4IBGA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibgA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibgA02
4IBJA 4IBBA 3L26A 4IJFA 3L2AA 3FKEA 3L27A 4IBCA 3L25A 3KS8A 4IBDA 4IBIA 4LG2A 4IBGA 3KS4A 4IBEA 4IBKA 3L28A 4IJEA 4IBFA 3L29A 4GH9A 4GHLA 4GHAA 5BPVA
chains in the Genus database with same CATH superfamily
4G6ZA 4G3OA 3B7NA 4DV7M 2KRKA 1ZMWA 2L4FA 3F92A 2UUBM 3T6PA 4LFBM 2Y2NA 2RGHA 2UUCM 4BB9A 4OVZB 8CATA 3J81S 3TWKA 3ZC7B 1PJSA 4NSOB 5ITXE 2F5SA 3CGWA 1E32A 3FKEA 3WD4A 4NYUA 1W1VA 1LV7A 3SASA 2V5OA 3PFIA 1G41A 1NO1A 2RTSA 4OU7A 2KXEA 3KSXA 4QHTA 5ITTA 4DV0M 3I01M 4G4QA 3A42A 3QYEA 4AW4A 5JI2E 4OJPA 5EXXA 1XB2B 2CV2A 1QAMA 1OKSA 2UUAM 1GOIA 2D7EA 3W68A 1GABA 1YU4A 1E88A 2DAMA 4WW0A 4D80A 1I94M 5KQDA 1G8PA 1FJGM 1G71A 4Z6YA 1QYRA 3EIHA 1WR1B 1PRBA 3FTCA 4L4UA 4MM3B 3VK8A 2DKLA 1NJGA 2KZUA 2ZTDA 1NNJA 1SXJE 2R46A 4NXNM 2KA6B 1YU3A 3MJ5A 1NJFA 2ZAOA 4F1IA 3K1JA 2H5XA 2LVAA 1Z59A 2MROB 1SXJD 2CP8A 4FW9A 2JA2A 2HKJA 4LGMA 4OJ5A 2R18A 4CIZA 3WD2A 5ITYA 1L6JA 4GC5A 4R71A 4GITA 1IY1A 1AUAA 2VIIA 3SC3A 3SMSA 1JR3A 5H37D 2OPFA 1JB0F 5EP1A 3I04M 4REZA 1VEJA 4EIWA 1EFUB 3RFWA 3GLFB 4II7A 3H4JA 4DV5M 3T1HM 1G59A 1W1TA 1GXDA 1JR3E 1DO2A 3NBXX 3I4YA 1PJTA 2ZTCA 2L2DA 3FE3A 3THGA 4LZJA 3SAUA 1YLAA 1VQ1A 3K9PA 1R6BX 1Z5BA 4BBAA 1HR0M 4L15A 4OJ6A 3K8ZA 4LY6A 2JY6B 2MR9A 3GLHB 2EKFA 1H6UA 3SMPA 4NZ5A 1IY2A 2M60A 3B7ZA 4RKUF 1YSYA 4AI6A 3K9OA 5ITRA 1N75A 3RGSA 3GLGA 1IN5A 1H8PA 3E21A 1E15A 2LXEA 1OJLA 4MH0E 2Y0QA 3GLFA 4R7GA 1XC8A 3HJSA 3U60B 3HJQA 2C99A 3HHXA 2Y2LA 2BWBA 4Z8XA 2C9OA 4BLCA 1JQJC 4IBIA 3GLGE 1PM5A 1DGGA 1V34A 3HHWA 3LCVB 1TDHA 3FTFA 2QBYA 5LMNM 3MHVC 4DR5M 4OJLA 4KLNA 2YNMD 3ILKA 3UGJA 2QSFX 2EJSA 2D7HA 1HT1E 1NNUC 4M9XA 1QQWA 5F3WA 4L8RC 1DGHB 1OGBA 1Q02A 4PCZA 3HU3A 4DR3M 2G8LA 2DAEA 2DAGA 2CRUA 5DYIA 2K9DA 3JR4A 3U60A 1UR9A 4CISA 3J7BA 2R4EA 3FUXA 1Q39A 2L6OA 3GP1A 2UXBM 1PJJA 2X49A 1YE9A 2Q2EB 2R6FA 3JR5A 3R8FA 2G5GX 3K2LA 2XH9A 1WXQA 1N78A 3J2PB 5IT9S 5KPTA 1A5TA 2Y2PA 4D82A 2Y2GA 1VDLA 4JI7M 2XD1A 2OO9A 2L7HA 3B9PA 3HX3A 4G4NA 2HCBA 3LVWA 4IBGA 2KNAA 2K47A 5FTNA 2LNHC 4A3VB 4QOZC 1ZMVA 4LJ5A 3VKHA 2HAKA 3BOSA 1CXWA 2XSZA 4MB7A 3OTOM 4LRSA 1FNNA 1D0LA 2DNAA 2EKKA 4DR1M 3W0LB 4MGYE 1VEGA 2ZAMA 2Y2KA 2Z7JA 3A98B 3V76A 3FTEA 1L8QA 4GEWA 4X64M 1YU2A 4HEOA 2EO2A 5IWAM 1R7RA 3AV0A 1QVRA 2OQ4A 3U6QA 3GPYA 4DR6M 2KHHA 2Z8YM 3UJNA 4M0DA 3MK6A 3B7QA 1XWIA 2JZ1A 3QYBA 3W67A 4NXMM 4FVMA 4GKJM 1CUKA 5KO3A 1W1YA 1J7KA 1DO0A 1MJGM 4S12A 5EJCA 4PD2A 4Y28F 2FN2A 2XLJA 3VDPA 4LF6M 2M5ZA 4Z2IA 2LWXA 2WSFF 1K82A 1AIPC 3FD9A 3TPZA 3LMMA 2JP7A 4ZPXA 1HT2E 5E6JA 3AOEC 4OW0A 5ITXA 5FTLA 3IG5A 4X66M 3CF0A 1GJSA 1SXJB 4G4RA 3GLIA 1PJIA 1Y8GA 3NBIA 2DHYA 2X4AA 2YFQA 3MMPA 4ITQA 3WD3A 1G4AE 1G3IA 1D0MA 3AOGA 4RF0A 2DAIA 2JZ0A 4LF5M 4JV5M 2XF3A 2XFTA 3T15A 2CV0A 3HONA 2JY7A 2LH0A 3GLIE 3HWSA 4I81A 4AG6A 2DI0A 1HNZM 3KP0E 4I4LA 4NOOB 1OFHA 1H0IA 5EXSA 3GO8A 4CHTB 1SXJA 2XD5A 4FD2A 5FTKA 1XMOM 4K0KM 1E8BA 3U61A 4FWGA 3GQ5A 3TQSA 4HLQA 4B3TM 1IN4A 3E4RA 2L09A 3PXGA 3SHGB 5FSWA 2F5PA 2RRUA 4GMQA 5DFLA 4JI3M 4HMCA 4M9SA 2XGNA 4B7GA 4B7FA 1WJ7A 4I8OA 4TUWA 4NSRA 3KP1E 4AKIA 1E6RA 5FTMA 1IXZA 2DZNB 5DNYA 4MGHA 1TR8A 5KQ8A 4Z2LA 2MGWA 4KODA 3C58A 4AKGA 1EE8A 4Q7JA 7CATA 3FUTA 4DR4M 3GLGB 1XNQM 2WSCF 3TL4X 3J27B 1T43A 1Z5CA 4CJ6A 2VF8A 3KDSE 4OUIA 1V33A 3HJ8A 4LJ4A 2KNVA 5EQTA 2DZOB 2OOAA 3W0FA 3IHPA 1XXHB 1YUBA 1W5TA 3RGPA 4IBJA 1L2CA 2DWMA 2QBYB 4PDIA 3U6LA 4X65M 2Y2QA 2CFOA 3EIEA 2Z3XA 1E9RA 1TH2A 2C9CA 2CE7A 1R2YA 1HQCA 4JI0M 3SARA 1IFYA 1SG9A 1KS0A 2XZFA 3RE8A 1TH3A 5IZ7D 3UMMA 3GPUA 4AQYM 1N77A 1N36M 3A46A 2F4VM 3GRVA 1KSFX 2WSEF 4DV3M 