YY3 M;  1IY1 A;  3HHY A;  4JI0 M;  1L1T A;  4JI8 M;  3KFU G;  1DV0 A;  4IJE A;  2KNZ A;  2R45 A;  1G8P A;  1JR3 D;  2JUJ A;  3HWS A;  3NBX X;  5KO3 A;  2M5Z A;  1TTE A;  4AI6 A;  3U61 A;  1E88 A;  3HJQ A;  1C1K A;  1L2D A;  2EJS A;  2JA2 A;  2DZO B;  4OVZ B;  1GAB A;  1NY6 A;  4M9X A;  1AUA A;  1IBK M;  1L8Q A;  2UXD M;  3HHZ A;  2G5G X;  1FNN A;  1S3S A;  3LCV B;  1PJT A;  2XD1 A;  5EXX A;  4B7F A;  3HHX A;  3I4V A;  1P3Q Q;  2WZJ A;  4G6Z A;  1DO0 A;  1NV8 A;  2MGW A;  3KXE C;  4IBG A;  5KPZ A;  3J7B A;  1V33 A;  2JY7 A;  3HJ8 A;  1TR8 A;  3GLH B;  1G41 A;  2EUC A;  5DFL A;  1R4G A;  3U60 B;  2DHR A;  1J5E M;  1W1V A;  4IBK A;  1QAQ A;  1GL7 A;  1NJF A;  1ZV1 A;  2OOB A;  3AL0 C;  2JNH A;  4Z2I A;  3FRI A;  4XGI A;  5FTL A;  4Z2J A;  2X49 A;  1XB2 B;  4NC6 A;  4DV6 M;  1QDT A;  1ZMV A;  4GKJ M;  1PJS A;  1RU3 A;  1WGN A;  2EA0 A;  2FFF B;  1IBL M;  4DV5 M;  5BPV A;  4Z2L A;  2G3Q A;  3C58 A;  1VG5 A;  3F92 A;  4NXM M;  2HKJ A;  4LF8 M;  4DV0 M;  1LV7 A;  3PNY A;  2J5Y A;  4L78 A;  4NOO B;  4LF5 M;  3SMP A;  1TH4 A;  2R62 A;  1Q39 A;  4LJ4 A;  2XGN A;  4FCW A;  5IZ7 D;  2C9C A;  3FUU A;  2ZAO A;  1NHW C;  3THG A;  2DWM A;  4MB7 A;  2YNM D;  2R46 A;  3SAT A;  1YU3 A;  4IJF A;  1E9R A;  2MH8 A;  1HT1 E;  4GMQ A;  2F5Q A;  3FTE A;  1A5T A;  4B7H A;  2CV1 A;  1VEJ A;  1CUK A;  3HU1 A;  1IN4 A;  2VDB B;  3HHW A;  1E32 A;  2L4E A;  4XK8 F;  3T1Y M;  1NV9 A;  4DR4 M;  1N33 M;  5EQT A;  2OPF A;  4CHT B;  3DA1 A;  3M0E A;  2XF3 A;  3FTD A;  1W5S A;  3K92 A;  4LY6 A;  3LVV A;  5ITR A;  1QAN A;  3PXG A;  2F5S A;  2DWZ B;  2DZN B;  2MR9 A;  2QNJ A;  3JR4 A;  3AOE A;  3HU3 A;  4RNA A;  1GVN A;  1VEG A;  1N36 M;  4GHA A;  4MGK E;  4LJ8 A;  2QZ4 A;  4R7G A;  4DR6 M;  3TE6 A;  3FUV A;  5KPT A;  3KOY E;  4OVZ A;  3VK7 A;  3E9S A;  1OIP A;  3NBI A;  4CGY B;  1H0G A;  4HMC A;  3ZQJ A;  1SXJ E;  3SHG B;  4DR5 M;  3WD4 A;  1KFV A;  2LXE A;  4NYU A;  5A2Q S;  3R9X B;  3GLG E;  1XXH E;  4IBC A;  4LRS A;  2K0B X;  1IN8 A;  3U61 B;  1LTM A;  2UUB M;  3FRH A;  2V1U A;  2V6Z M;  2KZS A;  4BLC A;  2UXC M;  1EE8 A;  3U6E A;  1EIJ A;  3U60 A;  4NRV A;  1WGL A;  4KHP M;  2R0I A;  3J27 B;  3PNV A;  4AKH A;  2Y2J A;  2JZ1 A;  5GKN A;  4RKU F;  4QNR A;  3UJN A;  1R6B X;  4G4N A;  2GQF A;  3IHP A;  4QNL A;  2R6F A;  1OIZ A;  3KSX A;  3WD1 A;  5ITY A;  3MMP A;  4HMD A;  1G71 A;  4MH0 E;  1NNU C;  3IG5 A;  3A46 A;  3SAU A;  4L15 A;  1HR0 M;  2E5L M;  2Y2H A;  3ZH9 B;  3SAW A;  2C5R A;  3GPX A;  4JI5 M;  1D0L A;  1IXS B;  2LHG A;  2FH0 A;  2R44 A;  2EKF A;  2LVQ D;  4YHH M;  3KS8 A;  4G4R A;  4GHL A;  1W1P A;  2OO9 A;  3FKE A;  4A3V B;  4JYA M;  1OFI A;  3QYE A;  4LF4 M;  3K9P A;  1Q02 A;  3MQL A;  3V76 A;  1XNQ M;  1SXJ D;  2D7E A;  2JCH A;  2NQ8 C;  1NO1 A;  3L28 A;  3U6O A;  2KA6 B;  4LF6 M;  5LMU M;  4B3R M;  4AW4 A;  1Z5B A;  3DZD A;  3NWL A;  1ED7 A;  1UR9 A;  1GJT A;  2DKL A;  1H8P A;  3UZU A;  4AG6 A;  1N78 A;  1K3X A;  1IN5 A;  3TWK A;  3SMS A;  4S12 A;  1HNW M;  1YU1 A;  3VDP A;  4NZ1 A;  2JY5 A;  3A42 A;  2L6O A;  4DV4 M;  3FE3 A;  4G3O A;  2FNA A;  3M6A A;  4HEO A;  4IBI A;  2MJ5 B;  2OQ4 A;  4JI6 M;  5IT9 S;  1E94 E;  2DAM A;  1DO2 A;  1WIV A;  1YU4 A;  5L8R F;  5EP4 A;  5FTK A;  3RGS A;  2K47 A;  4BBA A;  4QHT A;  1TH3 A;  2XFS A;  5ITX E;  3GP1 A;  4DR1 M;  3MJ5 A;  4Z6Y A;  1V92 A;  3VK8 A;  2KEB A;  2KXE A;  4MB4 A;  1ZMU A;  1W1Y A;  4OUI A;  4OJ5 A;  1XNR M;  1E6N A;  1E6R A;  4DBG B;  4DV3 M;  2CHQ A;  2LVP C;  3GRU A;  3VKH A;  1BVS A;  5E26 A;  1IY2 A;  4FWH A;  1XC8 A;  1IN6 A;  2XEP A;  1XMQ M;  2RKO A;  2CV2 A;  1HNZ M;  2H5X A;  1VDL A;  1OQY A;  2KDL A;  2BNK A;  1R2Z A;  2JE5 A;  2FN2 A;  2DAI A;  1Q3C A;  1L2C A;  1NSF A;  4L6V 6;  2A5Y B;  1IXR C;  4IBB A;  4DR2 M;  2L7I A;  1IM2 A;  3JR5 A;  2LNH C;  3KSJ A;  3Q8X A;  1IXS A;  3WHK A;  2F5O A;  1I4W A;  4JI7 M;  3GQ4 A;  1X37 A;  3IEC A;  3M7G A;  3SAV A;  1R2Y A;  3FUT A;  1HQC A;  2W82 A;  2KNA A;  1NJG A;  4ZPX A; 
#chains in the Genus database with same CATH homology
 5FTM A;  4FCT A;  1G3I A;  3MHV C;  2QBY B;  1Z5C A;  1IY0 A;  3AV0 A;  4G4O A;  2M60 A;  4AZF A;  2CUZ A;  4EIW A;  2Y20 A;  4D80 A;  5JI2 E;  4NZ4 A;  3SAS A;  4FCV A;  3D8L A;  5ITU A;  4X64 M;  3LQQ A;  2R4J A;  4LJA A;  3VFD A;  3EIE A;  1QAO A;  2UUA M;  5EXP A;  2Y2K A;  4KLN A;  3TL4 X;  2AHM A;  2P5T A;  3VLF B;  4QOZ C;  4LF7 M;  4GKK M;  3FUW A;  3WHL A;  1NVM A;  2X8A A;  1YUE A;  4BB9 A;  2Y0T A;  3HGI A;  4DUY M;  2CE7 A;  3L2A A;  4MGZ E;  4WW0 A;  4Z8X A;  3U6M A;  4OJO A;  1R7R A;  4AQY M;  3OTO M;  4NZ5 A;  2QCU A;  1PJI A;  2BG1 A;  2Y21 