4IBGA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibgA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibgA02
4LG2A 4GHAA 3FKEA 3L28A 4IBCA 3L25A 4IBDA 5BPVA 4IBKA 4IBJA 4IJFA 3L26A 3KS8A 3KS4A 3L29A 4IBGA 4IBEA 4IBIA 4GH9A 4IJEA 3L27A 3L2AA 4IBBA 4GHLA 4IBFA
chains in the Genus database with same CATH superfamily
4WW0A 2LVAA 4L78A 2C5RA 3MQLA 3AV0A 4A3VB 4LG2A 5KQDA 4Z2JA 2ZTCA 1OTRA 2OOAA 3FE3A 4GC9A 2XEPA 3ZH9B 1OIPA 2CHVA 3R8FA 3L25A 4Z2LA 1C1KA 1DGGA 3TPZA 2Z7JA 1XC8A 2O01F 3CTWB 1J7KA 2B3TA 2I7NA 3ZQJA 4D80A 1QUTA 4MB4A 3U5ZB 1W5TA 5E26A 4NZ4A 3F92A 1CUKA 1WXQA 4NZ5A 4JI4M 2KXEA 4IBEA 2GQFA 5FTLA 4GITA 3HU1A 1NJGA 1WJ7A 2CP8A 4R3DA 3NBIA 1ORYB 5L8RF 3HHYA 5IWAM 1N33M 1KYIA 1BVSA 2XSZA 1HQCA 3AOEA 1UFZA 1XWIA 4GIPA 4X66M 3HWSA 2Y21A 3GO8A 4DR5M 3HJSA 4FCWA 1NY5A 2K0BX 3D8LA 4MGIE 2LH0A 3IECA 3HZJA 1RU3A 4I81A 2XSZD 1GL6A 1OAOC 3B7QA 3HHXA 1LTMA 1J09A 4LJAA 4PD2A 1CK7A 3C58A 4I5SA 4OJOA 1VQ1A 4NSOB 5ITXA 2UXDM 2DWZB 1K82A 3SMSA 3KSJA 1G3IA 5EJCA 3FUUA 3HJ8A 4B7FA 4JI8M 2UUAM 2QHOB 4MGKE 1H8PA 2DKLA 4HEOA 4QHSA 5FTKA 2UWXA 4IBGA 5EP4A 4DUYM 3T38A 1PJSA 2DAEA 1NVMA 2WSFF 3K2LA 3UGJA 4TUWA 1QAMA 4DV6M 2V5OA 2Y2HA 1IN8A 2GNOA 1L1TA 3DZDA 1QANA 5C1BA 4JV5M 1R2YA 1KS0A 4R7GA 1W1PA 2QZ4A 2WSCF 5EP3A 1NV8A 1IBLM 1GABA 1GXDA 1N32M 1L2CA 2Y2MA 3FKEA 1PJIA 1VDLA 4NZ3A 3N3FA 1N75A 1QVRA 2C9CA 3HY5A 1OAIA 5LMUM 4IBDA 5JI3E 4FWGA 1D2NA 1ZAEA 2KNVA 1GVNA 4D81A 3K1JA 2X4AA 4NRVA 1L1ZA 5FSWA 5FTMA 1QZEA 3B74A 2M60A 2HHHM 4QOSA 3TE6A 1C7YA 4QNMA 2Y2NA 2HL7A 2R65A 1TR8A 2DHYA 4B3SM 3U6OA 2JZ0A 2OQ4A 4NY2A 1Q39A 4LGYA 4GH9A 4GKKM 3IG5A 5GKNA 1IXSB 3U6DA 3J27B 3GPXA 3GLIB 3M7GA 3THGA 4FD2A 5BR8M 1XMQM 3RFWA 1W5SA 2APLA 1G41A 3M0EA 3HJQA 3KOWE 1N77A 4LF5M 2L7HA 4LJ4A 1E8BA 2JUJA 2JZ1A 2R62A 1QDRA 2I7PA 3SASA 4LY6A 2P5TA 4LJ5A 3T1HM 3U5ZA 3U60B 2XZUA 1GOIA 3FRHA 3SYKA 1ZV1A 2Z3XA 4Z2GA 2DZLA 3WD0A 2Y2IA 1TH2A 4GMQA 3GP1A 2ZTDA 3KOYE 5EP2A 3VKHA 1ZMUA 2QP9X 2LTUA 4MM3B 1Y8GA 2DWLA 2FN2A 4JI3M 4B08A 3EIHA 3LQQA 1MJGM 4OVZB 4DV1M 2BG1A 2KNZA 4IJEA 4MGHA 3CF2A 4GHLA 4OJ5A 3E4RA 3GQ3A 2QCUA 1J5EM 4ANRA 1N34M 1ZMWA 1GJSA 4G6ZA 2C96A 2E5LM 3WD1A 2VQEM 2RRUA 2OOBA 3LMMA 2Y20A 3W0LB 4JI5M 1L6JA 1H0IA 2XH9A 4NYUA 4LJ8A 1SG9A 4R71A 4B3MM 4AW4A 2VF8A 3AFHA 3SC3A 3TWLA 5JI2E 1XMOM 1XXHB 4Z6YA 1OFIA 3Q8GA 3QYEA 3E46A 1IFYA 1JQJC 3L29A 1HQYE 2NQ8C 1D0MA 2XZFA 2XFSA 4Z2IA 1R6BX 2VDBB 4B3TM 2XF3A 1E9RA 2Y2QA 1E94E 2R18A 1IN7A 4AQYM 4DR2M 3GRUA 3I04M 2DI0A 1EAKA 3H4JA 2DAMA 4KT0F 3J80S 4AG6A 3GLFB 2QSFX 1QUSA 1UM8A 2WSEF 2DXIA 3WX7A 2F5SA 2G8LA 4GHAA 3T6PA 4NRWA 1H0GA 2C9OA 4LJ7A 2JWSA 5IZ7D 3SBJA 4BBAA 4JI0M 4F2LA 4P16A 2R45A 1YE9A 1YUEA 3MMPA 1YU2A 4L16A 1O6IA 3TQSA 2R4EA 1QAQA 3PFIA 2Z4SA 1TDHA 1NHWC 1YLAA 2BJVA 3KS8A 4LRSA 4LZJA 1E6NA 2OPFA 4QHTA 1IXSA 1QQWA 3WHKA 3GLHB 4Z2KA 3GLIA 1DV0A 3GPUA 1DGHB 3LCUA 1A5TA 3J2PB 3SFZA 2ERCA 3HKPA 4AG5A 2UUBM 4GKJM 1IY2A 1NJFA 1DGBA 2L4EA 4G4OA 3PVSA 1Z6TA 4DV4M 4NXMM 3FTEA 3HHWA 1NY6A 1PJTA 3HU3A 4DR3M 1OJLA 4KLNA 3JR5A 4Y28F 1YU0A 4NYYA 2VF7A 2YNMD 3FYDA 3HGIA 2DHRA 3AOEC 3WD3A 1OGGA 2LVPC 2C98A 1NO1A 2ZAOA 2ZANA 1TGUA 3KDSE 3ZCBB 5KO3A 2Y2LA 1ED7A 1X37A 1WHCA 1AIWA 3K92A 4GRIA 4OVZA 2RTSA 3KS4A 2Y2OA 4EIWA 2RGHA 2R4JA 4LJ6A 3LVVA 1ZMVA 2V6ZM 3KSXA 1FNNA 4DBGB 4F1IA 4IBIA 1EIJA 3ZC7B 3PXGA 3CGWA 4K0KM 4FWDA 4TX8A 2KEBA 2KZSA 4I4LA 4OJPA 4IBBA 3GRVA 3WD4A 4QNLA 3AKZA 4OW0A 1PJQA 1WR1B 2CE7A 2KA6B 2J7OA 2OO9A 4B7HA 3EIEA 1MX0A 1YU3A 3E21A 1W1VA 4LFCM 4LRTA 4QOZC 3M6AA 4IBCA 3SATA 1YU4A 3M7PA 1E32A 3E9SA 3B9PA 3FTDA 3I51A 1PRBA 4RF1A 4CGYB 1XXHA 4CJ6A 4OX9M 1IBMM 1YUBA 1HJPA 4IIWA 4DV5M 4QNRA 3FD9A 2L7IA 4P17A 4HL4A 1N36M 2Y2KA 2EKFA 2R44A 1GLNA 3W68A 1SXJB 2XFTA 3GLFA 2ZM6M 3HONA 2L09A 1V92A 2BNKA 3GLIE 3T1YM 1TH4A 1K3WA 4M9ZA 2LVOC 1Z59A 1UR8A 5DNYA 2MJ5B 2LWXA 