4KT0F 1XXHA 2JCHA 2GNOA 4MGIE 3HU1A 2R45A 1R5LA 5IREB 4CGYB 4FWHA 2CV1A 2Z4RA 4GH9A 1GLNA 4TX8A 1NVMA 3HKPA 1QZEA 1OTRA 2CHGA 4P17A 1XXHE 3UK6A 2Y2JA 2LVQD 3FRHA 1YUEA 4IBBA 2H1RA 3GRYA 2BJWA 3AJIB 1V92A 3AFHA 3SFZA 3LW5F 1IN6A 4QOSA 3SYLA 1K3XA 3L27A 2C98A 1W5SA 3VKGA 1IXSA 2R4JA 2KW0A 4YHHM 1D2NA 3U6PA 3M6AA 3TWMA 3U6SA 2DXIA 2JWSA 2O5RA 4JI5M 4JN6A 4XGIA 3T1YM 3SATA 2I7PA 2BWEA 5EP3A 1EAKA 1E6ZA 5EXTA 1HNWM 3HSHA 1OIZA 1R4GA 4GHLA 1UM8A 1I4WA 3PNVA 3DA1A 4DUYM 3U5ZA 3N3FA 4AKHA 3L26A 5GKNA 3KVWA 4DV2M 2F5OA 4Z2KA 1OQYA 2CHVA 4JXJA 2QCUA 1VEKA 3M7GA 4DV6M 3GQ4A 1E6NA 1E94E 1L1ZA 2EUCA 3AL0C 2FS1A 1MN3A 3ZCBB 2IOUA 1J7MA 2ERCA 1BVSA 1OFIA 2LVNC 2C96A 2XFSA 3LCUA 4LJ6A 1K3WA 2BG1A 1X37A 4FCTA 2JE5A 2O25A 1S3SA 4FWDA 4B3MM 1WGLA 2QHOB 1QZMA 4IBDA 1E9SA 2R0IA 1QDRA 3KOYE 4LG2A 3GLIB 2N35A 3VFDA 1NY6A 3KOWE 1WIVA 2BNKA 1QUSA 3L28A 4IJEA 4B08A 2B3TA 4LCBA 3Q8GA 5JI3E 3L29A 2UXDM 2R44A 4MB3A 3KXEC 3GPPA 1J09A 2ZM6M 3BBZA 2BJVA 3M0EA 5EP4A 4L78A 3DZDA 4QHSA 2L7IA 1GKIA 4NZ1A 3U6DA 4YY3M 3VLFB 3CTWB 1DGBA 3HHYA 4MGZE 4GIPA 1NY5A 3PNYA 1DV0A 1LTMA 3QWLA 2P5TA 3U61B 2Y2MA 3FRIA 2QENA 3L25A 1IXRC 1HQYE 2Y0TA 5EP2A 2DAKA 1UR8A 3KFUG 1ZAEA 2KEBA 4LJ9A 1ZV1A 1CK7A 1MU5A 3E46A 3KW6A 4LF7M 2QP9X 4NC6A 4DV1M 4HMDA 4LRTA 4MB4A 3A45A 1HJPA 5LMUM 4RF1A 1WHCA 3VDUA 4JI1M 1C1KA 3FTDA 3SAVA 1SXJC 4FCWA 3SAWA 2UWXA 1WGNA 3WHKA 5L8RF 4R3DA 4WP2A 2X8AA 4I5SA 4JI6M 3BXWA 2YQZA 4G4OA 3PVSA 3WX7A 1C7YA 5ITQA 3U6OA 4Z2GA 1KFVA 4GRIA 5BR8M 1OGGA 5C18A 3GRRA 2J7NA 3U6CA 1T3TA 1IBKM 4IBCA 3SYKA 3QAUA 2ZBKB 3HZJA 3WHLA 3D8BA 3AKZA 2E5LM 3TE6A 1IBMM 2GQFA 2I7NA 3C3DA 1GL7A 2DENA 4JYAM 2CEAA 3TWLA 5DYGA 2JUJA 3K92A 2R65A 3HHZA 2JNHA 2RGOA 1PDCA 4LF8M 4X62M 1Z6TA 2KRUA 2XEPA 4DUZM 4LGYA 2MJ5B 4QNLA 2FOIC 2JY5A 4MGKE 4NRWA 1OAOC 4IBFA 4OVZA 5C1BA 1L2DA 4RNAA 2OOBA 1N32M 2K6BA 1N33M 4GHAA 4GC9A 3HU2A 5BPVA 2D49A 1QO6A 1IN7A 4ANRA 1HNXM 2A5YB 3ZQJA 2R62A 2XZUA 2DWZB 3SBJA 1QUTA 5A2QS 4KO8A 3FUUA 4NYYA 4M9ZA 4WURA 5EXPA 1ZMUA 2F5NA 2Y2OA 4IIWA 2AHMA 3WD1A 2J7OA 2Z4SA 4XK8F 3U6MA 1E6PA 3WD0A 1VDDA 3FYCA 2RKOA 4JI2M 2QZ4A 4OX9M 1IN8A 3C9PA 3LQQA 1KYIA 4W5WA 4D81A 1AIWA 3FYDA 3KS4A 3MQLA 1RU3A 2LTUA 3IG8A 1NHGC 2LHGA 2WZJA 3IECA 4DR7M 4QNMA 3GRUA 2EA0A 4PT5A 1IXSB 3U6EA 2JXNA 2DWLA 1O6IA 1NHWC 1ED7A 1NSFA 1JR3D 2J5YA 3CF6E 4LF9M 2LBCA 1Q3CA 2O01F 1QDTA 2ZANA 4OJOA 3GQ3A 1D0KA 2CUZA 4LJAA 1GL6A 3UZUA 4DV4M 2F5QA 5ITUA 1TTEA 4LJ8A 2CHQA 3J80S 3SHFA 3U5ZB 3VK7A 2KNZA 1IBLM 2HL7A 1XNRM 4MB5A 3R9XB 2KZSA 4UN2B 3GLFE 3LQRA 4QNRA 4LFCM 1GJTA 2D7GA 3B89A 3CF2A 3GLHA 2LVOC 1IY0A 4B7HA 1OAIA 2DHRA 2W82A 3LVVA 4GKKM 3T38A 2DWNA 3I4VA 2UXCM 1GO5A 4DR2M 2DZLA 1DGFA 1ZQ9A 4JI4M 3KSJA 1TGUA 2APLA 2QNJA 3GLHE 3JAMS 3J7AS 1XMQM 3DOAA 3KOZE 1IQPA 1NV8A 3NWLA 4M0WA 3ZH9B 2QPAA 4KHPM 1GVNA 3M7PA 1QAQA 1L1TA 1L2BA 3L2AA 2FE8A 2L4EA 3KOXE 4LZZA 1QANA 2V6ZM 3FUVA 4HL4A 4NRVA 4PDGA 2VQFM 3H4MA 2NQ8C 4AG5A 1DGHA 1GPFA 2DVWB 4NY2A 3FUWA 4IBEA 1W1PA 3DFZA 2FFFB 5KPZA 2LVPC 4Z2JA 1J5EM 4LF4M 4NZ4A 3HY5A 3Q8XA 2Y2HA 4L6V6 1NV9A 2VDBB 2V1CA 1ORYB 2QQ8A 1YU1A 1TF0B 2FNAA 5KPRA 1P3QQ 3B74A 1XHBA 1UFZA 4IJFA 4DBGB 2MH8A 4P16A 1Z5AA 4L16A 1VG5A 2XSZD 2YR0A 2C5RA 4HMEA 2HWJA 2CWBA 3E9SA 1PGYA 4NL4H 2VQEM 4Z2HA 3C3EA 4B3RM 1YU0A 5FTJA 2G3QA 2K0BX 1Q3BA 1QAOA 1F4IA 3D8LA 1PJQA 3KS8A 2FFJA 4NZ3A 2HHHM 1OIPA 1TDZA 2LHCA 2Y20A 1T6OA 2Y2IA 4FCVA 4LJ7A 2Y21A 1MX0A 4XBOA 4JI8M 3I51A 2UU9M 4IBKA 3GPXA 4LFAM 2VF7A 1EIJA 4B3SM 5FLXS 2JY8A 2FH0A 5E26A 1R2ZA 1TH4A 1N34M 2KDLA 2V1UA 1IM2A 4AZFA 4F2LA 3HGIA 3AOEA 1H0GA
chains in the Genus database with same CATH topology
