4IBGA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibgA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibgA02
4IBCA 4IBBA 3L28A 4IBKA 3KS4A 3L27A 5BPVA 4IJFA 3KS8A 4GHLA 4GHAA 4IBGA 4GH9A 3L26A 4IBDA 4LG2A 3FKEA 3L2AA 4IBIA 3L29A 4IBFA 4IJEA 4IBJA 4IBEA 3L25A
chains in the Genus database with same CATH superfamily
2Z7JA 2EJSA 2R6FA 4IBBA 3PXGA 1PJIA 2BJWA 4LJ9A 1YU0A 4CHTB 3SC3A 1DV0A 1ZMUA 4ITQA 2J7NA 4DR6M 4ANRA 1XMOM 2DAMA 5EP4A 4BBAA 2QSFX 4I8OA 2BG1A 1XHBA 5EXTA 3RFWA 4REZA 3KP1E 1VQ1A 4W5WA 2F5OA 1R4GA 1IY2A 5LMNM 3HHYA 1YSYA 1NV8A 4CISA 1IXZA 4QNLA 2KZSA 3E21A 2L4EA 1NJGA 1XC8A 1HT2E 4MB7A 3NBXX 1C7YA 1PJJA 4IBEA 1XXHE 3FUVA 4HMEA 1OIPA 1KSFX 2ERCA 2ZBKB 3TWMA 3WHKA 5A2QS 3GPUA 3GQ5A 4LJ6A 3GPXA 1GXDA 1W1TA 1ZMVA 4IBKA 4NZ3A 2DAIA 3L27A 2UUBM 3SAVA 4X62M 3FRIA 5EQTA 3RGPA 2JP7A 3LVVA 3UGJA 4TX8A 4I4LA 4P17A 1CUKA 2R44A 2CV2A 4HMCA 3HHXA 1PJTA 3E46A 4UN2B 3FE3A 2R0IA 1OFHA 1T3TA 2XF3A 3JR5A 4FWDA 5FTLA 1G71A 2V1UA 5IT9S 1E88A 1TDZA 3TQSA 2BWEA 3SATA 2VDBB 4LFBM 1TTEA 3GRVA 3GLHB 5LMUM 2RTSA 3VDUA 2CHQA 2QZ4A 1FJGM 1NSFA 2LBCA 4NZ1A 1DO2A 1XXHB 1EE8A 2HKJA 2JA2A 1MX0A 1IY0A 3GQ4A 2ZANA 3VLFB 2JZ0A 1QUSA 1HNWM 2OOBA 1WIVA 1AIWA 3L28A 3B74A 5FTMA 4DBGB 1O6IA 2DI0A 3C3EA 5EXPA 3HJ8A 3I01M 4DR5M 3ZH9B 4FVMA 2BJVA 2QHOB 2JY5A 4OJ6A 2RGOA 4DV4M 2YNMD 3DA1A 1V92A 2P5TA 1YU4A 2OOAA 4X66M 5H37D 4Z6YA 1IXRC 3HHWA 4X64M 3FUUA 1FNNA 4DV7M 2Y2NA 1IY1A 1SXJC 1GVNA 3VDPA 4F1IA 2QBYA 3SAWA 1QDRA 1WGNA 2QQ8A 4I5SA 3TWLA 5EP3A 3U6CA 3L25A 4NXNM 4F2LA 1N77A 2L6OA 3WX7A 2CFOA 4Z2LA 2VQFM 4NYUA 2WZJA 1N34M 2CE7A 3GPPA 1ED7A 3QWLA 1LV7A 3KFUG 4TUWA 4Z2JA 1E6NA 4AI6A 8CATA 2EO2A 1E6RA 2C98A 3K92A 1VDLA 3J7BA 4M9SA 4G4NA 1L8QA 1E32A 2Y2HA 2W82A 4LJ5A 1KYIA 3R8FA 1L1ZA 1E6ZA 1NHGC 1QVRA 4WURA 4B3SM 3LMMA 2RKOA 3E9SA 2Y2JA 2M5ZA 2VQEM 3AOEA 4LRSA 2LHGA 4L6V6 2X49A 3GRUA 4LRTA 1D0LA 1G4AE 2CHGA 4RKUF 4M9ZA 4IBJA 1R6BX 3AKZA 1QO6A 1IN5A 3W68A 4IBCA 3W0LB 3SARA 3WD1A 1IBLM 1JR3A 2FH0A 1OFIA 3VFDA 3W67A 3GLGA 2DXIA 4PD2A 2UUAM 2DZNB 2WSCF 1E94E 1R5LA 3FUTA 4EIWA 4L4UA 3H4MA 2OQ4A 4NL4H 3GLHE 2UUCM 1Q3CA 4NRVA 4Z2IA 1OKSA 4AW4A 1GLNA 5EXXA 4ZPXA 4JI1M 2XZFA 1W5SA 1UM8A 1ZAEA 4OVZB 3U6DA 3U61A 2DWNA 4RF0A 4GHAA 1N78A 3MJ5A 1X37A 4LF4M 1TR8A 3NWLA 4AG5A 4PDIA 4LF9M 3C3DA 2XFTA 3BBZA 3KVWA 4QNRA 2LNHC 4G6ZA 3ZCBB 4NOOB 4G4QA 3HU3A 4GEWA 1E15A 2LVAA 4KLNA 3MK6A 1IBMM 3AFHA 3FTFA 4K0KM 2KNZA 2VF8A 1J7MA 2ZTDA 3FRHA 3VK8A 3H4JA 2NQ8C 1XB2B 3GLIB 2Y2LA 2JNHA 3J80S 1MN3A 5IWAM 3BOSA 3U6MA 3B7NA 1L2BA 3PNVA 2J5YA 2D49A 3U6QA 2ZM6M 2UXBM 2KRUA 1EFUB 2I7NA 2C96A 3GRRA 4GITA 3KOZE 1R2YA 4HLQA 1SXJD 1NO1A 1Q02A 2KW0A 2R4EA 3AOGA 4XK8F 2Z8YM 4M9XA 4NXMM 1L2DA 2DZOB 3MHVC 2QBYB 3L26A 3GQ3A 2HAKA 4JI8M 1XNQM 1E8BA 4CIZA 4L78A 4LJ4A 1R7RA 4L8RC 3FTEA 3UZUA 1T43A 2Q2EB 3HU2A 4MM3B 4QHTA 2DAEA 3SYLA 4DR7M 1H0GA 1Z59A 2V5OA 1J5EM 3DFZA 3E4RA 1HT1E 1VEGA 2KDLA 1HQYE 1H6UA 1K3WA 2Y2PA 3HSHA 4R3DA 2CHVA 2JY8A 1E9RA 5EJCA 5BR8M 3GLFA 3AV0A 5ITYA 1SXJB 2J7OA 5ITXA 1WHCA 1AUAA 2VF7A 4JXJA 2DHRA 3I04M 4M0DA 4Z2HA 2MR9A 1PGYA 1ZMWA 1YU1A 1HNXM 1XMQM 2FNAA 4NC6A 1IXSA 3HZJA 5DYIA 3D8BA 1DGBA 1HR0M 1QZEA 3QYEA 2APLA 2MROB 1SXJA 2DWLA 3VKHA 1PDCA 1TDHA 3C9PA 3AJIB 2LH0A 3T38A 3CF6E 4IJEA 2D7HA 4D80A 2KHHA 3B89A 2ZAMA 1OJLA 3LCVB 3UJNA 2Y2OA 1IN7A 3U6EA 1H8PA 5FSWA 1NNJA 2Y20A 3LW5F 5F3WA 2A5YB 3HY5A 2D7EA 4NRWA 4OJLA 4B3MM 2G8LA 4AKHA 4IIWA 3TWKA 4GKJM 7CATA 3J27B 4JI3M 2UXCM 5BPVA 4MGZE 2IOUA 4YHHM 4DV2M 3B7ZA 4Z2KA 3KS8A 2HL7A 2C9OA 2UWXA 3CF0A 1F4IA 1YUBA 3U60A 1H0IA 2YR0A 4DR1M 2L2DA 3W0FA 5JI3E 2Y0TA 4PCZA 1G59A 4HEOA 4BLCA 3R9XB 2K9DA 4NZ4A 3FKEA 2FFJA 3FTDA 1D0MA 2KNVA 3PVSA 2B3TA 3KP0E 2CP8A 2KNAA 3D8LA 5E26A 3T1YM 2EKKA 2X4AA 2R46A 1DGHB 1IN6A 3I4YA 5FTKA 4DV6M 4FD2A 2FS1A 1K82A 1WXQA 3SMSA 1OTRA 5KPRA 4DV0M 1Z5CA 