2D7GA 4RKUF 1VEKA 3A45A 3GPYA 2L4FA 4HMDA 4AI6A 1EE8A 1IY1A 1G4AE 1GPFA 2J7NA 7CATA 3A98B 2MR9A 3B7ZA 5ITTA 4WURA 4AZFA 1F4IA 1E6RA 1OGBA 3HSHA 4LCBA 4CIZA 3BXWA 4GC5A 4Z2HA 3SHFA 1G8PA 3T15A 3GLHA 1T3TA 1IM2A 5KPRA 4DR7M 1DGHA 4JI1M 4JYAM 2L2DA 1QYRA 2KDLA 3RGPA 4G3OA 4BLCA 4X62M 4DV7M 1V34A 4WP2A 4LF7M 3C3EA 1GJTA 4ZPXA 2G3QA 5KPZA 2F4VM 2JY8A 1GKIA 3C9PA 1V33A 2VQFM 1OQYA 4S12A 4HMCA 2F5PA 2JY7A 2MH8A 3QWLA 2Y2GA 3C3DA 2WZJA 1HT2E 4X64M 1YU1A 2LHGA 3SAWA 4L4UA 1NV9A 2C99A 5EQTA 2O5RA 3VDUA 1OIZA 4AKGA 2LVQD 4JI2M 3U6LA 2CWBA 2CEAA 2YQZA 2QBYB 1FJGM 5KQ8A 4PDIA 2UU9M 3SARA 3JAMS 2AHMA 4UN2B 3JR4A 2DAKA 3W0FA 1S3SA 4RF0A 2Z4RA 1IY0A 3WHLA 5A2QS 2CFOA 1XXHE 3FUVA 4IBJA 4HMEA 1D0KA 3H4MA 1XNQM 2QENA 3KP0E 2CHQA 3DA1A 1OKSA 2BWBA 8CATA 4DV3M 2LNHC 2JA2A 4LGMA 3IHPA 1AUAA 5DFLA 3KFUG 4M0WA 1T6OA 1NNJA 3GLFE 2A5YB 5DYIA 3U6SA 4PCZA 4CISA 3J81S 3OTOM 1L2DA 2DWNA 2XD5A 2KHHA 3MJ5A 4LF8M 4L8RC 1NNUC 1TTEA 2F5QA 4Z8XA 4LF4M 1WIVA 4DV2M 3U6CA 1XNRM 4KHPM 2FFFB 2BJWA 4XK8F 4OJLA 4DR4M 4REZA 4PT5A 4NOOB 4FW9A 4X65M 2FOIC 2V1CA 1GL7A 3VK7A 4YY3M 3HU2A 4FCTA 2FS1A 1SXJA 1J7MA 3GLHE 1PDCA 4G4NA 3UZUA 2DWMA 5H37D 2H1RA 2JP7A 3KVWA 3L27A 4JI7M 3AL0C 3HHZA 2RGOA 4XBOA 2LXEA 5FTJA 3VLFB 4DR1M 4LF6M 2LBCA 3SHGB 3MHVC 3HX3A 1XHBA 4DV0M 3VKGA 3U60A 1ZQ9A 5EXTA 1EFUB 4MGYE 1GO5A 3QYBA 4HLQA 4II7A 3K9PA 2JNHA 1I94M 4I8OA 3QAUA 4NZ1A 1E15A 3FRIA 1LV7A 4KODA 4MB5A 1VDDA 2EO2A 4BB9A 3L26A 3U6EA 4M0DA 2V1UA 2K47A 2QPAA 5EXSA 2KW0A 3U61B 1T43A 1P3QQ 1QO6A 2MROB 2BWEA 1Q02A 1IXRC 1VEGA 1HR0M 1W1TA 3AOGA 1E6PA 4DUZM 3KOXE 2DAGA 4IBFA 3VK8A 2XD1A 3K9OA 2QBYA 3GQ5A 5LMNM 1L8QA 4M9SA 1R5LA 1XB2B 3GLGE 1PM5A 1JR3A 2XGNA 2CV1A 3B7NA 1Q3BA 3I4VA 1TDZA 4OU7A 2YR0A 3W67A 2DVWB 1WGLA 3GLGB 2R6FA 3L28A 1Z5BA 4FVMA 1R2ZA 2JY6B 4NSRA 4NL4H 2UXBM 2Y2PA 2D7EA 3LVWA 1TH3A 4M9XA 3SYLA 4D82A 1JR3D 1E88A 4B7GA 2FNAA 1CXWA 2KRKA 3SAUA 1HNZM 3J7BA 2LVNC 4OUIA 3V76A 3TWKA 5FTNA 2LHCA 5EXPA 3VFDA 4L6V6 2K9DA 2N35A 2R0IA 2Y2JA 4MGZE 2F5NA 2QQ8A 1SXJE 5FLXS 2UUCM 4CHTB 1D0LA 3LCVB 3TL4X 3A46A 1IBKM 3U6PA 3FTFA 1W1YA 2HKJA 4JI6M 1IN5A 2O25A 3PNYA 2M5ZA 2RKOA 2ZBKB 2EKKA 2K6BA 3NBXX 3TWMA 2D49A 1UR9A 1OFHA 2ZAMA 1PJJA 4LFBM 2D7HA 1NSFA 2DZNB 2JCHA 1PGYA 3PNVA 1IQPA 1E6ZA 4W5WA 1HT1E 2EUCA 4FWHA 2KZUA 3BOSA 5KPTA 2G5GX 2CV2A 5IREB 2Y0QA 3KXEC 3MK6A 3VDPA 1I4WA 3RE8A 4MH0E 1DO0A 3U6MA 2F5OA 3FUWA 4IJFA 3UK6A 1G59A 3KP1E 1KFVA 1R4GA 4Q7JA 2X8AA 4NXNM 3WD2A 4AKIA 1QAOA 2W82A 2Z8YM 2FFJA 2HWJA 4MB3A 3KOZE 3Q8XA 1VEJA 4PDGA 3UMMA 3CF0A 3I01M 4MB7A 1NHGC 1YSYA 3BBZA 3NWLA 3RGSA 2L6OA 3D8BA 2HCBA 5C18A 1Z5CA 2YFQA 1DGFA 2JXNA 1HNWM 3LW5F 3AJIB 1KSFX 4LZZA 1JR3E 2XLJA 2EA0A 3R9XB 1G71A 3SMPA 3DFZA 5DYGA 4G4QA 3GPPA 3J7AS 2JE5A 1MU5A 2MGWA 4RNAA 5ITXE 3KW6A 3FYCA 3U61A 4G4RA 1WGNA 4OJ6A 4L15A 2DAIA 4ITQA 3GRRA 3U6QA 2DZOB 3DOAA 1K3XA 2CHGA 4LJ9A 5EP1A 2X49A 2QNJA 4GEWA 3GRYA 2H5XA 2DENA 3SAVA 1IN4A 1DO2A 4YHHM 4JN6A 3ILKA 5ITRA 1L2BA 3GLGA 2R46A 5F3WA 4B3RM 1HNXM 5E6JA 1JB0F 2CV0A 3A42A 3FTCA 1E9SA 5IT9S 3B89A 2Y0TA 4NC6A 5EXXA 5ITUA 2IOUA 2CRUA 4AKHA 2JY5A 3FUXA 3I4YA 4KO8A 4FCVA 2KRUA 4LFAM 5ITYA 1Q3CA 2J5YA 1MN3A 2HAKA 3IG8A 4XGIA 5BPVA 3UJNA 2FH0A 3FUTA 1H6UA 1N78A 1IXZA 4LF9M 3CF6E 2EJSA 4IBKA 4JXJA 1R7RA 2FE8A 1AIPC 1QZMA 2DNAA 2UXCM 1TF0B 4DR6M 3K8ZA 1VG5A 2KNAA 1IN6A 1QDTA 3L2AA 3LQRA 2VIIA 1SXJD 1Z5AA 2Q2EB 2CUZA 3GQ4A 1SXJC 5ITQA
chains in the Genus database with same CATH topology