4G6ZA 4DV7M 2KRKA 2UUBM 4LFBM 2Y2NA 2RGHA 2UUCM 4BB9A 4OVZB 8CATA 3J81S 3TWKA 3ZC7B 4NSOB 5ITXE 2F5SA 1E32A 3FKEA 4NYUA 1LV7A 3SASA 3PFIA 1G41A 4OU7A 2KXEA 3KSXA 4QHTA 5ITTA 4DV0M 4G4QA 3A42A 4AW4A 5JI2E 4OJPA 5EXXA 2CV2A 1QAMA 2UUAM 2D7EA 1YU4A 4WW0A 4D80A 1I94M 5KQDA 1G8PA 1FJGM 4Z6YA 1QYRA 3EIHA 3FTCA 4L4UA 4MM3B 3VK8A 2KZUA 1NJGA 1NNJA 1SXJE 2R46A 4NXNM 2KA6B 1YU3A 3MJ5A 1NJFA 2ZAOA 3K1JA 1Z59A 1SXJD 4FW9A 2JA2A 2HKJA 4LGMA 4OJ5A 2R18A 5ITYA 4GC5A 4GITA 1IY1A 2VIIA 3SC3A 3SMSA 1JR3A 5H37D 2OPFA 5EP1A 4REZA 4EIWA 3RFWA 3GLFB 4II7A 4DV5M 3T1HM 1G59A 1DO2A 3I4YA 3THGA 3SAUA 4LZJA 4BBAA 1R6BX 1Z5BA 4OJ6A 1HR0M 4L15A 3K8ZA 4LY6A 3GLHB 1H6UA 3SMPA 4NZ5A 1IY2A 2M60A 1YSYA 4AI6A 5ITRA 1N75A 3RGSA 3GLGA 1IN5A 2LXEA 1OJLA 4MH0E 2Y0QA 3GLFA 4R7GA 1XC8A 3HJSA 3U60B 3HJQA 2C99A 3HHXA 2Y2LA 4Z8XA 2C9OA 4BLCA 1JQJC 4IBIA 1PM5A 1DGGA 3HHWA 1TDHA 3FTFA 2QBYA 5LMNM 3MHVC 4DR5M 4OJLA 4KLNA 2YNMD 3ILKA 3UGJA 2VQFM 5F3WA 2D7HA 1HT1E 1NNUC 4M9XA 1QQWA 4L8RC 1DGHB 4PCZA 3HU3A 4DR3M 2G8LA 3JR4A 5DYIA 3U60A 4CISA 3J7BA 2R4EA 3FUXA 1Q39A 2L6OA 3GP1A 2UXBM 1PJJA 2X49A 1YE9A 2Q2EB 3R8FA 3JR5A 1N78A 2G5GX 2XH9A 1WXQA 3J2PB 5IT9S 5KPTA 2Y2PA 4D82A 2Y2GA 4JI7M 2XD1A 3B9PA 2L7HA 4G4NA 2HCBA 3LVWA 4IBGA 4QOZC 2K47A 5FTNA 2LNHC 4A3VB 4LJ5A 3VKHA 3BOSA 2XSZA 4MB7A 3OTOM 4LRSA 1FNNA 4DR1M 3W0LB 4MGYE 2ZAMA 2Y2KA 3A98B 2Z7JA 3FTEA 1L8QA 4X64M 1YU2A 2EO2A 5IWAM 1R7RA 3AV0A 1QVRA 2OQ4A 3U6QA 3GPYA 4DR6M 3UJNA 4M0DA 3MK6A 1XWIA 4NXMM 4FVMA 4GKJM 5KO3A 1J7KA 1DO0A 4S12A 5EJCA 4PD2A 2XLJA 3VDPA 4LF6M 2M5ZA 2LWXA 1K82A 3FD9A 3TPZA 3LMMA 4ZPXA 1HT2E 5E6JA 3AOEC 4OW0A 5ITXA 5FTLA 3IG5A 4X66M 3CF0A 1SXJB 4G4RA 3GLIA 1PJIA 3NBIA 4ITQA 2X4AA 2YFQA 1G4AE 1G3IA 3AOGA 4RF0A 4LF5M 4JV5M 2XF3A 2XFTA 3T15A 2CV0A 3HONA 2LH0A 3HWSA 4I81A 4AG6A 1HNZM 3KP0E 4I4LA 4NOOB 1OFHA 5EXSA 3GO8A 4CHTB 1SXJA 2XD5A 4FD2A 5FTKA 1XMOM 4K0KM 3U61A 4FWGA 3GQ5A 3TQSA 4HLQA 4B3TM 1IN4A 3E4RA 2L09A 3PXGA 3SHGB 5FSWA 2F5PA 4GMQA 4JI3M 4M9SA 2XGNA 4B7GA 4B7FA 4I8OA 4TUWA 4NSRA 3KP1E 4AKIA 5FTMA 1IXZA 2DZNB 5DNYA 4MGHA 5KQ8A 4KODA 3C58A 4AKGA 1EE8A 7CATA 3FUTA 4DR4M 3GLGB 1XNQM 3TL4X 3J27B 1Z5CA 4OUIA 3KDSE 3HJ8A 4LJ4A 5EQTA 2DZOB 3W0FA 1XXHB 1YUBA 1W5TA 3RGPA 4IBJA 1L2CA 2DWMA 2QBYB 4PDIA 3U6LA 4X65M 2Y2QA 2CFOA 3EIEA 2Z3XA 1E9RA 1TH2A 2C9CA 2CE7A 1R2YA 1HQCA 4JI0M 3SARA 2XZFA 3RE8A 1TH3A 5IZ7D 3UMMA 3GPUA 4AQYM 1N77A 1N36M 3A46A 2F4VM 3GRVA 1KSFX 4DV3M 1XXHA 2JCHA 4MGIE 3HU1A 2R45A 5IREB 4CGYB 4FWHA 2CV1A 2Z4RA 4GH9A 1GLNA 1NVMA 3HKPA 2CHGA 3UK6A 2Y2JA 1YUEA 4IBBA 2H1RA 3GRYA 2BJWA 3AJIB 3AFHA 3SFZA 1IN6A 4QOSA 3SYLA 1K3XA 3L27A 2C98A 1W5SA 3VKGA 2R4JA 2KW0A 4YHHM 1D2NA 3U6PA 3M6AA 3TWMA 3U6SA 2DXIA 2O5RA 4JI5M 4JN6A 4XGIA 3T1YM 3SATA 2I7PA 5EP3A 5EXTA 1HNWM 3HGIA 3HSHA 4GHLA 1UM8A 1I4WA 3PNVA 3DA1A 4DUYM 3U5ZA 3N3FA 4AKHA 3L26A 5GKNA 3KVWA 4DV2M 2F5OA 2CHVA 4JXJA 2QCUA 3M7GA 4DV6M 3GQ4A 1E94E 1L1ZA 2EUCA 3AL0C 3ZCBB 2IOUA 2ERCA 1OFIA 1K3WA 2C96A 2XFSA 4LJ6A 2BG1A 1X37A 4FCTA 2JE5A 1S3SA 4FWDA 4B3MM 1QZMA 4IBDA 1E9SA 4LG2A 3KOYE 3GLIB 3VFDA 1NY6A 3KOWE 2BNKA 3L28A 4IJEA 4B08A 5JI3E 4LCBA 3L29A 2UXDM 3KXEC 3GPPA 1J09A 2ZM6M 2BJVA 3M0EA 5EP4A 4L78A 3DZDA 4QHSA 2L7IA 1GKIA 4NZ1A 3U6DA 4YY3M 3VLFB 3CTWB 1DGBA 3HHYA 4MGZE 4GIPA 1NY5A 3PNYA 3QWLA 2P5TA 3U61B 2Y2MA 2QENA 3L25A 1IXRC 1HQYE 2Y0TA 5EP2A 3KFUG 1ZAEA 2KEBA 4LJ9A 1MU5A 3KW6A 4LF7M 2QP9X 4DV1M 4LRTA 3A45A 5LMUM 4RF1A 3VDUA 4JI1M 1C1KA 3FTDA 3SAVA 1SXJC 4FCWA 3SAWA 2UWXA 3WHKA 4R3DA 2X8AA 4I5SA 4JI6M 2YQZA 4G4OA 3PVSA 3WX7A 5ITQA 3U6OA 1KFVA 4GRIA 5BR8M 5C18A 3GRRA 2J7NA 3U6CA 1T3TA 1IBKM 4IBCA 3SYKA 3QAUA 2ZBKB 2E5LM 3WHLA 3D8BA 3AKZA 3TE6A 1IBMM 2I7NA 1GL7A 4JYAM 2CEAA 3TWLA 5DYGA 3K92A 