1GO5A 1S3SA 4QOSA 1Z5BA 1IM2A 3K9PA 3M0EA 5ITXE 1WGLA 4CJ6A 3J2PB 4CGYB 4D81A 3SFZA 3GLFB 4OJ5A 3U5ZA 1HJPA 3IHPA 3J7AS 3U60B 2F5QA 2L7IA 1YU2A 5GKNA 1KFVA 4FCWA 4DUZM 4B3TM 3WD0A 4GRIA 1QANA 5JI2E 3M7PA 4R7GA 5L8RF 4LJ7A 3THGA 4OJPA 1NHWC 2DAKA 3A42A 2F5SA 2D7GA 1PM5A 3M6AA 4JI4M 1VG5A 2FOIC 2XGNA 3DZDA 4LJAA 4G4OA 2O5RA 1TH3A 2N35A 1PJQA 3GP1A 3B9PA 3A45A 5E6JA 1NNUC 4JYAM 4AG6A 2QENA 2JWSA 1G3IA 2KRKA 3U5ZB 2OO9A 5EP1A 1W1PA 3U6OA 4LF8M 3HONA 1YUEA 2R62A 1IN4A 4L15A 1GL7A 2QPAA 4XGIA 4JV5M 3IG5A 1L1TA 1C1KA 2XZUA 2DHYA 3KSJA 1RU3A 1VEJA 3UMMA 3SBJA 3Q8XA 4DR4M 4GC9A 4NSRA 2DWZB 1J7KA 5DYGA 4IBDA 1Z6TA 3L2AA 4OX9M 2CV0A 3F92A 4NY2A 2EA0A 3FUWA 4B7HA 1DGGA 1QAMA 3K1JA 2Z4SA 2RRUA 4JI5M 2Y2KA 1R2ZA 3WHLA 2F5NA 4L16A 1QDTA 2HWJA 3K9OA 1E6PA 4KODA 4II7A 1IQPA 1GL6A 1E9SA 3LCUA 1G41A 1XWIA 2FFFB 4MGYE 2XEPA 4YY3M 2H5XA 5C18A 1ZQ9A 3PNYA 3KS4A 4KHPM 1IN8A 2WSFF 3OTOM 1DGFA 1Q3BA 3KOYE 1N36M 2JE5A 2GQFA 2KZUA 4AQYM 2F4VM 4KT0F 2DVWB 1P3QQ 3JR4A 5C1BA 1L6JA 3U6PA 2R45A 3DOAA 3HJSA 3RGSA 2C5RA 3EIEA 1NY5A 4LGMA 2DKLA 5KQ8A 4GC5A 4Q7JA 4IBIA 3L29A 4RNAA 2FE8A 5KQDA 4GKKM 2HCBA 1W5TA 2K47A 1GKIA 3KDSE 2XD5A 3K2LA 1MJGM 3U61B 2OPFA 4MB4A 2KA6B 1G8PA 1YE9A 2LVOC 4I81A 1K3XA 3HWSA 1DO0A 1A5TA 1WR1B 3HX3A 2L4FA 2M60A 3U6SA 2QNJA 3TL4X 3IECA 3PFIA 2XD1A 1ORYB 4WP2A 4B7FA 3SHGB 3GO8A 2JZ1A 3U6LA 2G3QA 2HHHM 2Y2QA 1EAKA 2ZAOA 2Z4RA 1D2NA 4FWHA 3LQQA 2EKFA 1YLAA 4G4RA 1Z5AA 2R4JA 2XLJA 4LG2A 1GPFA 1N75A 2DZLA 4KO8A 3SYKA 1OIZA 4OU7A 1NY6A 1V34A 4M0WA 1QZMA 2Y0QA 3JAMS 5ITTA 3CTWB 3MQLA 5IZ7D 2JCHA 3UK6A 4LGYA 2XSZD 1Y8GA 4LF5M 1IFYA 5FTJA 3FUXA 2LHCA 4MGHA 3ILKA 1QUTA 3HU1A 2BNKA 1GJTA 2DENA 4GMQA 4S12A 3RE8A 4FW9A 3NBIA 1QAOA 2YFQA 4B3RM 4DR2M 4QOZC 2Y2GA 4OJOA 3J81S 3VKGA 2LTUA 2MGWA 2RGHA 4GIPA 4JI0M 5ITQA 2LVPC 2VIIA 1JQJC 2CWBA 4LZZA 3M7GA 3C58A 1UR8A 2UU9M 5EXSA 2DNAA 3FYCA 3FTCA 2KEBA 4QHSA 3N3FA 5KPZA 2Y21A 2H1RA 4X65M 3V76A 4DV1M 5ITRA 1W1YA 2CUZA 2Y2MA 1OGBA 4LF6M 1CK7A 2C9CA 3ZQJA 1OAIA 1IBKM 4MB5A 2FN2A 1OQYA 3CGWA 1UFZA 1BVSA 4FCTA 4LY6A 2L09A 4OVZA 1QYRA 2LVQD 4WW0A 3SMPA 2CV1A 3AL0C 3BXWA 2UXDM 2K0BX 3IG8A 3QYBA 1TH2A 4D82A 2JUJA 2QCUA 3I4VA 2WSEF 5ITUA 1VDDA 5KPTA 2EUCA 4P16A 1JR3D 3Q8GA 2XSZA 4HL4A 1I4WA 1VEKA 1SXJE 1ZV1A 3CF2A 3T6PA 4BB9A 1QQWA 1NV9A 3QAUA 3T1HM 1GJSA 4IJFA 4LCBA 4B7GA 1GABA 4B08A 4RF1A 3GLGE 1EIJA 3WD3A 1JR3E 4GHLA 1LTMA 2C99A 3WD4A 1I94M 5DFLA 3K8ZA 3FYDA 3KOWE 4IBGA 4LZJA 4R71A 1L2CA 1PRBA 4GH9A 1QAQA 3KXEC 2Y2IA 3GLIE 2AHMA 2MH8A 3HJQA 4DR3M 1MU5A 4LFAM 2XH9A 2V6ZM 1WJ7A 3I51A 1XNRM 1V33A 3GRYA 1XXHA 3TE6A 4AKGA 2F5PA 3HKPA 2DAGA 1UR9A 4NZ5A 4AZFA 1Q39A 2CEAA 1NVMA 4OW0A 4XBOA 4HMDA 1CXWA 2CRUA 3GLFE 3VK7A 1AIPC 3ZC7B 1SG9A 1OAOC 4MGKE 3KSXA 2JXNA 3WD2A 2K6BA 1GOIA 2QP9X 4JI6M 5IREB 3MMPA 2O01F 3SHFA 3SASA 4JI2M 1TGUA 4FWGA 3T15A 4LF7M 2LXEA 2DWMA 4PT5A 2JY7A 4LJ8A 3TPZA 4MB3A 1J09A 2L7HA 4MH0E 3GLIA 3A46A 1W1VA 3EIHA 4JN6A 5FTNA 3LQRA 3LVWA 1TF0B 3GLGB 2GNOA 1IXSB 3HGIA 2V1CA 4A3VB 2KXEA 2O25A 4DUYM 1DGHA 1D0KA 3B7QA 3KW6A 2YQZA 1YU3A 5FLXS 2G5GX 1HQCA 4OUIA 2R18A 2I7PA 1T6OA 4Y28F 2Z3XA 3KOXE 5EP2A 4LFCM 4NSOB 5KO3A 3HHZA 4DV3M 5DNYA 2X8AA 1NJFA 4Z2GA 1OGGA 4PDGA 4G3OA 2JY6B 1TH4A 3FD9A 1N33M 1HNZM 4NYYA 4QNMA 2ZTCA 1KS0A 2BWBA 4FCVA 3GLHA 1PJSA 4DV5M 2R65A 2LWXA 2XFSA 1N32M 3AOEC 4JI7M 3A98B 4IBFA 4AKIA 2MJ5B 2E5LM 3SAUA 3GPYA 4Z8XA 1JB0F 4MGIE 2LVNC
chains in the Genus database with same CATH topology