4WW0A 4L78A 2C5RA 3AV0A 4A3VB 4LG2A 5KQDA 4GC9A 2XEPA 3ZH9B 2CHVA 3R8FA 3L25A 1C1KA 1DGGA 3TPZA 2Z7JA 1XC8A 3CTWB 1J7KA 2I7NA 4D80A 3U5ZB 1W5TA 5E26A 4NZ4A 1WXQA 4NZ5A 4JI4M 2KXEA 4IBEA 5FTLA 4GITA 3HU1A 1NJGA 4R3DA 3NBIA 1ORYB 5IWAM 3HHYA 1N33M 1KYIA 2XSZA 3AOEA 1HQCA 4GIPA 4X66M 1XWIA 3HWSA 2Y21A 3GO8A 4DR5M 3HJSA 4FCWA 1NY5A 3D8LA 4MGIE 2LH0A 4I81A 2XSZD 1GL6A 3HHXA 1J09A 4LJAA 4PD2A 4OJOA 3C58A 4I5SA 4NSOB 5ITXA 2UXDM 2DWZB 1K82A 3SMSA 3KSJA 1G3IA 5EJCA 3FUUA 3HJ8A 4B7FA 4JI8M 2UUAM 4MGKE 5FTKA 2UWXA 4QHSA 4IBGA 5EP4A 4DUYM 3T38A 3K2LA 1NVMA 3HSHA 3UGJA 4TUWA 1QAMA 4DV6M 2Y2HA 1IN8A 1L1TA 3DZDA 1QANA 5C1BA 4JV5M 1R2YA 4R7GA 2QZ4A 5EP3A 1IBLM 1N32M 1L2CA 2Y2MA 3FKEA 1PJIA 4NZ3A 3N3FA 1N75A 1QVRA 2C9CA 5LMUM 4IBDA 5JI3E 4FWGA 1D2NA 1ZAEA 1GVNA 4D81A 3K1JA 2X4AA 4NRVA 1L1ZA 5FSWA 5FTMA 2M60A 2HHHM 4QOSA 3TE6A 4QNMA 2Y2NA 2HL7A 2R65A 4B3SM 3U6OA 2OQ4A 4NY2A 1Q39A 4LGYA 4GH9A 4GKKM 3IG5A 5GKNA 1IXSB 3U6DA 3J27B 3GPXA 3GLIB 3M7GA 3THGA 4FD2A 5BR8M 1XMQM 3RFWA 1W5SA 1G41A 3M0EA 3HJQA 3KOWE 1N77A 4LF5M 2L7HA 4LJ4A 2R62A 2I7PA 3SASA 4LY6A 2P5TA 4LJ5A 3T1HM 3U5ZA 3U60B 2XZUA 3SYKA 2Z3XA 2Y2IA 1TH2A 4GMQA 3GP1A 3KOYE 5EP2A 3VKHA 2QP9X 4MM3B 2DWLA 4JI3M 4B08A 3EIHA 3LQQA 4OVZB 4DV1M 2BG1A 4IJEA 4MGHA 3CF2A 4GHLA 4OJ5A 3E4RA 3GQ3A 2QCUA 1J5EM 1N34M 4G6ZA 2C96A 2E5LM 2VQEM 3LMMA 2Y20A 3W0LB 4JI5M 2XH9A 4NYUA 4LJ8A 4B3MM 4AW4A 3TWLA 3AFHA 3SC3A 5JI2E 1XMOM 1XXHB 4Z6YA 1OFIA 1JQJC 3L29A 1HQYE 2NQ8C 2XZFA 2XFSA 1R6BX 4B3TM 2XF3A 1E9RA 2Y2QA 1E94E 2R18A 1IN7A 4AQYM 4DR2M 3GRUA 3J80S 4AG6A 3GLFB 1UM8A 2DXIA 3WX7A 2F5SA 2G8LA 4GHAA 4NRWA 2C9OA 4LJ7A 5IZ7D 3SBJA 4BBAA 4JI0M 4P16A 2R45A 1YE9A 1YUEA 1YU2A 4L16A 3TQSA 2R4EA 1QAQA 3PFIA 2Z4SA 1TDHA 1NHWC 2BJVA 3KS8A 4LRSA 4LZJA 2OPFA 4QHTA 3WHKA 1QQWA 3GLHB 3GLIA 3GPUA 1DGHB 3J2PB 4AG5A 3SFZA 2ERCA 3HKPA 2UUBM 4GKJM 1IY2A 1NJFA 1DGBA 4G4OA 3FTEA 3PVSA 1Z6TA 4DV4M 4NXMM 3HHWA 1NY6A 3HU3A 4DR3M 1OJLA 4KLNA 3JR5A 1YU0A 4NYYA 2YNMD 3FYDA 3HGIA 2DHRA 3AOEC 2ZAOA 2C98A 3KDSE 2ZANA 3ZCBB 1TGUA 5KO3A 2Y2LA 1X37A 3K92A 4GRIA 4OVZA 3KS4A 2Y2OA 4EIWA 2RGHA 2R4JA 4LJ6A 3LVVA 2V6ZM 3KSXA 1FNNA 4IBIA 3ZC7B 3PXGA 4K0KM 4FWDA 2KEBA 2KZSA 4I4LA 4OJPA 4IBBA 3GRVA 4QNLA 3AKZA 4OW0A 2CE7A 2KA6B 2J7OA 4B7HA 3EIEA 1MX0A 1YU3A 4LFCM 4LRTA 4QOZC 3M6AA 4IBCA 3SATA 1YU4A 1E32A 3E9SA 3B9PA 3FTDA 3I51A 4RF1A 4CGYB 1XXHA 4OX9M 1IBMM 1YUBA 4IIWA 4DV5M 4QNRA 3FD9A 2L7IA 1N36M 4HL4A 2Y2KA 1GLNA 1SXJB 2XFTA 3GLFA 2ZM6M 3HONA 2L09A 2BNKA 3T1YM 1TH4A 1K3WA 4M9ZA 1Z59A 5DNYA 2LWXA 2D7GA 3A45A 3GPYA 4AI6A 1EE8A 1IY1A 1G4AE 2J7NA 7CATA 3A98B 5ITTA 4WURA 4AZFA 4LCBA 4GC5A 3SHFA 1G8PA 3T15A 3GLHA 1T3TA 1IM2A 5KPRA 4DR7M 1DGHA 4JI1M 4JYAM 1QYRA 3RGPA 4DV7M 4BLCA 4X62M 4LF7M 4ZPXA 5KPZA 2F4VM 1GKIA 2VQFM 4S12A 2F5PA 3QWLA 2Y2GA 4X64M 1YU1A 1HT2E 3SAWA 4L4UA 5EQTA 2C99A 3VDUA 2O5RA 4AKGA 4JI2M 3U6LA 2QBYB 2CEAA 2YQZA 1FJGM 5KQ8A 4PDIA 2UU9M 3SARA 3JAMS 2AHMA 3JR4A 3W0FA 1S3SA 4RF0A 2Z4RA 1IY0A 3WHLA 5A2QS 2CFOA 3FUVA 4IBJA 1XNQM 3H4MA 2QENA 3KP0E 2CHQA 3DA1A 8CATA 4DV3M 2LNHC 2JA2A 4LGMA 3KFUG 4M0WA 1NNJA 3U6SA 2A5YB 5DYIA 4CISA 4PCZA 2XD5A 3J81S 3OTOM 1L2DA 2DWNA 3MJ5A 4LF8M 4L8RC 1NNUC 2F5QA 4LF4M 4Z8XA 4DV2M 3U6CA 1XNRM 4KHPM 2FFFB 2BJWA 4OJLA 4DR4M 4REZA 4PT5A 4NOOB 4FW9A 4X65M 2FOIC 2V1CA 1GL7A 3VK7A 4YY3M 3HU2A 4FCTA 1SXJA 4G4NA 3UZUA 2DWMA 5H37D 2H1RA 3KVWA 3L27A 4JI7M 3AL0C 3HHZA 2RGOA 4XBOA 2LXEA 5FTJA 3VLFB 4DR1M 4LF6M 3SHGB 3MHVC 1XHBA 4DV0M 3VKGA 3U60A 1ZQ9A 5EXTA 4MGYE 4HLQA 4II7A 1I94M 4I8OA 3QAUA 4NZ1A 1LV7A 4KODA 1VDDA 2EO2A 4BB9A 3L26A 3U6EA 4M0DA 2V1UA 2K47A 2QPAA 5EXSA 2KW0A 3U61B 1IXRC 1HR0M 3AOGA 4DUZM 3KOXE 2XD1A 4IBFA 3VK8A 2QBYA 3GQ5A 5LMNM 1L8QA 4M9SA 2CV1A 1PM5A 1JR3A 2XGNA 3I4VA 1Q3BA 1TDZA 4OU7A 2YR0A 2DVWB 3GLGB 3L28A 1Z5BA 4FVMA 1R2ZA 4NSRA 4NL4H 2UXBM 2Y2PA 2D7EA 3LVWA 1TH3A 4M9XA 3SYLA 4D82A 1JR3D 4B7GA 2FNAA 2KRKA 3SAUA 1HNZM 3J7BA 4OUIA 3TWKA 5FTNA 5EXPA 3VFDA 2Y2JA 4MGZE 2F5NA 1SXJE 5FLXS 2UUCM 4CHTB 3TL4X 3A46A 1IBKM 3U6PA 3FTFA 2HKJA 4JI6M 1IN5A 3PNYA 2M5ZA 2RKOA 2ZBKB 3TWMA 1OFHA 2ZAMA 1PJJA 4LFBM 2D7HA 1NSFA 2DZNB 2JCHA 3PNVA 1IQPA 4W5WA 1HT1E 2EUCA 4FWHA 2KZUA 3BOSA 5KPTA 2G5GX 2CV2A 5IREB 2Y0QA 3KXEC 3MK6A 