2R65A 3HHZA 2RGOA 4LF8M 4X62M 1Z6TA 2KRUA 2XEPA 4DUZM 4LGYA 4QNLA 2FOIC 4MGKE 4NRWA 5C1BA 4IBFA 4OVZA 1L2DA 4RNAA 1N32M 1N33M 4GHAA 4GC9A 3HU2A 5BPVA 1IN7A 1HNXM 2A5YB 2R62A 2XZUA 2DWZB 3SBJA 5A2QS 4KO8A 3FUUA 4NYYA 4M9ZA 4WURA 5EXPA 2F5NA 2Y2OA 4IIWA 2AHMA 2J7OA 2Z4SA 3U6MA 1VDDA 3FYCA 2RKOA 4JI2M 2QZ4A 4OX9M 1IN8A 3LQQA 4W5WA 1KYIA 4D81A 3FYDA 3KS4A 3IG8A 1NHGC 4DR7M 4QNMA 3GRUA 2EA0A 4PT5A 1IXSB 3U6EA 2DWLA 1NHWC 1NSFA 1JR3D 3CF6E 4LF9M 1Q3CA 2ZANA 4OJOA 3GQ3A 2CUZA 4LJAA 1GL6A 3UZUA 4DV4M 2F5QA 5ITUA 4LJ8A 3SHFA 2CHQA 3J80S 3U5ZB 3VK7A 1IBLM 2HL7A 1XNRM 3R9XB 2KZSA 3LQRA 4QNRA 4LFCM 2D7GA 3CF2A 3GLHA 1IY0A 4B7HA 2DHRA 2W82A 3LVVA 4GKKM 3T38A 2DWNA 3I4VA 2UXCM 4DR2M 1DGFA 1ZQ9A 4JI4M 3KSJA 1TGUA 3JAMS 3J7AS 1XMQM 3DOAA 3KOZE 1IQPA 3NWLA 4M0WA 3ZH9B 2QPAA 4KHPM 1GVNA 1QAQA 1L1TA 1L2BA 3L2AA 2FE8A 3KOXE 4LZZA 1QANA 2V6ZM 3FUVA 4HL4A 4NRVA 4PDGA 3H4MA 2NQ8C 4AG5A 1DGHA 2DVWB 4NY2A 3FUWA 4IBEA 3DFZA 2FFFB 5KPZA 1J5EM 4LF4M 4NZ4A 3Q8XA 2Y2HA 2V1CA 1ORYB 1YU1A 2FNAA 5KPRA 1XHBA 4IJFA 4P16A 1Z5AA 4L16A 2XSZD 2YR0A 2C5RA 3E9SA 4NL4H 2VQEM 4B3RM 1YU0A 5FTJA 1Q3BA 1QAOA 3D8LA 3KS8A 2FFJA 4NZ3A 2HHHM 1TDZA 2Y20A 2Y2IA 4FCVA 4LJ7A 2Y21A 1MX0A 4XBOA 4JI8M 3I51A 2UU9M 4IBKA 3GPXA 4LFAM 4B3SM 5FLXS 5E26A 1R2ZA 1TH4A 1N34M 2V1UA 1IM2A 4AZFA 3K2LA 3AOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  4IBB A;  3L26 A;  4IJF A;  3L2A A;  3FKE A;  3L27 A;  4IBC A;  3L25 A;  3KS8 A;  4IBD A;  4IBI A;  4LG2 A;  4IBG A;  3KS4 A;  4IBE A;  4IBK A;  3L28 A;  4IJE A;  4IBF A;  3L29 A;  4GH9 A;  4GHL A;  4GHA A;  5BPV A; 
#chains in the Genus database with same CATH topology
 4G6Z A;  4G3O A;  3B7N A;  4DV7 M;  2KRK A;  1ZMW A;  2L4F A;  3F92 A;  2UUB M;  3T6P A;  4LFB M;  2Y2N A;  2RGH A;  2UUC M;  4BB9 A;  4OVZ B;  8CAT A;  3J81 S;  3TWK A;  3ZC7 B;  1PJS A;  4NSO B;  5ITX E;  2F5S A;  3CGW A;  1E32 A;  3FKE A;  3WD4 A;  4NYU A;  1W1V A;  1LV7 A;  3SAS A;  2V5O A;  3PFI A;  1G41 A;  1NO1 A;  2RTS A;  4OU7 A;  2KXE A;  3KSX A;  4QHT A;  5ITT A;  4DV0 M;  3I01 M;  4G4Q A;  3A42 A;  3QYE A;  4AW4 A;  5JI2 E;  4OJP A;  5EXX A;  1XB2 B;  2CV2 A;  1QAM A;  1OKS A;  2UUA M;  1GOI A;  2D7E A;  3W68 A;  1GAB A;  1YU4 A;  1E88 A;  2DAM A;  4WW0 A;  4D80 A;  1I94 M;  5KQD A;  1G8P A;  1FJG M;  1G71 A;  4Z6Y A;  1QYR A;  3EIH A;  1WR1 B;  1PRB A;  3FTC A;  4L4U A;  4MM3 B;  3VK8 A;  2DKL A;  1NJG A;  2KZU A;  2ZTD A;  1NNJ A;  1SXJ E;  2R46 A;  4NXN M;  2KA6 B;  1YU3 A;  3MJ5 A;  1NJF A;  2ZAO A;  4F1I A;  3K1J A;  2H5X A;  2LVA A;  1Z59 A;  2MRO B;  1SXJ D;  2CP8 A;  4FW9 A;  2JA2 A;  2HKJ A;  4LGM A;  4OJ5 A;  2R18 A;  4CIZ A;  3WD2 A;  5ITY A;  1L6J A;  4GC5 A;  4R71 A;  4GIT A;  1IY1 A;  1AUA A;  2VII A;  3SC3 A;  3SMS A;  1JR3 A;  5H37 D;  2OPF A;  1JB0 F;  5EP1 A;  3I04 M;  4REZ A;  1VEJ A;  4EIW A;  1EFU B;  3RFW A;  3GLF B;  4II7 A;  3H4J A;  4DV5 M;  3T1H M;  1G59 A;  1W1T A;  1GXD A;  1JR3 E;  1DO2 A;  3NBX X;  3I4Y A;  1PJT A;  2ZTC A;  2L2D A;  3FE3 A;  3THG A;  4LZJ A;  3SAU A;  1YLA A;  1VQ1 A;  3K9P A;  1R6B X;  1Z5B A;  4BBA A;  1HR0 M;  4L15 A;  4OJ6 A;  3K8Z A;  4LY6 A;  2JY6 B;  2MR9 A;  3GLH B;  2EKF A;  1H6U A;  3SMP A;  4NZ5 A;  1IY2 A;  2M60 A;  3B7Z A;  4RKU F;  1YSY A;  4AI6 A;  3K9O A;  5ITR A;  1N75 A;  3RGS A;  3GLG A;  1IN5 A;  1H8P A;  3E21 A;  1E15 A;  2LXE A;  1OJL A;  4MH0 E;  2Y0Q A;  3GLF A;  4R7G A;  1XC8 A;  3HJS A;  3U60 B;  3HJQ A;  2C99 A;  3HHX A;  2Y2L A;  2BWB A;  4Z8X A;  2C9O A;  4BLC A;  1JQJ C;  4IBI A;  3GLG E;  1PM5 A;  1DGG A;  1V34 A;  3HHW A;  3LCV B;  1TDH A;  3FTF A;  2QBY A;  5LMN M;  3MHV C;  4DR5 