2Z7JA 4IBBA 3PXGA 1PJIA 2BJWA 4LJ9A 1YU0A 4CHTB 3SC3A 4ITQA 2J7NA 4DR6M 1XMOM 5EP4A 4BBAA 4I8OA 2BG1A 1XHBA 5EXTA 3RFWA 4REZA 3KP1E 4W5WA 2F5OA 1IY2A 5LMNM 3HHYA 1YSYA 4CISA 1IXZA 4QNLA 2KZSA 1NJGA 1XC8A 1HT2E 4MB7A 1PJJA 4IBEA 3FUVA 1KSFX 2ERCA 2ZBKB 3TWMA 3WHKA 5A2QS 3GPUA 3GQ5A 4LJ6A 3GPXA 4IBKA 4NZ3A 2UUBM 3L27A 3SAVA 4X62M 5EQTA 3RGPA 3LVVA 3UGJA 4I4LA 2CV2A 3HHXA 1OFHA 1T3TA 2XF3A 3JR5A 4FWDA 5FTLA 2V1UA 5IT9S 1TDZA 3TQSA 3SATA 4LFBM 3GRVA 3GLHB 5LMUM 3VDUA 2CHQA 2QZ4A 1FJGM 1NSFA 4NZ1A 1DO2A 1XXHB 1EE8A 2HKJA 2JA2A 1MX0A 1IY0A 3GQ4A 2ZANA 3VLFB 1HNWM 3L28A 5FTMA 5EXPA 3HJ8A 4DR5M 3ZH9B 4FVMA 2BJVA 4OJ6A 2RGOA 4DV4M 2YNMD 3DA1A 2P5TA 1YU4A 4X66M 5H37D 4Z6YA 1IXRC 3HHWA 4X64M 3FUUA 1FNNA 4DV7M 2Y2NA 1IY1A 1SXJC 1GVNA 3VDPA 2QBYA 3SAWA 4I5SA 3TWLA 5EP3A 3U6CA 3L25A 4NXNM 1N77A 2L6OA 3WX7A 2CFOA 2VQFM 4NYUA 1N34M 2CE7A 3GPPA 3QWLA 1LV7A 3KFUG 4TUWA 4AI6A 8CATA 2EO2A 2C98A 3K92A 3J7BA 4M9SA 4G4NA 1L8QA 1E32A 2Y2HA 2W82A 4LJ5A 1KYIA 3R8FA 1L1ZA 1NHGC 1QVRA 4WURA 4B3SM 3LMMA 2RKOA 3E9SA 2Y2JA 2M5ZA 2VQEM 3AOEA 4LRSA 2X49A 3GRUA 4LRTA 1G4AE 2CHGA 4M9ZA 4IBJA 1R6BX 3AKZA 1IN5A 4IBCA 3W0LB 3SARA 1IBLM 1JR3A 1OFIA 3VFDA 3GLGA 2DXIA 4PD2A 2UUAM 2DZNB 3FUTA 1E94E 4EIWA 4L4UA 3H4MA 2OQ4A 4NL4H 2UUCM 1Q3CA 4NRVA 4AW4A 1GLNA 5EXXA 4ZPXA 4JI1M 2XZFA 1W5SA 1UM8A 1ZAEA 4OVZB 3U6DA 3U61A 2DWNA 4RF0A 4GHAA 1N78A 3MJ5A 1X37A 4LF4M 3NWLA 4AG5A 4PDIA 4LF9M 2XFTA 3KVWA 4QNRA 2LNHC 4G6ZA 3ZCBB 4NOOB 4G4QA 3HU3A 4KLNA 3MK6A 1IBMM 3AFHA 3FTFA 4K0KM 3VK8A 2NQ8C 3GLIB 2Y2LA 3J80S 4OJLA 5IWAM 3U6MA 3BOSA 1L2BA 3PNVA 3U6QA 2ZM6M 2UXBM 2KRUA 2I7NA 2C96A 3GRRA 4GITA 3KOZE 1R2YA 4HLQA 1SXJD 2R4EA 2KW0A 3AOGA 4M9XA 4NXMM 1L2DA 2DZOB 3MHVC 2QBYB 3L26A 3GQ3A 4JI8M 1XNQM 4L78A 4LJ4A 1R7RA 4L8RC 3FTEA 3UZUA 3HU2A 2Q2EB 4MM3B 4QHTA 3SYLA 4DR7M 1Z59A 1J5EM 3DFZA 3E4RA 1HT1E 1K3WA 1HQYE 1H6UA 2Y2PA 3HSHA 4R3DA 2CHVA 5BR8M 1E9RA 5EJCA 3GLFA 3AV0A 5ITYA 1SXJB 2J7OA 5ITXA 4JXJA 2DHRA 4M0DA 1YU1A 1HNXM 1XMQM 2FNAA 5DYIA 3D8BA 1DGBA 1HR0M 1SXJA 2DWLA 3VKHA 1TDHA 3AJIB 2LH0A 3T38A 3CF6E 4IJEA 2D7HA 4D80A 3UJNA 2ZAMA 1OJLA 2Y2OA 1IN7A 3U6EA 5FSWA 1NNJA 2Y20A 5F3WA 2A5YB 2D7EA 4NRWA 4B3MM 2G8LA 4AKHA 4IIWA 3TWKA 4GKJM 7CATA 3J27B 4JI3M 2UXCM 5BPVA 4MGZE 2IOUA 4YHHM 4DV2M 3KS8A 2HL7A 2C9OA 2UWXA 3CF0A 1YUBA 3U60A 2YR0A 4DR1M 3W0FA 5JI3E 1G59A 2Y0TA 4PCZA 4BLCA 3R9XB 4NZ4A 3FKEA 2FFJA 3FTDA 3PVSA 3KP0E 3D8LA 5E26A 3T1YM 2X4AA 3I4YA 2R46A 1DGHB 1IN6A 5FTKA 4DV6M 4FD2A 1K82A 1WXQA 3SMSA 5KPRA 4DV0M 1Z5CA 1S3SA 4QOSA 1Z5BA 1IM2A 3M0EA 5ITXE 4D81A 3J2PB 4CGYB 3GLFB 3SFZA 4OJ5A 3U5ZA 3J7AS 3U60B 2F5QA 2L7IA 1YU2A 5GKNA 1KFVA 4FCWA 4DUZM 4B3TM 4GRIA 1QANA 5JI2E 4R7GA 4LJ7A 3THGA 4OJPA 1NHWC 2F5SA 3A42A 2D7GA 1PM5A 3M6AA 4JI4M 2XGNA 2FOIC 3DZDA 4LJAA 4G4OA 2O5RA 1TH3A 3GP1A 3B9PA 3A45A 5E6JA 1NNUC 4JYAM 4AG6A 2QENA 1G3IA 2KRKA 3U5ZB 5EP1A 3U6OA 4LF8M 3HONA 1YUEA 2R62A 1IN4A 4L15A 1GL7A 2QPAA 4XGIA 4JV5M 3IG5A 1L1TA 1C1KA 2XZUA 3KSJA 3UMMA 3SBJA 3Q8XA 4DR4M 4GC9A 4NSRA 2DWZB 1J7KA 5DYGA 4IBDA 1Z6TA 3L2AA 4OX9M 2CV0A 4NY2A 2EA0A 3FUWA 4B7HA 1DGGA 3K1JA 1QAMA 2Z4SA 2Y2KA 4JI5M 1R2ZA 3WHLA 2F5NA 4L16A 4KODA 4II7A 1IQPA 1GL6A 1E9SA 2FFFB 1G41A 1XWIA 4MGYE 2XEPA 4YY3M 5C18A 1ZQ9A 3PNYA 3KS4A 4KHPM 1IN8A 3OTOM 1DGFA 1Q3BA 3KOYE 1N36M 2JE5A 2KZUA 2F4VM 4AQYM 2DVWB 3JR4A 5C1BA 3U6PA 2R45A 3DOAA 3HJSA 3RGSA 2C5RA 3EIEA 1NY5A 4LGMA 5KQ8A 4GC5A 4RNAA 4IBIA 3L29A 5KQDA 2FE8A 4GKKM 2HCBA 1W5TA 2K47A 1GKIA 3KDSE 2XD5A 3K2LA 3U61B 2OPFA 2KA6B 1G8PA 1YE9A 4I81A 1K3XA 3HWSA 1DO0A 2M60A 3U6SA 3TL4X 3PFIA 2XD1A 1ORYB 4B7FA 3SHGB 3GO8A 3U6LA 2HHHM 2Y2QA 2ZAOA 2Z4RA 1D2NA 4FWHA 3LQQA 4G4RA 1Z5AA 2R4JA 2XLJA 4LG2A 1N75A 4KO8A 3SYKA 4OU7A 1NY6A 4M0WA 1QZMA 2Y0QA 3JAMS 5ITTA 3CTWB 5IZ7D 2JCHA 3UK6A 4LGYA 2XSZD 4LF5M 5FTJA 3FUXA 4MGHA 3ILKA 3HU1A 2BNKA 4GMQA 4S12A 3RE8A 4B3RM 4FW9A 3NBIA 1QAOA 2YFQA 4QOZC 4DR2M 2Y2GA 4OJOA 3J81S 3VKGA 2RGHA 4JI0M 5ITQA 4GIPA 2VIIA 1JQJC 4LZZA 3M7GA 3C58A 2UU9M 5EXSA 3FYCA 3FTCA 2KEBA 4QHSA 3N3FA 5KPZA 2Y21A 2H1RA 4X65M 4DV1M 5ITRA 2CUZA 2Y2MA 4LF6M 2C9CA 1IBKM 4FCTA 4OVZA 4WW0A 4LY6A 3AL0C 2L09A 2CV1A 1QYRA 3SMPA 2UXDM 3IG8A 1TH2A 4D82A 3I4VA 2QCUA 5ITUA 1VDDA 5KPTA 2EUCA 4P16A 