3VDPA 1I4WA 3RE8A 4MH0E 1DO0A 3U6MA 2F5OA 3FUWA 4IJFA 3UK6A 1G59A 3KP1E 1KFVA 2X8AA 4NXNM 4AKIA 1QAOA 2W82A 2FFJA 3KOZE 3Q8XA 4PDGA 3UMMA 3CF0A 4MB7A 1NHGC 1YSYA 3RGSA 3NWLA 2L6OA 3D8BA 2HCBA 5C18A 1Z5CA 2YFQA 1DGFA 1HNWM 3AJIB 1KSFX 4LZZA 3R9XB 2XLJA 2EA0A 3SMPA 3DFZA 5DYGA 4G4QA 3GPPA 3J7AS 2JE5A 1MU5A 4RNAA 5ITXE 3KW6A 3FYCA 3U61A 4G4RA 4OJ6A 4L15A 4ITQA 3GRRA 3U6QA 2DZOB 3DOAA 1K3XA 2CHGA 4LJ9A 5EP1A 2X49A 3GRYA 3SAVA 1IN4A 1DO2A 4YHHM 4JN6A 3ILKA 5ITRA 1L2BA 3GLGA 2R46A 5F3WA 4B3RM 1HNXM 5E6JA 2CV0A 3A42A 3FTCA 1E9SA 5IT9S 2IOUA 2Y0TA 5EXXA 5ITUA 4AKHA 3FUXA 3I4YA 4KO8A 4FCVA 2KRUA 4LFAM 5ITYA 1Q3CA 3IG8A 4XGIA 5BPVA 3UJNA 3FUTA 1H6UA 1N78A 1IXZA 4LF9M 3CF6E 4IBKA 4JXJA 1R7RA 2FE8A 1QZMA 2UXCM 4DR6M 3K8ZA 1IN6A 3LQRA 3L2AA 2VIIA 1SXJD 1Z5AA 2Q2EB 2CUZA 3GQ4A 1SXJC 5ITQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG2 A;  4GHA A;  3FKE A;  3L28 A;  4IBC A;  3L25 A;  4IBD A;  5BPV A;  4IBK A;  4IBJ A;  4IJF A;  3L26 A;  3KS8 A;  3KS4 A;  3L29 A;  4IBG A;  4IBE A;  4IBI A;  4GH9 A;  4IJE A;  3L27 A;  3L2A A;  4IBB A;  4GHL A;  4IBF A; 
#chains in the Genus database with same CATH topology
 4WW0 A;  2LVA A;  4L78 A;  2C5R A;  3MQL A;  3AV0 A;  4A3V B;  4LG2 A;  5KQD A;  4Z2J A;  2ZTC A;  1OTR A;  2OOA A;  3FE3 A;  4GC9 A;  2XEP A;  3ZH9 B;  1OIP A;  2CHV A;  3R8F A;  3L25 A;  4Z2L A;  1C1K A;  1DGG A;  3TPZ A;  2Z7J A;  1XC8 A;  2O01 F;  3CTW B;  1J7K A;  2B3T A;  2I7N A;  3ZQJ A;  4D80 A;  1QUT A;  4MB4 A;  3U5Z B;  1W5T A;  5E26 A;  4NZ4 A;  3F92 A;  1CUK A;  1WXQ A;  4NZ5 A;  4JI4 M;  2KXE A;  4IBE A;  2GQF A;  5FTL A;  4GIT A;  3HU1 A;  1NJG A;  1WJ7 A;  2CP8 A;  4R3D A;  3NBI A;  1ORY B;  5L8R F;  3HHY A;  5IWA M;  1N33 M;  1KYI A;  1BVS A;  2XSZ A;  1HQC A;  3AOE A;  1UFZ A;  1XWI A;  4GIP A;  4X66 M;  3HWS A;  2Y21 A;  3GO8 A;  4DR5 M;  3HJS A;  4FCW A;  1NY5 A;  2K0B X;  3D8L A;  4MGI E;  2LH0 A;  3IEC A;  3HZJ A;  1RU3 A;  4I81 A;  2XSZ D;  1GL6 A;  1OAO C;  3B7Q A;  3HHX A;  1LTM A;  1J09 A;  4LJA A;  4PD2 A;  1CK7 A;  3C58 A;  4I5S A;  4OJO A;  1VQ1 A;  4NSO B;  5ITX A;  2UXD M;  2DWZ B;  1K82 A;  3SMS A;  3KSJ A;  1G3I A;  5EJC A;  3FUU A;  3HJ8 A;  4B7F A;  4JI8 M;  2UUA M;  2QHO B;  4MGK E;  1H8P A;  2DKL A;  4HEO A;  4QHS A;  5FTK A;  2UWX A;  4IBG A;  5EP4 A;  4DUY M;  3T38 A;  1PJS A;  2DAE A;  1NVM A;  2WSF F;  3K2L A;  3UGJ A;  4TUW A;  1QAM A;  4DV6 M;  2V5O A;  2Y2H A;  1IN8 A;  2GNO A;  1L1T A;  3DZD A;  1QAN A;  5C1B A;  4JV5 M;  1R2Y A;  1KS0 A;  4R7G A;  1W1P A;  2QZ4 A;  2WSC F;  5EP3 A;  1NV8 A;  1IBL M;  1GAB A;  1GXD A;  1N32 M;  1L2C A;  2Y2M A;  3FKE A;  1PJI A;  1VDL A;  4NZ3 A;  3N3F A;  1N75 A;  1QVR A;  2C9C A;  3HY5 A;  1OAI A;  5LMU M;  4IBD A;  5JI3 E;  4FWG A;  1D2N A;  1ZAE A;  2KNV A;  1GVN A;  4D81 A;  3K1J A;  2X4A A;  4NRV A;  1L1Z A;  5FSW A;  5FTM A;  1QZE A;  3B74 A;  2M60 A;  2HHH M;  4QOS A;  3TE6 A;  1C7Y A;  4QNM A;  2Y2N A;  2HL7 A;  2R65 A;  1TR8 A;  2DHY A;  4B3S M;  3U6O A;  2JZ0 A;  2OQ4 A;  4NY2 A;  1Q39 A;  4LGY A;  4GH9 A;  4GKK M;  3IG5 A;  5GKN A;  1IXS B;  3U6D A;  3J27 B;  3GPX A;  3GLI B;  3M7G A;  3THG A;  4FD2 A;  5BR8 M;  1XMQ M;  3RFW A;  1W5S A;  2APL A;  1G41 A;  3M0E A;  3HJQ A;  3KOW E;  1N77 A;  4LF5 M;  2L7H A;  4LJ4 A;  1E8B A;  2JUJ A;  2JZ1 A;  2R62 A;  1QDR A;  2I7P A;  3SAS A;  4LY6 A;  2P5T A;  4LJ5 A;  3T1H M;  3U5Z A;  3U60 B;  2XZU A;  1GOI A;  3FRH A;  3SYK A;  1ZV1 A;  2Z3X A;  4Z2G A;  2DZL A;  3WD0 A;  2Y2I A;  1TH2 A;  4GMQ A;  3GP1 A;  2ZTD A;  3KOY E;  5EP2 A;  3VKH A;  1ZMU A;  2QP9 X;  2LTU A;  4MM3 B;  1Y8G A;  2DWL A;  2FN2 A;  4JI3 M;  4B08 A;  3EIH A;  3LQQ A;  1MJG M;  4OVZ B;  4DV1 M;  2BG1 A;  2KNZ A;  4IJE A;  4MGH A;  3CF2 A;  4GHL A;  4OJ5 A;  3E4R A;  3GQ3 A;  2QCU A;  1J5E