A;  2FOI C;  3UGJ A;  3EIH A;  1YE9 A;  1E9S A;  3TWL A;  4DR3 M;  4LJ9 A;  1IQP A;  4PT5 A;  4FWD A;  2CV0 A;  3VKG A;  3U6Q A;  3GLI B;  5FTN A;  5EJC A;  2CFO A;  3T38 A;  5KQD A;  3AKZ A;  4ITQ A;  4GH9 A;  4NL4 H;  3FD9 A;  2F5N A;  2YFQ A;  3DFZ A;  1HQY E;  3UK6 A;  3JAM S;  1N75 A;  3HJS A;  3ZC7 B;  3KDS E;  4NXN M;  4GIT A;  3FUX A;  2HL7 A;  2RGO A;  1N77 A;  7CAT A;  2C96 A;  4QNM A;  4L8R C;  2KRU A;  3FTF A;  3FYC A;  1GLN A;  4X65 M;  3L25 A;  2C98 A;  2F4V M;  5F3W A;  3UMM A;  2VQF M;  4JI2 M;  2QBY A;  1Z59 A;  4I4L A;  3B9P A;  2DVW B;  3CF6 E;  4R3D A;  3KW6 A;  3GLF B;  3SYL A;  3T1H M;  3MK6 A;  1DGH B;  2Z7J A;  2L7H A;  3U5Z B;  1UM8 A;  2FFJ A;  5EXS A;  2Z4S A;  5KPR A;  1JQJ C;  1YU2 A;  3DOA A;  1IBM M;  3WX7 A;  3GPU A;  1L1Z A;  2J7O A;  3HU2 A;  4KO8 A;  4PCZ A;  2HCB A;  3L26 A;  4LCB A;  3TWM A;  4L4U A;  5DYI A;  3E4R A;  2XZU A;  3LMM A;  4B3M M;  5EP3 A;  5JI3 E;  4X62 M;  2Z3X A;  4LF9 M;  1DGB A;  5DYG A;  1T3T A;  4HLQ A;  3GRY A;  3H4M A;  2XLJ A;  2XH9 A;  5FTJ A;  3I51 A;  2VQE M;  2ERC A;  4I81 A;  4DV1 M;  1QZM A;  1QQW A;  1WXQ A;  4L16 A;  4HL4 A;  2R65 A;  1HNX M;  3GLI A;  3I4Y A;  3GRV A;  1K3W A;  2ZAM A;  3SHF A;  4NYY A;  4QHS A;  5FLX S;  2BJW A;  2Y2G A;  5ITQ A;  2UXB M;  5IRE B;  4LFA M;  4OJL A;  4D81 A;  3GQ5 A;  3LVW A;  2XFT A;  4AKI A;  2XSZ A;  3U6P A;  3J2P B;  2BJV A;  1Z5A A;  3D8B A;  1Z6T A;  4B7G A;  2C9O A;  4JI4 M;  4M0W A;  4IBE A;  4G4Q A;  4FD2 A;  3U6S A;  3KS4 A;  1H6U A;  1ZQ9 A;  5C1B A;  4LZJ A;  2LWX A;  1IN7 A;  3AOG A;  3GLF A;  8CAT A;  2ZAN A;  1L2B A;  3QAU A;  1DGH A;  3KOX E;  2XZF A;  3ILK A;  1KYI A;  3U5Z A;  2O5R A;  5EP2 A;  1XMO M;  1TDZ A;  2I7P A;  3K8Z A;  2YR0 A;  3K1J A;  4PDI A;  3HSH A;  4LJ7 A;  4K0K M;  2R18 A;  4LZZ A;  4REZ A;  4NRW A;  1XHB A;  2UUC M;  1K82 A;  3SC3 A;  4KOD A;  4M9S A;  2Y2N A;  5KQ8 A;  2HHH M;  3L27 A;  4IBJ A;  3T15 A;  3R8F A;  2EO2 A;  4OU7 A;  1FJG M;  5EXT A;  3CTW B;  4LRT A;  3GO8 A;  3SFZ A;  1JR3 A;  4JI3 M;  1MX0 A;  4NY2 A;  4LFB M;  1SXJ C;  4JI1 M;  4IBF A;  2LH0 A;  2G8L A;  4NSR A;  4LJ6 A;  4B08 A;  4FVM A;  4FW9 A;  2DXI A;  3QWL A;  3VDU A;  3SAR A;  1G4A E;  2I7N A;  1Q3B A;  3PFI A;  1W5T A;  1TGU A;  4JN6 A;  4GRI A;  4OX9 M;  1NNJ A;  4OW0 A;  