1JR3D 2XSZA 4HL4A 1I4WA 1SXJE 3CF2A 4BB9A 1QQWA 3QAUA 3T1HM 4IJFA 4LCBA 4B7GA 4B08A 4RF1A 4GHLA 2C99A 1I94M 3K8ZA 3FYDA 3KOWE 4IBGA 4LZJA 1L2CA 4GH9A 1QAQA 3KXEC 2Y2IA 2AHMA 3HJQA 4DR3M 1MU5A 4LFAM 2XH9A 2V6ZM 3I51A 1XNRM 3GRYA 1XXHA 3TE6A 4AKGA 2F5PA 3HKPA 4NZ5A 4AZFA 1Q39A 2CEAA 1NVMA 4OW0A 4XBOA 3VK7A 3ZC7B 4MGKE 3KSXA 2QP9X 4JI6M 5IREB 4JI2M 3SHFA 3SASA 4FWGA 1TGUA 3T15A 4LF7M 2LXEA 2DWMA 4PT5A 4LJ8A 3TPZA 1J09A 2L7HA 4MH0E 3GLIA 3A46A 3EIHA 4JN6A 5FTNA 3LQRA 3LVWA 3GLGB 1IXSB 3HGIA 2V1CA 4A3VB 2KXEA 4DUYM 1DGHA 3KW6A 2YQZA 1YU3A 5FLXS 2G5GX 1HQCA 4OUIA 2R18A 2I7PA 2Z3XA 3KOXE 5EP2A 4LFCM 4NSOB 5KO3A 3HHZA 4DV3M 5DNYA 2X8AA 1NJFA 4PDGA 1TH4A 3FD9A 1N33M 1HNZM 4NYYA 4QNMA 4FCVA 3GLHA 4DV5M 2R65A 2LWXA 2XFSA 1N32M 3AOEC 4JI7M 3A98B 4IBFA 4AKIA 2E5LM 3SAUA 3GPYA 4Z8XA 4MGIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBC A;  4IBB A;  3L28 A;  4IBK A;  3KS4 A;  3L27 A;  5BPV A;  4IJF A;  3KS8 A;  4GHL A;  4GHA A;  4IBG A;  4GH9 A;  3L26 A;  4IBD A;  4LG2 A;  3FKE A;  3L2A A;  4IBI A;  3L29 A;  4IBF A;  4IJE A;  4IBJ A;  4IBE A;  3L25 A; 
#chains in the Genus database with same CATH topology
 2Z7J A;  2EJS A;  2R6F A;  4IBB A;  3PXG A;  1PJI A;  2BJW A;  4LJ9 A;  1YU0 A;  4CHT B;  3SC3 A;  1DV0 A;  1ZMU A;  4ITQ A;  2J7N A;  4DR6 M;  4ANR A;  1XMO M;  2DAM A;  5EP4 A;  4BBA A;  2QSF X;  4I8O A;  2BG1 A;  1XHB A;  5EXT A;  3RFW A;  4REZ A;  3KP1 E;  1VQ1 A;  4W5W A;  2F5O A;  1R4G A;  1IY2 A;  5LMN M;  3HHY A;  1YSY A;  1NV8 A;  4CIS A;  1IXZ A;  4QNL A;  2KZS A;  3E21 A;  2L4E A;  1NJG A;  1XC8 A;  1HT2 E;  4MB7 A;  3NBX X;  1C7Y A;  1PJJ A;  4IBE A;  1XXH E;  3FUV A;  4HME A;  1OIP A;  1KSF X;  2ERC A;  2ZBK B;  3TWM A;  3WHK A;  5A2Q S;  3GPU A;  3GQ5 A;  4LJ6 A;  3GPX A;  1GXD A;  1W1T A;  1ZMV A;  4IBK A;  4NZ3 A;  2DAI A;  3L27 A;  2UUB M;  3SAV A;  4X62 M;  3FRI A;  5EQT A;  3RGP A;  2JP7 A;  3LVV A;  3UGJ A;  4TX8 A;  4I4L A;  4P17 A;  1CUK A;  2R44 A;  2CV2 A;  4HMC A;  3HHX A;  1PJT A;  3E46 A;  4UN2 B;  3FE3 A;  2R0I A;  1OFH A;  1T3T A;  2XF3 A;  3JR5 A;  4FWD A;  5FTL A;  1G71 A;  2V1U A;  5IT9 S;  1E88 A;  1TDZ A;  3TQS A;  2BWE A;  3SAT A;  2VDB B;  4LFB M;  1TTE A;  3GRV A;  3GLH B;  5LMU M;  2RTS A;  3VDU A;  2CHQ A;  2QZ4 A;  1FJG M;  1NSF A;  2LBC A;  4NZ1 A;  1DO2 A;  1XXH B;  1EE8 A;  2HKJ A;  2JA2 A;  1MX0 A;  1IY0 A;  3GQ4 A;  2ZAN A;  3VLF B;  2JZ0 A;  1QUS A;  1HNW M;  2OOB A;  1WIV A;  1AIW A;  3L28 A;  3B74 A;  5FTM A;  4DBG B;  1O6I A;  2DI0 A;  3C3E A;  5EXP A;  3HJ8 A;  3I01 M;  4DR5 M;  3ZH9 B;  4FVM A;  2BJV A;  2QHO B;  2JY5 A;  4OJ6 A;  2RGO A;  4DV4 M;  2YNM D;  3DA1 A;  1V92 A;  2P5T A;  1YU4 A;  2OOA A;  4X66 M;  5H37 D;  4Z6Y A;  1IXR C;  3HHW A;  4X64 M;  3FUU A;  1FNN A;  4DV7 M;  2Y2N A;  1IY1 A;  1SXJ C;  1GVN A;  3VDP A;  4F1I A;  2QBY A;  3SAW A;  1QDR A;  1WGN A;  2QQ8 A;  4I5S A;  3TWL A;  5EP3 A;  3U6C A;  3L25 A;  4NXN M;  4F2L A;  1N77 A;  2L6O A;  3WX7 A;  2CFO A;  4Z2L A;  2VQF M;  4NYU A;  2WZJ A;  1N34 M;  2CE7 A;  3GPP A;  1ED7 A;  3QWL A;  1LV7 A;  3KFU G;  4TUW A;  4Z2J A;  1E6N A;  4AI6 A;  8CAT A;  2EO2 A;  1E6R A;  2C98 A;  3K92 A;  1VDL A;  3J7B A;  4M9S A;  4G4N A;  1L8Q A;  1E32 A;  2Y2H A;  2W82 A;  4LJ5 A;  1KYI A;  3R8F A;  1L1Z A;  1E6Z A;  1NHG C;  1QVR A;  4WUR A;  4B3S M;  3LMM A;  2RKO A;  3E9S A;  2Y2J A;  2M5Z A;  2VQE M;  3AOE A;  4LRS A;  2LHG A;  4L6V 6;  2X49 A;  3GRU A;  4LRT A;  1D0L A;  1G4A E;  2CHG A;  4RKU F;  4M9Z A;  4IBJ A;  1R6B X;  3AKZ A;  1QO6 A;  1IN5 A;  3W68 A;  4IBC A;  3W0L B;  3SAR A;  3WD1 A;  1IBL M;  1JR3 A;  2FH0 A;  1OFI A;  3VFD A;  3W67 A;  3GLG A;  2DXI A;  4PD2 A;  2UUA M;  2DZN B;  2WSC F;  1E94 E;  1R5L A;  3FUT A;  4EIW A;  4L4U A;  3H4M A;  2OQ4 A;  4NL4 H;  3GLH E;  2UUC