M;  4ANR A;  1N34 M;  1ZMW A;  1GJS A;  4G6Z A;  2C96 A;  2E5L M;  3WD1 A;  2VQE M;  2RRU A;  2OOB A;  3LMM A;  2Y20 A;  3W0L B;  4JI5 M;  1L6J A;  1H0I A;  2XH9 A;  4NYU A;  4LJ8 A;  1SG9 A;  4R71 A;  4B3M M;  4AW4 A;  2VF8 A;  3AFH A;  3SC3 A;  3TWL A;  5JI2 E;  1XMO M;  1XXH B;  4Z6Y A;  1OFI A;  3Q8G A;  3QYE A;  3E46 A;  1IFY A;  1JQJ C;  3L29 A;  1HQY E;  2NQ8 C;  1D0M A;  2XZF A;  2XFS A;  4Z2I A;  1R6B X;  2VDB B;  4B3T M;  2XF3 A;  1E9R A;  2Y2Q A;  1E94 E;  2R18 A;  1IN7 A;  4AQY M;  4DR2 M;  3GRU A;  3I04 M;  2DI0 A;  1EAK A;  3H4J A;  2DAM A;  4KT0 F;  3J80 S;  4AG6 A;  3GLF B;  2QSF X;  1QUS A;  1UM8 A;  2WSE F;  2DXI A;  3WX7 A;  2F5S A;  2G8L A;  4GHA A;  3T6P A;  4NRW A;  1H0G A;  2C9O A;  4LJ7 A;  2JWS A;  5IZ7 D;  3SBJ A;  4BBA A;  4JI0 M;  4F2L A;  4P16 A;  2R45 A;  1YE9 A;  1YUE A;  3MMP A;  1YU2 A;  4L16 A;  1O6I A;  3TQS A;  2R4E A;  1QAQ A;  3PFI A;  2Z4S A;  1TDH A;  1NHW C;  1YLA A;  2BJV A;  3KS8 A;  4LRS A;  4LZJ A;  1E6N A;  2OPF A;  4QHT A;  1IXS A;  1QQW A;  3WHK A;  3GLH B;  4Z2K A;  3GLI A;  1DV0 A;  3GPU A;  1DGH B;  3LCU A;  1A5T A;  3J2P B;  3SFZ A;  2ERC A;  3HKP A;  4AG5 A;  2UUB M;  4GKJ M;  1IY2 A;  1NJF A;  1DGB A;  2L4E A;  4G4O A;  3PVS A;  1Z6T A;  4DV4 M;  4NXM M;  3FTE A;  3HHW A;  1NY6 A;  1PJT A;  3HU3 A;  4DR3 M;  1OJL A;  4KLN A;  3JR5 A;  4Y28 F;  1YU0 A;  4NYY A;  2VF7 A;  2YNM D;  3FYD A;  3HGI A;  2DHR A;  3AOE C;  3WD3 A;  1OGG A;  2LVP C;  2C98 A;  1NO1 A;  2ZAO A;  2ZAN A;  1TGU A;  3KDS E;  3ZCB B;  5KO3 A;  2Y2L A;  1ED7 A;  1X37 A;  1WHC A;  1AIW A;  3K92 A;  4GRI A;  4OVZ A;  2RTS A;  3KS4 A;  2Y2O A;  4EIW A;  2RGH A;  2R4J A;  4LJ6 A;  3LVV A;  1ZMV A;  2V6Z M;  3KSX A;  1FNN A;  4DBG B;  4F1I A;  4IBI A;  1EIJ A;  3ZC7 B;  3PXG A;  3CGW A;  4K0K M;  4FWD A;  4TX8 A;  2KEB A;  2KZS A;  4I4L A;  4OJP A;  4IBB A;  3GRV A;  3WD4 A;  4QNL A;  3AKZ A;  4OW0 A;  1PJQ A;  1WR1 B;  2CE7 A;  2KA6 B;  2J7O A;  2OO9 A;  4B7H A;  3EIE A;  1MX0 A;  1YU3 A;  3E21 A;  1W1V A;  4LFC M;  4LRT A;  4QOZ C;  3M6A A;  4IBC A;  3SAT A;  1YU4 A;  3M7P A;  1E32 A;  3E9S A;  3B9P A;  3FTD A;  3I51 A;  1PRB A;  4RF1 A;  4CGY B;  1XXH A;  4CJ6 A;  4OX9 M;  1IBM M;  1YUB A;  1HJP A;  4IIW A;  4DV5 M;  4QNR A;  3FD9 A;  2L7I A;  4P17 A;  4HL4 A;  1N36 M;  2Y2K A;  2EKF A;  2R44 A;  1GLN A;  3W68 A;  1SXJ B;  2XFT A;  3GLF A;  2ZM6 M;  3HON A;  2L09 A;  1V92 A;  2BNK A;  3GLI E;  3T1Y M;  1TH4 A;  1K3W A;  4M9Z A;  2LVO C;  1Z59 A;  1UR8 A;  5DNY A;  2MJ5 B;  2LWX A;  2D7G A;  4RKU F;  1VEK A;  3A45 A;  3GPY A;  2L4F A;  4HMD A;  4AI6 A;  1EE8 A;  1IY1 A;  1G4A E;  1GPF A;  2J7N A;  7CAT A;  3A98 B;  2MR9 A;  3B7Z A;  5ITT A;  4WUR A;  4AZF A;  1F4I A;  1E6R A;  1OGB A;  3HSH A;  4LCB A;  4CIZ A;  3BXW A;  4GC5 A;  4Z2H A;  3SHF A;  1G8P A;  3T15 A;  3GLH A;  1T3T A;  1IM2 A;  5KPR A;  4DR7 M;  1DGH A;  4JI1 M;  4JYA M;  2L2D A;  1QYR A;  2KDL A;  3RGP A;  4G3O A;  4BLC A;  4X62 M;  4DV7 M;  1V34 A;  4WP2 A;  4LF7 M;  3C3E A;  1GJT A;  4ZPX A;  2G3Q A;  5KPZ A;  2F4V M;  2JY8 A;  1GKI A;  3C9P A;  1V33 A;  2VQF M;  1OQY A;  4S12 A;  4HMC A;  2F5P A;  2JY7 A;  2MH8 A;  3QWL A;  2Y2G A;  3C3D A;  2WZJ A;  1HT2 E;  4X64 M;  1YU1 A;  2LHG A;  3SAW A;  4L4U A;  1NV9 A;  2C99 A;  5EQT A;  2O5R A;  3VDU A;  1OIZ A;  4AKG A;  2LVQ D;  4JI2 M;  3U6L A;  2CWB A;  2CEA A;  2YQZ A;  2QBY B;  1FJG M;  5KQ8 A;  4PDI A;  2UU9 M;  3SAR A;  3JAM S;  2AHM A;  4UN2 B;  3JR4 A;  2DAK A;  3W0F A;  1S3S A;  4RF0 A;  2Z4R A;  1IY0 A;  3WHL A;  5A2Q S;  2CFO A;  1XXH E;  3FUV A;  4IBJ A;  4HME A;  1D0K A;  3H4M A;  1XNQ M;  2QEN A;  3KP0 E;  2CHQ A;  3DA1 A;  1OKS A;  2BWB A;  8CAT A;  4DV3 M;  2LNH C;  2JA2 A;  4LGM A;  3IHP A;  1AUA A;  5DFL A;  3KFU G;  4M0W A;  1T6O A;  