1MU5 A;  3TQS A;  2C99 A;  3U6L A;  5H37 D;  4OJ6 A;  3RFW A;  3TPZ A;  3GRR A;  4GIP A;  2CEA A;  4MM3 B;  1GKI A;  3PVS A;  3LQR A;  2F5P A;  3AJI B;  3U6C A;  3J80 S;  3U6D A;  1NY5 A;  2Y0Q A;  1TH2 A;  3RE8 A;  1TDH A;  4WUR A;  4W5W A;  5E6J A;  5ITT A;  5ITX A;  4M9Z A;  3W0L B;  2Y2O A;  2H1R A;  2Y2M A;  5EP1 A;  4PDG A;  4MGH A;  2L09 A;  3A45 A;  3KP0 E;  5C18 A;  5BR8 M;  1HT2 E;  1J7K A;  2Q2E B;  3SYK A;  3AFH A;  4DR7 M;  2Y2H A;  1ZAE A;  3N3F A;  4M0D A;  1ORY B;  2KW0 A;  2RGH A;  1SXJ B;  4MGI E;  4OJP A;  3GLG B;  1XXH B;  4II7 A;  4DUZ M;  1QVR A;  2XD5 A;  4LG2 A;  3HON A;  1D2N A;  4B3S M;  2V1C A;  3KOW E;  2DWL A;  3GPP A;  1NHG C;  3CF0 A;  3L29 A;  3KOZ E;  2FE8 A;  4DV2 M;  4NSO B;  4GC9 A;  3GLH A;  3CF2 A;  3FYD A;  2UU9 M;  1IXZ A;  3FTC A;  1GL6 A;  3HKP A;  4PD2 A;  3J7A S;  2Y2P A;  3ZCB B;  2KRK A;  2ZM6 M;  5DNY A;  4AG5 A;  4RF1 A;  4MGY E;  1PM5 A;  4CIS A;  2CHV A;  1G59 A;  4RF0 A;  3KP1 E;  4I8O A;  1XWI A;  3W0F A;  4GC5 A;  2DWN A;  4LGM A;  3AOE C;  3K2L A;  2X4A A;  4D82 A;  3KVW A;  1DGF A;  3IG8 A;  5IWA M;  2XSZ D;  4FWG A;  1YUB A;  2ZBK B;  2Y2Q A;  2R4E A;  1N32 M;  1YU0 A;  2D7H A;  2J7N A;  4IBD A;  2CHG A;  4X66 M;  1KSF X;  3SBJ A;  2QP9 X;  4P16 A;  3A98 B;  4QOS A;  1DGG A;  4NZ3 A;  1QYR A;  3BOS A;  2IOU A;  1J09 A;  1PJJ A;  3J81 S;  4LFC M;  4JXJ A;  4TUW A;  1OFH A;  2QEN A;  4B3T M;  2QPA A;  2Y2L A;  1OJL A;  3GPY A;  5LMN M;  4XBO A;  4JV5 M;  2YQZ A;  3RGP A;  4AKG A;  2UWX A;  1YSY A;  2Z4R A;  5FSW A;  2Y2I A;  1N34 M;  1SXJ A;  1VDD A;  4LGY A;  2KZU A;  4IIW A;  1XXH A;  3GLG A;  4LJ5 A;  2D7G A;  4I5S A;  2VII A;  4DV7 M;  1I94 M;  3GQ3 A;  1QAM A;  4YY3 M;  1IY1 A;  3HHY A;  4JI0 M;  1L1T A;  4JI8 M;  3KFU G;  4IJE A;  2R45 A;  1G8P A;  1JR3 D;  3HWS A;  4AI6 A;  5KO3 A;  2M5Z A;  3U61 A;  3HJQ A;  1C1K A;  1L2D A;  2JA2 A;  2DZO B;  4OVZ B;  1NY6 A;  4M9X A;  1IBK M;  1L8Q A;  2UXD M;  3HHZ A;  2G5G X;  1FNN A;  1S3S A;  2XD1 A;  5EXX A;  4B7F A;  3HHX A;  3I4V A;  4G6Z A;  1DO0 A;  4IBG A;  3KXE C;  5KPZ A;  3J7B A;  3HJ8 A;  3GLH B;  1G41 A;  2EUC A;  3U60 B;  1J5E M;  2DHR A;  4IBK A;  1QAQ A;  1GL7 A;  1NJF A;  3AL0 C;  4XGI A;  5FTL A;  2X49 A;  4DV6 M;  4GKJ M;  2FFF B;  2EA0 A;  1IBL M;  4DV5 M;  5BPV A;  