M;  1Q3C A;  4NRV A;  4Z2I A;  1OKS A;  4AW4 A;  1GLN A;  5EXX A;  4ZPX A;  4JI1 M;  2XZF A;  1W5S A;  1UM8 A;  1ZAE A;  4OVZ B;  3U6D A;  3U61 A;  2DWN A;  4RF0 A;  4GHA A;  1N78 A;  3MJ5 A;  1X37 A;  4LF4 M;  1TR8 A;  3NWL A;  4AG5 A;  4PDI A;  4LF9 M;  3C3D A;  2XFT A;  3BBZ A;  3KVW A;  4QNR A;  2LNH C;  4G6Z A;  3ZCB B;  4NOO B;  4G4Q A;  3HU3 A;  4GEW A;  1E15 A;  2LVA A;  4KLN A;  3MK6 A;  1IBM M;  3AFH A;  3FTF A;  4K0K M;  2KNZ A;  2VF8 A;  1J7M A;  2ZTD A;  3FRH A;  3VK8 A;  3H4J A;  2NQ8 C;  1XB2 B;  3GLI B;  2Y2L A;  2JNH A;  3J80 S;  1MN3 A;  5IWA M;  3BOS A;  3U6M A;  3B7N A;  1L2B A;  3PNV A;  2J5Y A;  2D49 A;  3U6Q A;  2ZM6 M;  2UXB M;  2KRU A;  1EFU B;  2I7N A;  2C96 A;  3GRR A;  4GIT A;  3KOZ E;  1R2Y A;  4HLQ A;  1SXJ D;  1NO1 A;  1Q02 A;  2KW0 A;  2R4E A;  3AOG A;  4XK8 F;  2Z8Y M;  4M9X A;  4NXM M;  1L2D A;  2DZO B;  3MHV C;  2QBY B;  3L26 A;  3GQ3 A;  2HAK A;  4JI8 M;  1XNQ M;  1E8B A;  4CIZ A;  4L78 A;  4LJ4 A;  1R7R A;  4L8R C;  3FTE A;  3UZU A;  1T43 A;  2Q2E B;  3HU2 A;  4MM3 B;  4QHT A;  2DAE A;  3SYL A;  4DR7 M;  1H0G A;  1Z59 A;  2V5O A;  1J5E M;  3DFZ A;  3E4R A;  1HT1 E;  1VEG A;  2KDL A;  1HQY E;  1H6U A;  1K3W A;  2Y2P A;  3HSH A;  4R3D A;  2CHV A;  2JY8 A;  1E9R A;  5EJC A;  5BR8 M;  3GLF A;  3AV0 A;  5ITY A;  1SXJ B;  2J7O A;  5ITX A;  1WHC A;  1AUA A;  2VF7 A;  4JXJ A;  2DHR A;  3I04 M;  4M0D A;  4Z2H A;  2MR9 A;  1PGY A;  1ZMW A;  1YU1 A;  1HNX M;  1XMQ M;  2FNA A;  4NC6 A;  1IXS A;  3HZJ A;  5DYI A;  3D8B A;  1DGB A;  1HR0 M;  1QZE A;  3QYE A;  2APL A;  2MRO B;  1SXJ A;  2DWL A;  3VKH A;  1PDC A;  1TDH A;  3C9P A;  3AJI B;  2LH0 A;  3T38 A;  3CF6 E;  4IJE A;  2D7H A;  4D80 A;  2KHH A;  3B89 A;  2ZAM A;  1OJL A;  3LCV B;  3UJN A;  2Y2O A;  1IN7 A;  3U6E A;  1H8P A;  5FSW A;  1NNJ A;  2Y20 A;  3LW5 F;  5F3W A;  2A5Y B;  3HY5 A;  2D7E A;  4NRW A;  4OJL A;  4B3M M;  2G8L A;  4AKH A;  4IIW A;  3TWK A;  4GKJ M;  7CAT A;  3J27 B;  4JI3 M;  2UXC M;  5BPV A;  4MGZ E;  2IOU A;  4YHH M;  4DV2 M;  3B7Z A;  4Z2K A;  3KS8 A;  2HL7 A;  2C9O A;  2UWX A;  3CF0 A;  1F4I A;  1YUB A;  3U60 A;  1H0I A;  2YR0 A;  4DR1 M;  2L2D A;  3W0F A;  5JI3 E;  2Y0T A;  4PCZ A;  1G59 A;  4HEO A;  4BLC A;  3R9X B;  2K9D A;  4NZ4 A;  3FKE A;  2FFJ A;  3FTD A;  1D0M A;  2KNV A;  3PVS A;  2B3T A;  3KP0 E;  2CP8 A;  2KNA A;  3D8L A;  5E26 A;  3T1Y M;  2EKK A;  2X4A A;  2R46 A;  1DGH B;  1IN6 A;  3I4Y A;  5FTK A;  4DV6 M;  4FD2 A;  2FS1 A;  1K82 A;  1WXQ A;  3SMS A;  1OTR A;  5KPR A;  4DV0 M;  1Z5C A;  1GO5 A;  1S3S A;  4QOS A;  1Z5B A;  1IM2 A;  3K9P A;  3M0E A;  5ITX E;  1WGL A;  4CJ6 A;  3J2P B;  4CGY B;  4D81 A;  3SFZ A;  3GLF B;  4OJ5 A;  3U5Z A;  1HJP A;  3IHP A;  3J7A S;  3U60 B;  2F5Q A;  2L7I A;  1YU2 A;  5GKN A;  1KFV A;  4FCW A;  4DUZ M;  4B3T M;  3WD0 A;  4GRI A;  1QAN A;  5JI2 E;  3M7P A;  4R7G A;  5L8R F;  4LJ7 A;  3THG A;  4OJP A;  1NHW C;  2DAK A;  3A42 A;  2F5S A;  2D7G A;  1PM5 A;  3M6A A;  4JI4 M;  1VG5 A;  2FOI C;  2XGN A;  3DZD A;  4LJA A;  4G4O A;  2O5R A;  1TH3 A;  2N35 A;  1PJQ A;  3GP1 A;  3B9P A;  3A45 A;  5E6J A;  1NNU C;  4JYA M;  4AG6 A;  2QEN A;  2JWS A;  1G3I A;  2KRK A;  3U5Z B;  2OO9 A;  5EP1 A;  1W1P A;  3U6O A;  4LF8 M;  3HON A;  1YUE A;  2R62 A;  1IN4 A;  4L15 A;  1GL7 A;  2QPA A;  4XGI A;  4JV5 M;  3IG5 A;  1L1T A;  1C1K A;  2XZU A;  2DHY A;  3KSJ A;  1RU3 A;  1VEJ A;  3UMM A;  3SBJ A;  3Q8X A;  4DR4 M;  4GC9 A;  4NSR A;  2DWZ B;  1J7K A;  5DYG A;  4IBD A;  1Z6T A;  3L2A A;  4OX9 M;  2CV0 A;  3F92 A;  4NY2 A;  2EA0 A;  3FUW A;  4B7H A;  1DGG A;  1QAM A;  3K1J A;  2Z4S A;  2RRU A;  4JI5 M;  2Y2K A;  1R2Z A;  3WHL A;  2F5N A;  4L16 A;  1QDT A;  2HWJ A;  3K9O A;  1E6P A;  4KOD A;  4II7 A;  1IQP A;  1GL6 A;  1E9S A;  3LCU A;  1G41 A;  1XWI A;  2FFF B;  