1NNJ A;  3GLF E;  2A5Y B;  5DYI A;  3U6S A;  4PCZ A;  4CIS A;  3J81 S;  3OTO M;  1L2D A;  2DWN A;  2XD5 A;  2KHH A;  3MJ5 A;  4LF8 M;  4L8R C;  1NNU C;  1TTE A;  2F5Q A;  4Z8X A;  4LF4 M;  1WIV A;  4DV2 M;  3U6C A;  1XNR M;  4KHP M;  2FFF B;  2BJW A;  4XK8 F;  4OJL A;  4DR4 M;  4REZ A;  4PT5 A;  4NOO B;  4FW9 A;  4X65 M;  2FOI C;  2V1C A;  1GL7 A;  3VK7 A;  4YY3 M;  3HU2 A;  4FCT A;  2FS1 A;  1SXJ A;  1J7M A;  3GLH E;  1PDC A;  4G4N A;  3UZU A;  2DWM A;  5H37 D;  2H1R A;  2JP7 A;  3KVW A;  3L27 A;  4JI7 M;  3AL0 C;  3HHZ A;  2RGO A;  4XBO A;  2LXE A;  5FTJ A;  3VLF B;  4DR1 M;  4LF6 M;  2LBC A;  3SHG B;  3MHV C;  3HX3 A;  1XHB A;  4DV0 M;  3VKG A;  3U60 A;  1ZQ9 A;  5EXT A;  1EFU B;  4MGY E;  1GO5 A;  3QYB A;  4HLQ A;  4II7 A;  3K9P A;  2JNH A;  1I94 M;  4I8O A;  3QAU A;  4NZ1 A;  1E15 A;  3FRI A;  1LV7 A;  4KOD A;  4MB5 A;  1VDD A;  2EO2 A;  4BB9 A;  3L26 A;  3U6E A;  4M0D A;  2V1U A;  2K47 A;  2QPA A;  5EXS A;  2KW0 A;  3U61 B;  1T43 A;  1P3Q Q;  1QO6 A;  2MRO B;  2BWE A;  1Q02 A;  1IXR C;  1VEG A;  1HR0 M;  1W1T A;  3AOG A;  1E6P A;  4DUZ M;  3KOX E;  2DAG A;  4IBF A;  3VK8 A;  2XD1 A;  3K9O A;  2QBY A;  3GQ5 A;  5LMN M;  1L8Q A;  4M9S A;  1R5L A;  1XB2 B;  3GLG E;  1PM5 A;  1JR3 A;  2XGN A;  2CV1 A;  3B7N A;  1Q3B A;  3I4V A;  1TDZ A;  4OU7 A;  2YR0 A;  3W67 A;  2DVW B;  1WGL A;  3GLG B;  2R6F A;  3L28 A;  1Z5B A;  4FVM A;  1R2Z A;  2JY6 B;  4NSR A;  4NL4 H;  2UXB M;  2Y2P A;  2D7E A;  3LVW A;  1TH3 A;  4M9X A;  3SYL A;  4D82 A;  1JR3 D;  1E88 A;  4B7G A;  2FNA A;  1CXW A;  2KRK A;  3SAU A;  1HNZ M;  3J7B A;  2LVN C;  4OUI A;  3V76 A;  3TWK A;  5FTN A;  2LHC A;  5EXP A;  3VFD A;  4L6V 6;  2K9D A;  2N35 A;  2R0I A;  2Y2J A;  4MGZ E;  2F5N A;  2QQ8 A;  1SXJ E;  5FLX S;  2UUC M;  4CHT B;  1D0L A;  3LCV B;  3TL4 X;  3A46 A;  1IBK M;  3U6P A;  3FTF A;  1W1Y A;  2HKJ A;  4JI6 M;  1IN5 A;  2O25 A;  3PNY A;  2M5Z A;  2RKO A;  2ZBK B;  2EKK A;  2K6B A;  3NBX X;  3TWM A;  2D49 A;  1UR9 A;  1OFH A;  2ZAM A;  1PJJ A;  4LFB M;  2D7H A;  1NSF A;  2DZN B;  2JCH A;  1PGY A;  3PNV A;  1IQP A;  1E6Z A;  4W5W A;  1HT1 E;  2EUC A;  4FWH A;  2KZU A;  3BOS A;  5KPT A;  2G5G X;  2CV2 A;  5IRE B;  2Y0Q A;  3KXE C;  3MK6 A;  3VDP A;  1I4W A;  3RE8 A;  4MH0 E;  1DO0 A;  3U6M A;  2F5O A;  3FUW A;  4IJF A;  3UK6 A;  1G59 A;  3KP1 E;  1KFV A;  1R4G A;  4Q7J A;  2X8A A;  4NXN M;  3WD2 A;  4AKI A;  1QAO A;  2W82 A;  2Z8Y M;  2FFJ A;  2HWJ A;  4MB3 A;  3KOZ E;  3Q8X A;  1VEJ A;  4PDG A;  3UMM A;  3CF0 A;  3I01 M;  4MB7 A;  1NHG C;  1YSY A;  3BBZ A;  3NWL A;  3RGS A;  2L6O A;  3D8B A;  2HCB A;  5C18 A;  1Z5C A;  2YFQ A;  1DGF A;  2JXN A;  1HNW M;  3LW5 F;  3AJI B;  1KSF X;  4LZZ A;  1JR3 E;  2XLJ A;  2EA0 A;  3R9X B;  1G71 A;  3SMP A;  3DFZ A;  5DYG A;  4G4Q A;  3GPP A;  3J7A S;  2JE5 A;  1MU5 A;  2MGW A;  4RNA A;  5ITX E;  3KW6 A;  3FYC A;  3U61 A;  4G4R A;  1WGN A;  4OJ6 A;  4L15 A;  2DAI A;  4ITQ A;  3GRR A;  3U6Q A;  2DZO B;  3DOA A;  1K3X A;  2CHG A;  4LJ9 A;  5EP1 A;  2X49 A;  2QNJ A;  4GEW A;  3GRY A;  2H5X A;  2DEN A;  3SAV A;  1IN4 A;  1DO2 A;  4YHH M;  4JN6 A;  3ILK A;  5ITR A;  1L2B A;  3GLG A;  2R46 A;  5F3W A;  4B3R M;  1HNX M;  5E6J A;  1JB0 F;  2CV0 A;  3A42 A;  3FTC A;  1E9S A;  5IT9 S;  3B89 A;  2Y0T A;  4NC6 A;  5EXX A;  5ITU A;  2IOU A;  2CRU A;  4AKH A;  2JY5 A;  3FUX A;  3I4Y A;  4KO8 A;  4FCV A;  2KRU A;  4LFA M;  5ITY A;  1Q3C A;  2J5Y A;  1MN3 A;  2HAK A;  3IG8 A;  4XGI A;  5BPV A;  3UJN A;  2FH0 A;  3FUT A;  1H6U A;  1N78 A;  1IXZ A;  4LF9 M;  3CF6 E;  2EJS A;  4IBK A;  4JXJ A;  1R7R A;  2FE8 A;  1AIP C;  1QZM A;  2DNA A;  2UXC M;  1TF0 B;  4DR6 M;  3K8Z A;  1VG5 A;  2KNA A;  1IN6 A;  1QDT A;  3L2A A;  3LQR A;  2VII A;  1SXJ D;  1Z5A A;  2Q2E B;  2CUZ A;  3GQ4 A;  1SXJ C;  5ITQ A; 