M;  4OJL A;  4KLN A;  2YNM D;  3ILK A;  3UGJ A;  2QSF X;  2EJS A;  2D7H A;  1HT1 E;  1NNU C;  4M9X A;  1QQW A;  5F3W A;  4L8R C;  1DGH B;  1OGB A;  1Q02 A;  4PCZ A;  3HU3 A;  4DR3 M;  2G8L A;  2DAE A;  2DAG A;  2CRU A;  5DYI A;  2K9D A;  3JR4 A;  3U60 A;  1UR9 A;  4CIS A;  3J7B A;  2R4E A;  3FUX A;  1Q39 A;  2L6O A;  3GP1 A;  2UXB M;  1PJJ A;  2X49 A;  1YE9 A;  2Q2E B;  2R6F A;  3JR5 A;  3R8F A;  2G5G X;  3K2L A;  2XH9 A;  1WXQ A;  1N78 A;  3J2P B;  5IT9 S;  5KPT A;  1A5T A;  2Y2P A;  4D82 A;  2Y2G A;  1VDL A;  4JI7 M;  2XD1 A;  2OO9 A;  2L7H A;  3B9P A;  3HX3 A;  4G4N A;  2HCB A;  3LVW A;  4IBG A;  2KNA A;  2K47 A;  5FTN A;  2LNH C;  4A3V B;  4QOZ C;  1ZMV A;  4LJ5 A;  3VKH A;  2HAK A;  3BOS A;  1CXW A;  2XSZ A;  4MB7 A;  3OTO M;  4LRS A;  1FNN A;  1D0L A;  2DNA A;  2EKK A;  4DR1 M;  3W0L B;  4MGY E;  1VEG A;  2ZAM A;  2Y2K A;  2Z7J A;  3A98 B;  3V76 A;  3FTE A;  1L8Q A;  4GEW A;  4X64 M;  1YU2 A;  4HEO A;  2EO2 A;  5IWA M;  1R7R A;  3AV0 A;  1QVR A;  2OQ4 A;  3U6Q A;  3GPY A;  4DR6 M;  2KHH A;  2Z8Y M;  3UJN A;  4M0D A;  3MK6 A;  3B7Q A;  1XWI A;  2JZ1 A;  3QYB A;  3W67 A;  4NXM M;  4FVM A;  4GKJ M;  1CUK A;  5KO3 A;  1W1Y A;  1J7K A;  1DO0 A;  1MJG M;  4S12 A;  5EJC A;  4PD2 A;  4Y28 F;  2FN2 A;  2XLJ A;  3VDP A;  4LF6 M;  2M5Z A;  4Z2I A;  2LWX A;  2WSF F;  1K82 A;  1AIP C;  3FD9 A;  3TPZ A;  3LMM A;  2JP7 A;  4ZPX A;  1HT2 E;  5E6J A;  3AOE C;  4OW0 A;  5ITX A;  5FTL A;  3IG5 A;  4X66 M;  3CF0 A;  1GJS A;  1SXJ B;  4G4R A;  3GLI A;  1PJI A;  1Y8G A;  3NBI A;  2DHY A;  2X4A A;  2YFQ A;  3MMP A;  4ITQ A;  3WD3 A;  1G4A E;  1G3I A;  1D0M A;  3AOG A;  4RF0 A;  2DAI A;  2JZ0 A;  4LF5 M;  4JV5 M;  2XF3 A;  2XFT A;  3T15 A;  2CV0 A;  3HON A;  2JY7 A;  2LH0 A;  3GLI E;  3HWS A;  4I81 A;  4AG6 A;  2DI0 A;  1HNZ M;  3KP0 E;  4I4L A;  4NOO B;  1OFH A;  1H0I A;  5EXS A;  3GO8 A;  4CHT B;  1SXJ A;  2XD5 A;  4FD2 A;  5FTK A;  1XMO M;  4K0K M;  1E8B A;  3U61 A;  4FWG A;  3GQ5 A;  3TQS A;  4HLQ A;  4B3T M;  1IN4 A;  3E4R A;  2L09 A;  3PXG A;  3SHG B;  5FSW A;  2F5P A;  2RRU A;  4GMQ A;  5DFL A;  4JI3 M;  4HMC A;  4M9S A;  2XGN A;  4B7G A;  4B7F A;  1WJ7 A;  4I8O A;  4TUW A;  4NSR A;  3KP1 E;  4AKI A;  1E6R A;  5FTM A;  1IXZ A;  2DZN B;  5DNY A;  4MGH A;  1TR8 A;  5KQ8 A;  4Z2L A;  2MGW A;  4KOD A;  3C58 A;  4AKG A;  1EE8 A;  4Q7J A;  7CAT A;  3FUT A;  4DR4 M;  3GLG B;  1XNQ M;  2WSC F;  3TL4 X;  3J27 B;  1T43 A;  1Z5C A;  4CJ6 A;  2VF8 A;  3KDS E;  4OUI A;  1V33 A;  3HJ8 A;  4LJ4 A;  2KNV A;  5EQT A;  2DZO B;  2OOA A;  3W0F A;  3IHP A;  1XXH B;  1YUB A;  1W5T A;  3RGP A;  4IBJ A;  1L2C A;  2DWM A;  2QBY B;  4PDI A;  3U6L A;  4X65 M;  2Y2Q A;  2CFO A;  3EIE A;  2Z3X A;  1E9R A;  1TH2 A;  2C9C A;  2CE7 A;  1R2Y A;  1HQC A;  4JI0 M;  3SAR A;  1IFY A;  1SG9 A;  1KS0 A;  2XZF A;  3RE8 A;  1TH3 A;  5IZ7 D;  3UMM A;  3GPU A;  4AQY M;  1N77 A;  1N36 M;  3A46 A;  2F4V M;  3GRV A;  1KSF X;  2WSE F;  4DV3 M;  4KT0 F;  1XXH A;  2JCH A;  2GNO A;  4MGI E;  3HU1 A;  2R45 A;  1R5L A;  5IRE B;  4CGY B;  4FWH A;  2CV1 A;  2Z4R A;  4GH9 A;  1GLN A;  4TX8 A;  1NVM A;  3HKP A;  1QZE A;  1OTR A;  2CHG A;  4P17 A;  1XXH E;  3UK6 A;  2Y2J A;  2LVQ D;  3FRH A;  1YUE A;  4IBB A;  2H1R A;  3GRY A;  2BJW A;  3AJI B;  1V92 A;  3AFH A;  3SFZ A;  3LW5 F;  1IN6 A;  4QOS A;  3SYL A;  1K3X A;  3L27 A;  2C98 A;  1W5S A;  3VKG A;  1IXS A;  2R4J A;  2KW0 A;  4YHH M;  1D2N A;  3U6P A;  3M6A A;  3TWM A;  3U6S A;  2DXI A;  2JWS A;  2O5R A;  4JI5 M;  4JN6 A;  4XGI A;  3T1Y M;  3SAT A;  2I7P A;  2BWE A;  5EP3 A;  1EAK A;  1E6Z A;  5EXT A;  1HNW M;  3HSH A;  1OIZ A;  1R4G A;  