4MGY E;  2XEP A;  4YY3 M;  2H5X A;  5C18 A;  1ZQ9 A;  3PNY A;  3KS4 A;  4KHP M;  1IN8 A;  2WSF F;  3OTO M;  1DGF A;  1Q3B A;  3KOY E;  1N36 M;  2JE5 A;  2GQF A;  2KZU A;  4AQY M;  2F4V M;  4KT0 F;  2DVW B;  1P3Q Q;  3JR4 A;  5C1B A;  1L6J A;  3U6P A;  2R45 A;  3DOA A;  3HJS A;  3RGS A;  2C5R A;  3EIE A;  1NY5 A;  4LGM A;  2DKL A;  5KQ8 A;  4GC5 A;  4Q7J A;  4IBI A;  3L29 A;  4RNA A;  2FE8 A;  5KQD A;  4GKK M;  2HCB A;  1W5T A;  2K47 A;  1GKI A;  3KDS E;  2XD5 A;  3K2L A;  1MJG M;  3U61 B;  2OPF A;  4MB4 A;  2KA6 B;  1G8P A;  1YE9 A;  2LVO C;  4I81 A;  1K3X A;  3HWS A;  1DO0 A;  1A5T A;  1WR1 B;  3HX3 A;  2L4F A;  2M60 A;  3U6S A;  2QNJ A;  3TL4 X;  3IEC A;  3PFI A;  2XD1 A;  1ORY B;  4WP2 A;  4B7F A;  3SHG B;  3GO8 A;  2JZ1 A;  3U6L A;  2G3Q A;  2HHH M;  2Y2Q A;  1EAK A;  2ZAO A;  2Z4R A;  1D2N A;  4FWH A;  3LQQ A;  2EKF A;  1YLA A;  4G4R A;  1Z5A A;  2R4J A;  2XLJ A;  4LG2 A;  1GPF A;  1N75 A;  2DZL A;  4KO8 A;  3SYK A;  1OIZ A;  4OU7 A;  1NY6 A;  1V34 A;  4M0W A;  1QZM A;  2Y0Q A;  3JAM S;  5ITT A;  3CTW B;  3MQL A;  5IZ7 D;  2JCH A;  3UK6 A;  4LGY A;  2XSZ D;  1Y8G A;  4LF5 M;  1IFY A;  5FTJ A;  3FUX A;  2LHC A;  4MGH A;  3ILK A;  1QUT A;  3HU1 A;  2BNK A;  1GJT A;  2DEN A;  4GMQ A;  4S12 A;  3RE8 A;  4FW9 A;  3NBI A;  1QAO A;  2YFQ A;  4B3R M;  4DR2 M;  4QOZ C;  2Y2G A;  4OJO A;  3J81 S;  3VKG A;  2LTU A;  2MGW A;  2RGH A;  4GIP A;  4JI0 M;  5ITQ A;  2LVP C;  2VII A;  1JQJ C;  2CWB A;  4LZZ A;  3M7G A;  3C58 A;  1UR8 A;  2UU9 M;  5EXS A;  2DNA A;  3FYC A;  3FTC A;  2KEB A;  4QHS A;  3N3F A;  5KPZ A;  2Y21 A;  2H1R A;  4X65 M;  3V76 A;  4DV1 M;  5ITR A;  1W1Y A;  2CUZ A;  2Y2M A;  1OGB A;  4LF6 M;  1CK7 A;  2C9C A;  3ZQJ A;  1OAI A;  1IBK M;  4MB5 A;  2FN2 A;  1OQY A;  3CGW A;  1UFZ A;  1BVS A;  4FCT A;  4LY6 A;  2L09 A;  4OVZ A;  1QYR A;  2LVQ D;  4WW0 A;  3SMP A;  2CV1 A;  3AL0 C;  3BXW A;  2UXD M;  2K0B X;  3IG8 A;  3QYB A;  1TH2 A;  4D82 A;  2JUJ A;  2QCU A;  3I4V A;  2WSE F;  5ITU A;  1VDD A;  5KPT A;  2EUC A;  4P16 A;  1JR3 D;  3Q8G A;  2XSZ A;  4HL4 A;  1I4W A;  1VEK A;  1SXJ E;  1ZV1 A;  3CF2 A;  3T6P A;  4BB9 A;  1QQW A;  1NV9 A;  3QAU A;  3T1H M;  1GJS A;  4IJF A;  4LCB A;  4B7G A;  1GAB A;  4B08 A;  4RF1 A;  3GLG E;  1EIJ A;  3WD3 A;  1JR3 E;  4GHL A;  1LTM A;  2C99 A;  3WD4 A;  1I94 M;  5DFL A;  3K8Z A;  3FYD A;  3KOW E;  4IBG A;  4LZJ A;  4R71 A;  1L2C A;  1PRB A;  4GH9 A;  1QAQ A;  3KXE C;  2Y2I A;  3GLI E;  2AHM A;  2MH8 A;  3HJQ A;  4DR3 M;  1MU5 A;  4LFA M;  2XH9 A;  2V6Z M;  1WJ7 A;  3I51 A;  1XNR M;  1V33 A;  3GRY A;  1XXH A;  3TE6 A;  4AKG A;  2F5P A;  3HKP A;  2DAG A;  1UR9 A;  4NZ5 A;  4AZF A;  1Q39 A;  2CEA A;  1NVM A;  4OW0 A;  4XBO A;  4HMD A;  1CXW A;  2CRU A;  3GLF E;  3VK7 A;  1AIP C;  3ZC7 B;  1SG9 A;  1OAO C;  4MGK E;  3KSX A;  2JXN A;  3WD2 A;  2K6B A;  1GOI A;  2QP9 X;  4JI6 M;  5IRE B;  3MMP A;  2O01 F;  3SHF A;  3SAS A;  4JI2 M;  1TGU A;  4FWG A;  3T15 A;  4LF7 M;  2LXE A;  2DWM A;  4PT5 A;  2JY7 A;  4LJ8 A;  3TPZ A;  4MB3 A;  1J09 A;  2L7H A;  4MH0 E;  3GLI A;  3A46 A;  1W1V A;  3EIH A;  4JN6 A;  5FTN A;  3LQR A;  3LVW A;  1TF0 B;  3GLG B;  2GNO A;  1IXS B;  3HGI A;  2V1C A;  4A3V B;  2KXE A;  2O25 A;  4DUY M;  1DGH A;  1D0K A;  3B7Q A;  3KW6 A;  2YQZ A;  1YU3 A;  5FLX S;  2G5G X;  1HQC A;  4OUI A;  2R18 A;  2I7P A;  1T6O A;  4Y28 F;  2Z3X A;  3KOX E;  5EP2 A;  4LFC M;  4NSO B;  5KO3 A;  3HHZ A;  4DV3 M;  5DNY A;  2X8A A;  1NJF A;  4Z2G A;  1OGG A;  4PDG A;  4G3O A;  2JY6 B;  1TH4 A;  3FD9 A;  1N33 M;  1HNZ M;  4NYY A;  4QNM A;  2ZTC A;  1KS0 A;  2BWB A;  4FCV A;  3GLH A;  1PJS A;  4DV5 M;  2R65 A;  2LWX A;  2XFS A;  1N32 M;  3AOE C;  4JI7 M;  3A98 B;  4IBF A;  4AKI A;  2MJ5 B;  2E5L M;  3SAU A;  3GPY A;  4Z8X A;  1JB0 F;  4MGI E;  2LVN C; 