3C58 A;  4NXM M;  2HKJ A;  4LF8 M;  4DV0 M;  1LV7 A;  3PNY A;  4L78 A;  4LF5 M;  4NOO B;  3SMP A;  1TH4 A;  2R62 A;  1Q39 A;  4LJ4 A;  2XGN A;  4FCW A;  5IZ7 D;  2C9C A;  3FUU A;  2ZAO A;  1NHW C;  3THG A;  2DWM A;  4MB7 A;  2YNM D;  2R46 A;  3SAT A;  1YU3 A;  4IJF A;  1E9R A;  4GMQ A;  1HT1 E;  2F5Q A;  3FTE A;  4B7H A;  2CV1 A;  3HU1 A;  1IN4 A;  3HHW A;  1E32 A;  3T1Y M;  4DR4 M;  1N33 M;  5EQT A;  2OPF A;  4CHT B;  3DA1 A;  3M0E A;  2XF3 A;  3FTD A;  1W5S A;  3K92 A;  4LY6 A;  3LVV A;  5ITR A;  1QAN A;  3PXG A;  2F5S A;  2DWZ B;  2DZN B;  3JR4 A;  3AOE A;  3HU3 A;  4RNA A;  1GVN A;  4GHA A;  1N36 M;  4MGK E;  4LJ8 A;  2QZ4 A;  4R7G A;  4DR6 M;  3TE6 A;  3FUV A;  5KPT A;  3KOY E;  4OVZ A;  3VK7 A;  3E9S A;  3NBI A;  4CGY B;  1SXJ E;  3SHG B;  4DR5 M;  1KFV A;  2LXE A;  4NYU A;  5A2Q S;  3R9X B;  4IBC A;  4LRS A;  1IN8 A;  3U61 B;  2UUB M;  2V1U A;  2V6Z M;  2KZS A;  4BLC A;  2UXC M;  1EE8 A;  3U6E A;  3U60 A;  4NRV A;  4KHP M;  3J27 B;  3PNV A;  4AKH A;  2Y2J A;  5GKN A;  3UJN A;  4QNR A;  4G4N A;  1R6B X;  4QNL A;  3KSX A;  5ITY A;  4MH0 E;  3A46 A;  1NNU C;  3IG5 A;  3SAU A;  2E5L M;  4L15 A;  1HR0 M;  3ZH9 B;  3SAW A;  2C5R A;  3GPX A;  4JI5 M;  4YHH M;  1IXS B;  3KS8 A;  4GHL A;  4G4R A;  3FKE A;  4A3V B;  4JYA M;  1OFI A;  4LF4 M;  1XNQ M;  1SXJ D;  2D7E A;  2JCH A;  2NQ8 C;  3L28 A;  3U6O A;  2KA6 B;  4LF6 M;  5LMU M;  4B3R M;  4AW4 A;  1Z5B A;  3DZD A;  3NWL A;  3UZU A;  4AG6 A;  1N78 A;  1K3X A;  1IN5 A;  3TWK A;  3SMS A;  4S12 A;  1HNW M;  1YU1 A;  3VDP A;  4NZ1 A;  3A42 A;  2L6O A;  4DV4 M;  4IBI A;  2FNA A;  3M6A A;  2OQ4 A;  4JI6 M;  5IT9 S;  1E94 E;  1DO2 A;  1YU4 A;  5EP4 A;  5FTK A;  3RGS A;  2K47 A;  4BBA A;  4QHT A;  1TH3 A;  2XFS A;  5ITX E;  3GP1 A;  4DR1 M;  3MJ5 A;  4Z6Y A;  3VK8 A;  2KEB A;  2KXE A;  4OUI A;  4OJ5 A;  1XNR M;  4DV3 M;  2CHQ A;  3GRU A;  3VKH A;  5E26 A;  1IY2 A;  4FWH A;  1XC8 A;  1IN6 A;  2XEP A;  1XMQ M;  2RKO A;  2CV2 A;  1HNZ M;  2BNK A;  1R2Z A;  2JE5 A;  1L2C A;  1Q3C A;  1NSF A;  2A5Y B;  1IXR C;  4IBB A;  4DR2 M;  2L7I A;  1IM2 A;  3JR5 A;  2LNH C;  3KSJ A;  3Q8X A;  3WHK A;  2F5O A;  4JI7 M;  1I4W A;  3GQ4 A;  1X37 A;  3SAV A;  3M7G A;  1R2Y A;  3FUT A;  1HQC A;  2W82 A;  1NJG A;  4ZPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...