#chains in the Genus database with same CATH homology
 4WW0 A;  4L78 A;  2C5R A;  3AV0 A;  4A3V B;  4LG2 A;  5KQD A;  4GC9 A;  2XEP A;  3ZH9 B;  2CHV A;  3R8F A;  3L25 A;  1C1K A;  1DGG A;  3TPZ A;  2Z7J A;  1XC8 A;  3CTW B;  1J7K A;  2I7N A;  4D80 A;  3U5Z B;  1W5T A;  5E26 A;  4NZ4 A;  1WXQ A;  4NZ5 A;  4JI4 M;  2KXE A;  4IBE A;  5FTL A;  4GIT A;  3HU1 A;  1NJG A;  4R3D A;  3NBI A;  1ORY B;  5IWA M;  3HHY A;  1N33 M;  1KYI A;  2XSZ A;  3AOE A;  1HQC A;  4GIP A;  4X66 M;  1XWI A;  3HWS A;  2Y21 A;  3GO8 A;  4DR5 M;  3HJS A;  4FCW A;  1NY5 A;  3D8L A;  4MGI E;  2LH0 A;  4I81 A;  2XSZ D;  1GL6 A;  3HHX A;  1J09 A;  4LJA A;  4PD2 A;  4OJO A;  3C58 A;  4I5S A;  4NSO B;  5ITX A;  2UXD M;  2DWZ B;  1K82 A;  3SMS A;  3KSJ A;  1G3I A;  5EJC A;  3FUU A;  3HJ8 A;  4B7F A;  4JI8 M;  2UUA M;  4MGK E;  5FTK A;  2UWX A;  4QHS A;  4IBG A;  5EP4 A;  4DUY M;  3T38 A;  3K2L A;  1NVM A;  3HSH A;  3UGJ A;  4TUW A;  1QAM A;  4DV6 M;  2Y2H A;  1IN8 A;  1L1T A;  3DZD A;  1QAN A;  5C1B A;  4JV5 M;  1R2Y A;  4R7G A;  2QZ4 A;  5EP3 A;  1IBL M;  1N32 M;  1L2C A;  2Y2M A;  3FKE A;  1PJI A;  4NZ3 A;  3N3F A;  1N75 A;  1QVR A;  2C9C A;  5LMU M;  4IBD A;  5JI3 E;  4FWG A;  1D2N A;  1ZAE A;  1GVN A;  4D81 A;  3K1J A;  2X4A A;  4NRV A;  1L1Z A;  5FSW A;  5FTM A;  2M60 A;  2HHH M;  4QOS A;  3TE6 A;  4QNM A;  2Y2N A;  2HL7 A;  2R65 A;  4B3S M;  3U6O A;  2OQ4 A;  4NY2 A;  1Q39 A;  4LGY A;  4GH9 A;  4GKK M;  3IG5 A;  5GKN A;  1IXS B;  3U6D A;  3J27 B;  3GPX A;  3GLI B;  3M7G A;  3THG A;  4FD2 A;  5BR8 M;  1XMQ M;  3RFW A;  1W5S A;  1G41 A;  3M0E A;  3HJQ A;  3KOW E;  1N77 A;  4LF5 M;  2L7H A;  4LJ4 A;  2R62 A;  2I7P A;  3SAS A;  4LY6 A;  2P5T A;  4LJ5 A;  3T1H M;  3U5Z A;  3U60 B;  2XZU A;  3SYK A;  2Z3X A;  2Y2I A;  1TH2 A;  4GMQ A;  3GP1 A;  3KOY E;  5EP2 A;  3VKH A;  2QP9 X;  4MM3 B;  2DWL A;  4JI3 M;  4B08 A;  3EIH A;  3LQQ A;  4OVZ B;  4DV1 M;  2BG1 A;  4IJE A;  4MGH A;  3CF2 A;  4GHL A;  4OJ5 A;  3E4R A;  3GQ3 A;  2QCU A;  1J5E M;  1N34 M;  4G6Z A;  2C96 A;  2E5L M;  2VQE M;  3LMM A;  2Y20 A;  3W0L B;  4JI5 M;  2XH9 A;  4NYU A;  4LJ8 A;  4B3M M;  4AW4 A;  3TWL A;  3AFH A;  3SC3 A;  5JI2 E;  1XMO M;  1XXH B;  4Z6Y A;  1OFI A;  1JQJ C;  3L29 A;  1HQY E;  2NQ8 C;  2XZF A;  2XFS A;  1R6B X;  4B3T M;  2XF3 A;  1E9R A;  2Y2Q A;  1E94 E;  2R18 A;  1IN7 A;  4AQY M;  4DR2 M;  3GRU A;  3J80 S;  4AG6 A;  3GLF B;  1UM8 A;  2DXI A;  3WX7 A;  2F5S A;  2G8L A;  4GHA A;  4NRW A;  2C9O A;  4LJ7 A;  5IZ7 D;  3SBJ A;  4BBA A;  4JI0 M;  4P16 A;  2R45 A;  1YE9 A;  1YUE A;  1YU2 A;  4L16 A;  3TQS A;  2R4E A;  1QAQ A;  3PFI A;  2Z4S A;  1TDH A;  1NHW C;  2BJV A;  3KS8 A;  4LRS A;  4LZJ A;  2OPF A;  4QHT A;  3WHK A;  1QQW A;  3GLH B;  3GLI A;  3GPU A;  1DGH B;  3J2P B;  4AG5 A;  3SFZ A;  2ERC A;  3HKP A;  2UUB M;  4GKJ M;  1IY2 A;  1NJF A;  1DGB A;  4G4O A;  3FTE A;  3PVS A;  1Z6T A;  4DV4 M;  4NXM M;  3HHW A;  1NY6 A;  3HU3 A;  4DR3 M;  1OJL A;  4KLN A;  3JR5 A;  1YU0 A;  4NYY A;  2YNM D;  3FYD A;  3HGI A;  2DHR A;  3AOE C;  2ZAO A;  2C98 A;  3KDS E;  2ZAN A;  3ZCB B;  1TGU A;  5KO3 A;  2Y2L A;  1X37 A;  3K92 A;  4GRI A;  4OVZ A;  3KS4 A;  2Y2O A;  4EIW A;  2RGH A;  2R4J A;  4LJ6 A;  3LVV A;  2V6Z M;  3KSX A;  1FNN A;  4IBI A;  3ZC7 B;  3PXG A;  4K0K M;  4FWD A;  2KEB A;  2KZS A;  4I4L A;  4OJP A;  4IBB A;  3GRV A;  4QNL A;  3AKZ A;  4OW0 A;  2CE7 A;  2KA6 B;  2J7O A;  4B7H A;  3EIE A;  1MX0 A;  1YU3 A;  4LFC M;  4LRT A;  4QOZ C;  3M6A A;  4IBC A;  3SAT A;  1YU4 A;  1E32 A;  3E9S A;  3B9P A;  3FTD A;  3I51 A;  4RF1 A;  4CGY B;  1XXH A;  4OX9 M;  1IBM M;  1YUB A;  4IIW A;  4DV5 M;  4QNR A;  3FD9 A;  2L7I A;  1N36 M;  4HL4 A;  2Y2K A;  1GLN A;  1SXJ B;  2XFT A;  3GLF A;  2ZM6 M;  3HON A;  2L09 A;  2BNK A;  3T1Y M;  1TH4 A;  1K3W A;  4M9Z