#chains in the Genus database with same CATH homology
 2Z7J A;  4IBB A;  3PXG A;  1PJI A;  2BJW A;  4LJ9 A;  1YU0 A;  4CHT B;  3SC3 A;  4ITQ A;  2J7N A;  4DR6 M;  1XMO M;  5EP4 A;  4BBA A;  4I8O A;  2BG1 A;  1XHB A;  5EXT A;  3RFW A;  4REZ A;  3KP1 E;  4W5W A;  2F5O A;  1IY2 A;  5LMN M;  3HHY A;  1YSY A;  4CIS A;  1IXZ A;  4QNL A;  2KZS A;  1NJG A;  1XC8 A;  1HT2 E;  4MB7 A;  1PJJ A;  4IBE A;  3FUV A;  1KSF X;  2ERC A;  2ZBK B;  3TWM A;  3WHK A;  5A2Q S;  3GPU A;  3GQ5 A;  4LJ6 A;  3GPX A;  4IBK A;  4NZ3 A;  2UUB M;  3L27 A;  3SAV A;  4X62 M;  5EQT A;  3RGP A;  3LVV A;  3UGJ A;  4I4L A;  2CV2 A;  3HHX A;  1OFH A;  1T3T A;  2XF3 A;  3JR5 A;  4FWD A;  5FTL A;  2V1U A;  5IT9 S;  1TDZ A;  3TQS A;  3SAT A;  4LFB M;  3GRV A;  3GLH B;  5LMU M;  3VDU A;  2CHQ A;  2QZ4 A;  1FJG M;  1NSF A;  4NZ1 A;  1DO2 A;  1XXH B;  1EE8 A;  2HKJ A;  2JA2 A;  1MX0 A;  1IY0 A;  3GQ4 A;  2ZAN A;  3VLF B;  1HNW M;  3L28 A;  5FTM A;  5EXP A;  3HJ8 A;  4DR5 M;  3ZH9 B;  4FVM A;  2BJV A;  4OJ6 A;  2RGO A;  4DV4 M;  2YNM D;  3DA1 A;  2P5T A;  1YU4 A;  4X66 M;  5H37 D;  4Z6Y A;  1IXR C;  3HHW A;  4X64 M;  3FUU A;  1FNN A;  4DV7 M;  2Y2N A;  1IY1 A;  1SXJ C;  1GVN A;  3VDP A;  2QBY A;  3SAW A;  4I5S A;  3TWL A;  5EP3 A;  3U6C A;  3L25 A;  4NXN M;  1N77 A;  2L6O A;  3WX7 A;  2CFO A;  2VQF M;  4NYU A;  1N34 M;  2CE7 A;  3GPP A;  3QWL A;  1LV7 A;  3KFU G;  4TUW A;  4AI6 A;  8CAT A;  2EO2 A;  2C98 A;  3K92 A;  3J7B A;  4M9S A;  4G4N A;  1L8Q A;  1E32 A;  2Y2H A;  2W82 A;  4LJ5 A;  1KYI A;  3R8F A;  1L1Z A;  1NHG C;  1QVR A;  4WUR A;  4B3S M;  3LMM A;  2RKO A;  3E9S A;  2Y2J A;  2M5Z A;  2VQE M;  3AOE A;  4LRS A;  2X49 A;  3GRU A;  4LRT A;  1G4A E;  2CHG A;  4M9Z A;  4IBJ A;  1R6B X;  3AKZ A;  1IN5 A;  4IBC A;  3W0L B;  3SAR A;  1IBL M;  1JR3 A;  1OFI A;  3VFD A;  3GLG A;  2DXI A;  4PD2 A;  2UUA M;  2DZN B;  3FUT A;  1E94 E;  4EIW A;  4L4U A;  3H4M A;  2OQ4 A;  4NL4 H;  2UUC M;  1Q3C A;  4NRV A;  4AW4 A;  1GLN A;  5EXX A;  4ZPX A;  4JI1 M;  2XZF A;  1W5S A;  1UM8 A;  1ZAE A;  4OVZ B;  3U6D A;  3U61 A;  2DWN A;  4RF0 A;  4GHA A;  1N78 A;  3MJ5 A;  1X37 A;  4LF4 M;  3NWL A;  4AG5 A;  4PDI A;  4LF9 M;  2XFT A;  3KVW A;  4QNR A;  2LNH C;  4G6Z A;  3ZCB B;  4NOO B;  4G4Q A;  3HU3 A;  4KLN A;  3MK6 A;  1IBM M;  3AFH A;  3FTF A;  4K0K M;  3VK8 A;  2NQ8 C;  3GLI B;  2Y2L A;  3J80 S;  4OJL A;  5IWA M;  3U6M A;  3BOS A;  1L2B A;  3PNV A;  3U6Q A;  2ZM6 M;  2UXB M;  2KRU A;  2I7N A;  2C96 A;  3GRR A;  4GIT A;  3KOZ E;  1R2Y A;  4HLQ A;  1SXJ D;  2R4E A;  2KW0 A;  3AOG A;  4M9X A;  4NXM M;  1L2D A;  2DZO B;  3MHV C;  2QBY B;  3L26 A;  3GQ3 A;  4JI8 M;  1XNQ M;  4L78 A;  4LJ4 A;  1R7R A;  4L8R C;  3FTE A;  3UZU A;  3HU2 A;  2Q2E B;  4MM3 B;  4QHT A;  3SYL A;  4DR7 M;  1Z59 A;  1J5E M;  3DFZ A;  3E4R A;  1HT1 E;  1K3W A;  1HQY E;  1H6U A;  2Y2P A;  3HSH A;  4R3D A;  2CHV A;  5BR8 M;  1E9R A;  5EJC A;  3GLF A;  3AV0 A;  5ITY A;  1SXJ B;  2J7O A;  5ITX A;  4JXJ A;  2DHR A;  4M0D A;  1YU1 A;  1HNX M;  1XMQ M;  2FNA A;  5DYI A;  3D8B A;  1DGB A;  1HR0 M;  1SXJ A;  2DWL A;  3VKH A;  1TDH A;  3AJI B;  2LH0 A;  3T38 A;  3CF6 E;  4IJE A;  2D7H A;  4D80 A;  3UJN A;  2ZAM A;  1OJL A;  2Y2O A;  1IN7 A;  3U6E A;  5FSW A;  1NNJ A;  2Y20 A;  5F3W A;  2A5Y B;  2D7E A;  4NRW A;  4B3M M;  2G8L A;  4AKH A;  4IIW A;  3TWK A;  4GKJ M;  7CAT A;  3J27 B;  4JI3 M;  2UXC M;  5BPV A;  4MGZ E;  2IOU A;  4YHH M;  4DV2 M;  3KS8 A;  2HL7 A;  2C9O A;  2UWX A;  3CF0 A;  1YUB A;  3U60 A;  2YR0 A;  4DR1 M;  3W0F A;  5JI3 E;  1G59 A;  2Y0T A;  4PCZ A;  4BLC A;  3R9X B;  4NZ4 A;  3FKE A;  2FFJ A;  3FTD A;  3PVS A;  3KP0 E;  3D8L A;  5E26 A;  3T1Y M;  2X4A A;  3I4Y A;  2R46 A;  1DGH B;  1IN6 A;  5FTK A;  4DV6 M;  4FD2 A;  1K82 A;  1WXQ A;  3SMS A;  5KPR A;  4DV0 M;  1Z5C