4GHL A;  1UM8 A;  1I4W A;  3PNV A;  3DA1 A;  4DUY M;  3U5Z A;  3N3F A;  4AKH A;  3L26 A;  5GKN A;  3KVW A;  4DV2 M;  2F5O A;  4Z2K A;  1OQY A;  2CHV A;  4JXJ A;  2QCU A;  1VEK A;  3M7G A;  4DV6 M;  3GQ4 A;  1E6N A;  1E94 E;  1L1Z A;  2EUC A;  3AL0 C;  2FS1 A;  1MN3 A;  3ZCB B;  2IOU A;  1J7M A;  2ERC A;  1BVS A;  1OFI A;  2LVN C;  2C96 A;  2XFS A;  3LCU A;  4LJ6 A;  1K3W A;  2BG1 A;  1X37 A;  4FCT A;  2JE5 A;  2O25 A;  1S3S A;  4FWD A;  4B3M M;  1WGL A;  2QHO B;  1QZM A;  4IBD A;  1E9S A;  2R0I A;  1QDR A;  3KOY E;  4LG2 A;  3GLI B;  2N35 A;  3VFD A;  1NY6 A;  3KOW E;  1WIV A;  2BNK A;  1QUS A;  3L28 A;  4IJE A;  4B08 A;  2B3T A;  4LCB A;  3Q8G A;  5JI3 E;  3L29 A;  2UXD M;  2R44 A;  4MB3 A;  3KXE C;  3GPP A;  1J09 A;  2ZM6 M;  3BBZ A;  2BJV A;  3M0E A;  5EP4 A;  4L78 A;  3DZD A;  4QHS A;  2L7I A;  1GKI A;  4NZ1 A;  3U6D A;  4YY3 M;  3VLF B;  3CTW B;  1DGB A;  3HHY A;  4MGZ E;  4GIP A;  1NY5 A;  3PNY A;  1DV0 A;  1LTM A;  3QWL A;  2P5T A;  3U61 B;  2Y2M A;  3FRI A;  2QEN A;  3L25 A;  1IXR C;  1HQY E;  2Y0T A;  5EP2 A;  2DAK A;  1UR8 A;  3KFU G;  1ZAE A;  2KEB A;  4LJ9 A;  1ZV1 A;  1CK7 A;  1MU5 A;  3E46 A;  3KW6 A;  4LF7 M;  2QP9 X;  4NC6 A;  4DV1 M;  4HMD A;  4LRT A;  4MB4 A;  3A45 A;  1HJP A;  5LMU M;  4RF1 A;  1WHC A;  3VDU A;  4JI1 M;  1C1K A;  3FTD A;  3SAV A;  1SXJ C;  4FCW A;  3SAW A;  2UWX A;  1WGN A;  3WHK A;  5L8R F;  4R3D A;  4WP2 A;  2X8A A;  4I5S A;  4JI6 M;  3BXW A;  2YQZ A;  4G4O A;  3PVS A;  3WX7 A;  1C7Y A;  5ITQ A;  3U6O A;  4Z2G A;  1KFV A;  4GRI A;  5BR8 M;  1OGG A;  5C18 A;  3GRR A;  2J7N A;  3U6C A;  1T3T A;  1IBK M;  4IBC A;  3SYK A;  3QAU A;  2ZBK B;  3HZJ A;  3WHL A;  3D8B A;  3AKZ A;  2E5L M;  3TE6 A;  1IBM M;  2GQF A;  2I7N A;  3C3D A;  1GL7 A;  2DEN A;  4JYA M;  2CEA A;  3TWL A;  5DYG A;  2JUJ A;  3K92 A;  2R65 A;  3HHZ A;  2JNH A;  2RGO A;  1PDC A;  4LF8 M;  4X62 M;  1Z6T A;  2KRU A;  2XEP A;  4DUZ M;  4LGY A;  2MJ5 B;  4QNL A;  2FOI C;  2JY5 A;  4MGK E;  4NRW A;  1OAO C;  4IBF A;  4OVZ A;  5C1B A;  1L2D A;  4RNA A;  2OOB A;  1N32 M;  2K6B A;  1N33 M;  4GHA A;  4GC9 A;  3HU2 A;  5BPV A;  2D49 A;  1QO6 A;  1IN7 A;  4ANR A;  1HNX M;  2A5Y B;  3ZQJ A;  2R62 A;  2XZU A;  2DWZ B;  3SBJ A;  1QUT A;  5A2Q S;  4KO8 A;  3FUU A;  4NYY A;  4M9Z A;  4WUR A;  5EXP A;  1ZMU A;  2F5N A;  2Y2O A;  4IIW A;  2AHM A;  3WD1 A;  2J7O A;  2Z4S A;  4XK8 F;  3U6M A;  1E6P A;  3WD0 A;  1VDD A;  3FYC A;  2RKO A;  4JI2 M;  2QZ4 A;  4OX9 M;  1IN8 A;  3C9P A;  3LQQ A;  1KYI A;  4W5W A;  4D81 A;  1AIW A;  3FYD A;  3KS4 A;  3MQL A;  1RU3 A;  2LTU A;  3IG8 A;  1NHG C;  2LHG A;  2WZJ A;  3IEC A;  4DR7 M;  4QNM A;  3GRU A;  2EA0 A;  4PT5 A;  1IXS B;  3U6E A;  2JXN A;  2DWL A;  1O6I A;  1NHW C;  1ED7 A;  1NSF A;  1JR3 D;  2J5Y A;  3CF6 E;  4LF9 M;  2LBC A;  1Q3C A;  2O01 F;  1QDT A;  2ZAN A;  4OJO A;  3GQ3 A;  1D0K A;  2CUZ A;  4LJA A;  1GL6 A;  3UZU A;  4DV4 M;  2F5Q A;  5ITU A;  1TTE A;  4LJ8 A;  2CHQ A;  3J80 S;  3SHF A;  3U5Z B;  3VK7 A;  2KNZ A;  1IBL M;  2HL7 A;  1XNR M;  4MB5 A;  3R9X B;  2KZS A;  4UN2 B;  3GLF E;  3LQR A;  4QNR A;  4LFC M;  1GJT A;  2D7G A;  3B89 A;  3CF2 A;  3GLH A;  2LVO C;  1IY0 A;  4B7H A;  1OAI A;  2DHR A;  2W82 A;  3LVV A;  4GKK M;  3T38 A;  2DWN A;  3I4V A;  2UXC M;  1GO5 A;  4DR2 M;  2DZL A;  1DGF A;  1ZQ9 A;  4JI4 M;  3KSJ A;  1TGU A;  2APL A;  2QNJ A;  3GLH E;  3JAM S;  3J7A S;  1XMQ M;  3DOA A;  3KOZ E;  1IQP A;  1NV8 A;  3NWL A;  4M0W A;  3ZH9 B;  2QPA A;  4KHP M;  1GVN A;  3M7P A;  1QAQ A;  1L1T A;  1L2B A;  3L2A A;  2FE8 A;  2L4E A;  3KOX E;  4LZZ A;  1QAN A;  2V6Z M;  3FUV A;  4HL4 A;  4NRV