A;  1Z59 A;  5DNY A;  2LWX A;  2D7G A;  3A45 A;  3GPY A;  4AI6 A;  1EE8 A;  1IY1 A;  1G4A E;  2J7N A;  7CAT A;  3A98 B;  5ITT A;  4WUR A;  4AZF A;  4LCB A;  4GC5 A;  3SHF A;  1G8P A;  3T15 A;  3GLH A;  1T3T A;  1IM2 A;  5KPR A;  4DR7 M;  1DGH A;  4JI1 M;  4JYA M;  1QYR A;  3RGP A;  4DV7 M;  4BLC A;  4X62 M;  4LF7 M;  4ZPX A;  5KPZ A;  2F4V M;  1GKI A;  2VQF M;  4S12 A;  2F5P A;  3QWL A;  2Y2G A;  4X64 M;  1YU1 A;  1HT2 E;  3SAW A;  4L4U A;  5EQT A;  2C99 A;  3VDU A;  2O5R A;  4AKG A;  4JI2 M;  3U6L A;  2QBY B;  2CEA A;  2YQZ A;  1FJG M;  5KQ8 A;  4PDI A;  2UU9 M;  3SAR A;  3JAM S;  2AHM A;  3JR4 A;  3W0F A;  1S3S A;  4RF0 A;  2Z4R A;  1IY0 A;  3WHL A;  5A2Q S;  2CFO A;  3FUV A;  4IBJ A;  1XNQ M;  3H4M A;  2QEN A;  3KP0 E;  2CHQ A;  3DA1 A;  8CAT A;  4DV3 M;  2LNH C;  2JA2 A;  4LGM A;  3KFU G;  4M0W A;  1NNJ A;  3U6S A;  2A5Y B;  5DYI A;  4CIS A;  4PCZ A;  2XD5 A;  3J81 S;  3OTO M;  1L2D A;  2DWN A;  3MJ5 A;  4LF8 M;  4L8R C;  1NNU C;  2F5Q A;  4LF4 M;  4Z8X A;  4DV2 M;  3U6C A;  1XNR M;  4KHP M;  2FFF B;  2BJW A;  4OJL A;  4DR4 M;  4REZ A;  4PT5 A;  4NOO B;  4FW9 A;  4X65 M;  2FOI C;  2V1C A;  1GL7 A;  3VK7 A;  4YY3 M;  3HU2 A;  4FCT A;  1SXJ A;  4G4N A;  3UZU A;  2DWM A;  5H37 D;  2H1R A;  3KVW A;  3L27 A;  4JI7 M;  3AL0 C;  3HHZ A;  2RGO A;  4XBO A;  2LXE A;  5FTJ A;  3VLF B;  4DR1 M;  4LF6 M;  3SHG B;  3MHV C;  1XHB A;  4DV0 M;  3VKG A;  3U60 A;  1ZQ9 A;  5EXT A;  4MGY E;  4HLQ A;  4II7 A;  1I94 M;  4I8O A;  3QAU A;  4NZ1 A;  1LV7 A;  4KOD A;  1VDD A;  2EO2 A;  4BB9 A;  3L26 A;  3U6E A;  4M0D A;  2V1U A;  2K47 A;  2QPA A;  5EXS A;  2KW0 A;  3U61 B;  1IXR C;  1HR0 M;  3AOG A;  4DUZ M;  3KOX E;  2XD1 A;  4IBF A;  3VK8 A;  2QBY A;  3GQ5 A;  5LMN M;  1L8Q A;  4M9S A;  2CV1 A;  1PM5 A;  1JR3 A;  2XGN A;  3I4V A;  1Q3B A;  1TDZ A;  4OU7 A;  2YR0 A;  2DVW B;  3GLG B;  3L28 A;  1Z5B A;  4FVM A;  1R2Z A;  4NSR A;  4NL4 H;  2UXB M;  2Y2P A;  2D7E A;  3LVW A;  1TH3 A;  4M9X A;  3SYL A;  4D82 A;  1JR3 D;  4B7G A;  2FNA A;  2KRK A;  3SAU A;  1HNZ M;  3J7B A;  4OUI A;  3TWK A;  5FTN A;  5EXP A;  3VFD A;  2Y2J A;  4MGZ E;  2F5N A;  1SXJ E;  5FLX S;  2UUC M;  4CHT B;  3TL4 X;  3A46 A;  1IBK M;  3U6P A;  3FTF A;  2HKJ A;  4JI6 M;  1IN5 A;  3PNY A;  2M5Z A;  2RKO A;  2ZBK B;  3TWM A;  1OFH A;  2ZAM A;  1PJJ A;  4LFB M;  2D7H A;  1NSF A;  2DZN B;  2JCH A;  3PNV A;  1IQP A;  4W5W A;  1HT1 E;  2EUC A;  4FWH A;  2KZU A;  3BOS A;  5KPT A;  2G5G X;  2CV2 A;  5IRE B;  2Y0Q A;  3KXE C;  3MK6 A;  3VDP A;  1I4W A;  3RE8 A;  4MH0 E;  1DO0 A;  3U6M A;  2F5O A;  3FUW A;  4IJF A;  3UK6 A;  1G59 A;  3KP1 E;  1KFV A;  2X8A A;  4NXN M;  4AKI A;  1QAO A;  2W82 A;  2FFJ A;  3KOZ E;  3Q8X A;  4PDG A;  3UMM A;  3CF0 A;  4MB7 A;  1NHG C;  1YSY A;  3RGS A;  3NWL A;  2L6O A;  3D8B A;  2HCB A;  5C18 A;  1Z5C A;  2YFQ A;  1DGF A;  1HNW M;  3AJI B;  1KSF X;  4LZZ A;  3R9X B;  2XLJ A;  2EA0 A;  3SMP A;  3DFZ A;  5DYG A;  4G4Q A;  3GPP A;  3J7A S;  2JE5 A;  1MU5 A;  4RNA A;  5ITX E;  3KW6 A;  3FYC A;  3U61 A;  4G4R A;  4OJ6 A;  4L15 A;  4ITQ A;  3GRR A;  3U6Q A;  2DZO B;  3DOA A;  1K3X A;  2CHG A;  4LJ9 A;  5EP1 A;  2X49 A;  3GRY A;  3SAV A;  1IN4 A;  1DO2 A;  4YHH M;  4JN6 A;  3ILK A;  5ITR A;  1L2B A;  3GLG A;  2R46 A;  5F3W A;  4B3R M;  1HNX M;  5E6J A;  2CV0 A;  3A42 A;  3FTC A;  1E9S A;  5IT9 S;  2IOU A;  2Y0T A;  5EXX A;  5ITU A;  4AKH A;  3FUX A;  3I4Y A;  4KO8 A;  4FCV A;  2KRU A;  4LFA M;  5ITY A;  1Q3C A;  3IG8 A;  4XGI A;  5BPV A;  3UJN A;  3FUT A;  1H6U A;  1N78 A;  1IXZ A;  4LF9 M;  3CF6 E;  4IBK A;  4JXJ A;  1R7R A;  2FE8 A;  1QZM A;  2UXC M;  4DR6 M;  3K8Z A;  1IN6 A;  3LQR A;  3L2A A;  2VII A;  1SXJ D;  1Z5A A;  2Q2E B;  2CUZ A;  3GQ4 A;  1SXJ C;  5ITQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...