A;  1S3S A;  4QOS A;  1Z5B A;  1IM2 A;  3M0E A;  5ITX E;  4D81 A;  3J2P B;  4CGY B;  3GLF B;  3SFZ A;  4OJ5 A;  3U5Z A;  3J7A S;  3U60 B;  2F5Q A;  2L7I A;  1YU2 A;  5GKN A;  1KFV A;  4FCW A;  4DUZ M;  4B3T M;  4GRI A;  1QAN A;  5JI2 E;  4R7G A;  4LJ7 A;  3THG A;  4OJP A;  1NHW C;  2F5S A;  3A42 A;  2D7G A;  1PM5 A;  3M6A A;  4JI4 M;  2XGN A;  2FOI C;  3DZD A;  4LJA A;  4G4O A;  2O5R A;  1TH3 A;  3GP1 A;  3B9P A;  3A45 A;  5E6J A;  1NNU C;  4JYA M;  4AG6 A;  2QEN A;  1G3I A;  2KRK A;  3U5Z B;  5EP1 A;  3U6O A;  4LF8 M;  3HON A;  1YUE A;  2R62 A;  1IN4 A;  4L15 A;  1GL7 A;  2QPA A;  4XGI A;  4JV5 M;  3IG5 A;  1L1T A;  1C1K A;  2XZU A;  3KSJ A;  3UMM A;  3SBJ A;  3Q8X A;  4DR4 M;  4GC9 A;  4NSR A;  2DWZ B;  1J7K A;  5DYG A;  4IBD A;  1Z6T A;  3L2A A;  4OX9 M;  2CV0 A;  4NY2 A;  2EA0 A;  3FUW A;  4B7H A;  1DGG A;  3K1J A;  1QAM A;  2Z4S A;  2Y2K A;  4JI5 M;  1R2Z A;  3WHL A;  2F5N A;  4L16 A;  4KOD A;  4II7 A;  1IQP A;  1GL6 A;  1E9S A;  2FFF B;  1G41 A;  1XWI A;  4MGY E;  2XEP A;  4YY3 M;  5C18 A;  1ZQ9 A;  3PNY A;  3KS4 A;  4KHP M;  1IN8 A;  3OTO M;  1DGF A;  1Q3B A;  3KOY E;  1N36 M;  2JE5 A;  2KZU A;  2F4V M;  4AQY M;  2DVW B;  3JR4 A;  5C1B A;  3U6P A;  2R45 A;  3DOA A;  3HJS A;  3RGS A;  2C5R A;  3EIE A;  1NY5 A;  4LGM A;  5KQ8 A;  4GC5 A;  4RNA A;  4IBI A;  3L29 A;  5KQD A;  2FE8 A;  4GKK M;  2HCB A;  1W5T A;  2K47 A;  1GKI A;  3KDS E;  2XD5 A;  3K2L A;  3U61 B;  2OPF A;  2KA6 B;  1G8P A;  1YE9 A;  4I81 A;  1K3X A;  3HWS A;  1DO0 A;  2M60 A;  3U6S A;  3TL4 X;  3PFI A;  2XD1 A;  1ORY B;  4B7F A;  3SHG B;  3GO8 A;  3U6L A;  2HHH M;  2Y2Q A;  2ZAO A;  2Z4R A;  1D2N A;  4FWH A;  3LQQ A;  4G4R A;  1Z5A A;  2R4J A;  2XLJ A;  4LG2 A;  1N75 A;  4KO8 A;  3SYK A;  4OU7 A;  1NY6 A;  4M0W A;  1QZM A;  2Y0Q A;  3JAM S;  5ITT A;  3CTW B;  5IZ7 D;  2JCH A;  3UK6 A;  4LGY A;  2XSZ D;  4LF5 M;  5FTJ A;  3FUX A;  4MGH A;  3ILK A;  3HU1 A;  2BNK A;  4GMQ A;  4S12 A;  3RE8 A;  4B3R M;  4FW9 A;  3NBI A;  1QAO A;  2YFQ A;  4QOZ C;  4DR2 M;  2Y2G A;  4OJO A;  3J81 S;  3VKG A;  2RGH A;  4JI0 M;  5ITQ A;  4GIP A;  2VII A;  1JQJ C;  4LZZ A;  3M7G A;  3C58 A;  2UU9 M;  5EXS A;  3FYC A;  3FTC A;  2KEB A;  4QHS A;  3N3F A;  5KPZ A;  2Y21 A;  2H1R A;  4X65 M;  4DV1 M;  5ITR A;  2CUZ A;  2Y2M A;  4LF6 M;  2C9C A;  1IBK M;  4FCT A;  4OVZ A;  4WW0 A;  4LY6 A;  3AL0 C;  2L09 A;  2CV1 A;  1QYR A;  3SMP A;  2UXD M;  3IG8 A;  1TH2 A;  4D82 A;  3I4V A;  2QCU A;  5ITU A;  1VDD A;  5KPT A;  2EUC A;  4P16 A;  1JR3 D;  2XSZ A;  4HL4 A;  1I4W A;  1SXJ E;  3CF2 A;  4BB9 A;  1QQW A;  3QAU A;  3T1H M;  4IJF A;  4LCB A;  4B7G A;  4B08 A;  4RF1 A;  4GHL A;  2C99 A;  1I94 M;  3K8Z A;  3FYD A;  3KOW E;  4IBG A;  4LZJ A;  1L2C A;  4GH9 A;  1QAQ A;  3KXE C;  2Y2I A;  2AHM A;  3HJQ A;  4DR3 M;  1MU5 A;  4LFA M;  2XH9 A;  2V6Z M;  3I51 A;  1XNR M;  3GRY A;  1XXH A;  3TE6 A;  4AKG A;  2F5P A;  3HKP A;  4NZ5 A;  4AZF A;  1Q39 A;  2CEA A;  1NVM A;  4OW0 A;  4XBO A;  3VK7 A;  3ZC7 B;  4MGK E;  3KSX A;  2QP9 X;  4JI6 M;  5IRE B;  4JI2 M;  3SHF A;  3SAS A;  4FWG A;  1TGU A;  3T15 A;  4LF7 M;  2LXE A;  2DWM A;  4PT5 A;  4LJ8 A;  3TPZ A;  1J09 A;  2L7H A;  4MH0 E;  3GLI A;  3A46 A;  3EIH A;  4JN6 A;  5FTN A;  3LQR A;  3LVW A;  3GLG B;  1IXS B;  3HGI A;  2V1C A;  4A3V B;  2KXE A;  4DUY M;  1DGH A;  3KW6 A;  2YQZ A;  1YU3 A;  5FLX S;  2G5G X;  1HQC A;  4OUI A;  2R18 A;  2I7P A;  2Z3X A;  3KOX E;  5EP2 A;  4LFC M;  4NSO B;  5KO3 A;  3HHZ A;  4DV3 M;  5DNY A;  2X8A A;  1NJF A;  4PDG A;  1TH4 A;  3FD9 A;  1N33 M;  1HNZ M;  4NYY A;  4QNM A;  4FCV A;  3GLH A;  4DV5 M;  2R65 A;  2LWX A;  2XFS A;  1N32 M;  3AOE C;  4JI7 M;  3A98 B;  4IBF A;  4AKI A;  2E5L M;  3SAU A;  3GPY A;  4Z8X A;  4MGI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...