A;  4PDG A;  2VQF M;  3H4M A;  2NQ8 C;  4AG5 A;  1DGH A;  1GPF A;  2DVW B;  4NY2 A;  3FUW A;  4IBE A;  1W1P A;  3DFZ A;  2FFF B;  5KPZ A;  2LVP C;  4Z2J A;  1J5E M;  4LF4 M;  4NZ4 A;  3HY5 A;  3Q8X A;  2Y2H A;  4L6V 6;  1NV9 A;  2VDB B;  2V1C A;  1ORY B;  2QQ8 A;  1YU1 A;  1TF0 B;  2FNA A;  5KPR A;  1P3Q Q;  3B74 A;  1XHB A;  1UFZ A;  4IJF A;  4DBG B;  2MH8 A;  4P16 A;  1Z5A A;  4L16 A;  1VG5 A;  2XSZ D;  2YR0 A;  2C5R A;  4HME A;  2HWJ A;  2CWB A;  3E9S A;  1PGY A;  4NL4 H;  2VQE M;  4Z2H A;  3C3E A;  4B3R M;  1YU0 A;  5FTJ A;  2G3Q A;  2K0B X;  1Q3B A;  1QAO A;  1F4I A;  3D8L A;  1PJQ A;  3KS8 A;  2FFJ A;  4NZ3 A;  2HHH M;  1OIP A;  1TDZ A;  2LHC A;  2Y20 A;  1T6O A;  2Y2I A;  4FCV A;  4LJ7 A;  2Y21 A;  1MX0 A;  4XBO A;  4JI8 M;  3I51 A;  2UU9 M;  4IBK A;  3GPX A;  4LFA M;  2VF7 A;  1EIJ A;  4B3S M;  5FLX S;  2JY8 A;  2FH0 A;  5E26 A;  1R2Z A;  1TH4 A;  1N34 M;  2KDL A;  2V1U A;  1IM2 A;  4AZF A;  4F2L A;  3HGI A;  3AOE A;  1H0G A; 
#chains in the Genus database with same CATH homology
 4G6Z A;  4DV7 M;  2KRK A;  2UUB M;  4LFB M;  2Y2N A;  2RGH A;  2UUC M;  4BB9 A;  4OVZ B;  8CAT A;  3J81 S;  3TWK A;  3ZC7 B;  4NSO B;  5ITX E;  2F5S A;  1E32 A;  3FKE A;  4NYU A;  1LV7 A;  3SAS A;  3PFI A;  1G41 A;  4OU7 A;  2KXE A;  3KSX A;  4QHT A;  5ITT A;  4DV0 M;  4G4Q A;  3A42 A;  4AW4 A;  5JI2 E;  4OJP A;  5EXX A;  2CV2 A;  1QAM A;  2UUA M;  2D7E A;  1YU4 A;  4WW0 A;  4D80 A;  1I94 M;  5KQD A;  1G8P A;  1FJG M;  4Z6Y A;  1QYR A;  3EIH A;  3FTC A;  4L4U A;  4MM3 B;  3VK8 A;  2KZU A;  1NJG A;  1NNJ A;  1SXJ E;  2R46 A;  4NXN M;  2KA6 B;  1YU3 A;  3MJ5 A;  1NJF A;  2ZAO A;  3K1J A;  1Z59 A;  1SXJ D;  4FW9 A;  2JA2 A;  2HKJ A;  4LGM A;  4OJ5 A;  2R18 A;  5ITY A;  4GC5 A;  4GIT A;  1IY1 A;  2VII A;  3SC3 A;  3SMS A;  1JR3 A;  5H37 D;  2OPF A;  5EP1 A;  4REZ A;  4EIW A;  3RFW A;  3GLF B;  4II7 A;  4DV5 M;  3T1H M;  1G59 A;  1DO2 A;  3I4Y A;  3THG A;  3SAU A;  4LZJ A;  4BBA A;  1R6B X;  1Z5B A;  4OJ6 A;  1HR0 M;  4L15 A;  3K8Z A;  4LY6 A;  3GLH B;  1H6U A;  3SMP A;  4NZ5 A;  1IY2 A;  2M60 A;  1YSY A;  4AI6 A;  5ITR A;  1N75 A;  3RGS A;  3GLG A;  1IN5 A;  2LXE A;  1OJL A;  4MH0 E;  2Y0Q A;  3GLF A;  4R7G A;  1XC8 A;  3HJS A;  3U60 B;  3HJQ A;  2C99 A;  3HHX A;  2Y2L A;  4Z8X A;  2C9O A;  4BLC A;  1JQJ C;  4IBI A;  1PM5 A;  1DGG A;  3HHW A;  1TDH A;  3FTF A;  2QBY A;  5LMN M;  3MHV C;  4DR5 M;  4OJL A;  4KLN A;  2YNM D;  3ILK A;  3UGJ A;  2VQF M;  5F3W A;  2D7H A;  1HT1 E;  1NNU C;  4M9X A;  1QQW A;  4L8R C;  1DGH B;  4PCZ A;  3HU3 A;  4DR3 M;  2G8L A;  3JR4 A;  5DYI A;  3U60 A;  4CIS A;  3J7B A;  2R4E A;  3FUX A;  1Q39 A;  2L6O A;  3GP1 A;  2UXB M;  1PJJ A;  2X49 A;  1YE9 A;  2Q2E B;  3R8F A;  3JR5 A;  1N78 A;  2G5G X;  2XH9 A;  1WXQ A;  3J2P B;  5IT9 S;  5KPT A;  2Y2P A;  4D82 A;  2Y2G A;  4JI7 M;  2XD1 A;  3B9P A;  2L7H A;  4G4N A;  2HCB A;  3LVW A;  4IBG A;  4QOZ C;  2K47 A;  5FTN A;  2LNH C;  4A3V B;  4LJ5 A;  3VKH A;  3BOS A;  2XSZ A;  4MB7 A;  3OTO M;  4LRS A;  1FNN A;  4DR1 M;  3W0L B;  4MGY E;  2ZAM A;  2Y2K A;  3A98 B;  2Z7J A;  3FTE A;  1L8Q A;  4X64 M;  1YU2 A;  2EO2 A;  5IWA M;  1R7R A;  3AV0 A;  1QVR A;  2OQ4 A;  3U6Q A;  3GPY A;  4DR6 M;  3UJN A;  4M0D A;  3MK6 A;  1XWI A;  4NXM M;  4FVM A;  4GKJ M;  5KO3 A;  1J7K A;  1DO0 A;  4S12 A;  5EJC A;  4PD2 A;  2XLJ A;  3VDP A;  4LF6 M;  2M5Z A;  2LWX A;  1K82 A;  3FD9 A;  3TPZ A;  3LMM A;  4ZPX A;  1HT2 E;  5E6J A;  3AOE C;  4OW0 A;  5ITX A;  5FTL A;  3IG5 A;  4X66 M;  3CF0 A;  1SXJ B;  4G4R A;  3GLI A;  1PJI A;  3NBI A;  4ITQ A;  2X4A A;  2YFQ A;  1G4A E;  1G3I A;  3AOG A;  4RF0 A;  4LF5 M;  4JV5 M;  2XF3 A;  2XFT A;  3T15 A;  2CV0 A;  3HON A;  2LH0 A;  3HWS A;  4I81 A;  4AG6 A;  1HNZ M;  3KP0 E;  4I4L A;  4NOO B;  1OFH A;  5EXS A;  3GO8 A;  4CHT B;  1SXJ A;  2XD5 A;  4FD2 A;  5FTK A;  1XMO M;  4K0K M;  3U61 A;  4FWG A;  3GQ5 A;  3TQS A;  4HLQ A;  4B3T M;  1IN4 A;  3E4R A;  2L09 A;  3PXG A;  3SHG B;  5FSW A;  2F5P A;  4GMQ A;  4JI3 M;  4M9S A;  2XGN A;  4B7G A;  4B7F A;  4I8O A;  4TUW A;  4NSR A;  3KP1 E;  4AKI A;  5FTM A;  1IXZ A;  2DZN B;  5DNY A;  4MGH A;  5KQ8 A;  4KOD A;  3C58 A;  4AKG A;  1EE8 A;  7CAT A;  3FUT A;  4DR4 M;  3GLG B;  1XNQ M;  3TL4 X;  3J27 B;  1Z5C A;  4OUI A;  3KDS E;  3HJ8 A;  4LJ4 A;  5EQT A;  2DZO B;  3W0F A;  1XXH B;  1YUB A;  1W5T A;  3RGP A;  4IBJ A;  1L2C A;  2DWM A;  2QBY B;  4PDI A;  3U6L A;  4X65 M;  2Y2Q A;  2CFO A;  3EIE A;  2Z3X A;  1E9R A;  1TH2 A;  2C9C A;  2CE7 A;  1R2Y A;  1HQC A;  4JI0 M;  3SAR A;  2XZF A;  3RE8 A;  1TH3 A;  5IZ7 D;  3UMM A;  3GPU A;  4AQY M;  1N77 A;  1N36 M;  3A46 A;  2F4V M;  3GRV A;  1KSF X;  4DV3 M;  1XXH A;  2JCH A;  4MGI E;  3HU1 A;  2R45 A;  5IRE B;  4CGY B;  4FWH A;  2CV1 A;  2Z4R A;  4GH9 A;  1GLN A;  1NVM A;  3HKP A;  2CHG A;  3UK6 A;  2Y2J A;  1YUE A;  4IBB A;  2H1R A;  3GRY A;  2BJW A;  3AJI B;  3AFH A;  3SFZ A;  1IN6 A;  4QOS A;  3SYL A;  1K3X A;  3L27 A;  2C98 A;  1W5S A;  3VKG A;  2R4J A;  2KW0 A;  4YHH M;  1D2N A;  3U6P A;  3M6A A;  3TWM A;  3U6S A;  2DXI A;  2O5R A;  4JI5 M;  4JN6 A;  4XGI A;  3T1Y M;  3SAT A;  2I7P A;  5EP3 A;  5EXT A;  1HNW M;  3HGI A;  3HSH A;  4GHL A;  1UM8 A;  1I4W A;  3PNV A;  3DA1 A;  4DUY M;  3U5Z A;  3N3F A;  4AKH A;  3L26 A;  5GKN A;  3KVW A;  4DV2 M;  2F5O A;  2CHV A;  4JXJ A;  2QCU A;  3M7G A;  4DV6 M;  3GQ4 A;  1E94 E;  1L1Z A;  2EUC A;  3AL0 C;  3ZCB B;  2IOU A;  2ERC A;  1OFI A;  1K3W A;  2C96 A;  2XFS A;  4LJ6 A;  2BG1 A;  1X37 A;  4FCT A;  2JE5 A;  1S3S A;  4FWD A;  4B3M M;  1QZM A;  4IBD A;  1E9S A;  4LG2 A;  3KOY E;  3GLI B;  3VFD A;  1NY6 A;  3KOW E;  2BNK A;  3L28 A;  4IJE A;  4B08 A;  5JI3 E;  4LCB A;  3L29 A;  2UXD M;  3KXE C;  3GPP A;  1J09 A;  2ZM6 M;  2BJV A;  3M0E A;  5EP4 A;  4L78 A;  3DZD A;  4QHS A;  2L7I A;  1GKI A;  4NZ1 A;  3U6D A;  4YY3 M;  3VLF B;  3CTW B;  1DGB A;  3HHY A;  4MGZ E;  4GIP A;  1NY5 A;  3PNY A;  3QWL A;  2P5T A;  3U61 B;  2Y2M A;  2QEN A;  3L25 A;  1IXR C;  1HQY E;  2Y0T A;  5EP2 A;  3KFU G;  1ZAE A;  2KEB A;  4LJ9 A;  1MU5 A;  3KW6 A;  4LF7 M;  2QP9 X;  4DV1 M;  4LRT A;  3A45 A;  5LMU M;  4RF1 A;  3VDU A;  4JI1 M;  1C1K A;  3FTD A;  3SAV A;  1SXJ C;  4FCW A;  3SAW A;  2UWX A;  3WHK A;  4R3D A;  2X8A A;  4I5S A;  4JI6 M;  2YQZ A;  4G4O A;  3PVS A;  3WX7 A;  5ITQ A;  3U6O A;  1KFV A;  4GRI A;  5BR8 M;  5C18 A;  3GRR A;  2J7N A;  3U6C A;  1T3T A;  1IBK M;  4IBC A;  3SYK A;  3QAU A;  2ZBK B;  2E5L M;  3WHL A;  3D8B A;  3AKZ A;  3TE6 A;  1IBM M;  2I7N A;  1GL7 A;  4JYA M;  2CEA A;  3TWL A;  5DYG A;  3K92 A;  2R65 A;  3HHZ A;  2RGO A;  4LF8 M;  4X62 M;  1Z6T A;  2KRU A;  2XEP A;  4DUZ M;  4LGY A;  4QNL A;  2FOI C;  4MGK E;  4NRW A;  5C1B A;  4IBF A;  4OVZ A;  1L2D A;  4RNA A;  1N32 M;  1N33 M;  4GHA A;  4GC9 A;  3HU2 A;  5BPV A;  1IN7 A;  1HNX M;  2A5Y B;  2R62 A;  2XZU A;  2DWZ B;  3SBJ A;  5A2Q S;  4KO8 A;  3FUU A;  4NYY A;  4M9Z A;  4WUR A;  5EXP A;  2F5N A;  2Y2O A;  4IIW A;  2AHM A;  2J7O A;  2Z4S A;  3U6M A;  1VDD A;  3FYC A;  2RKO A;  4JI2 M;  2QZ4 A;  4OX9 M;  1IN8 A;  3LQQ A;  4W5W A;  1KYI A;  4D81 A;  3FYD A;  3KS4 A;  3IG8 A;  1NHG C;  4DR7 M;  4QNM A;  3GRU A;  2EA0 A;  4PT5 A;  1IXS B;  3U6E A;  2DWL A;  1NHW C;  1NSF A;  1JR3 D;  3CF6 E;  4LF9 M;  1Q3C A;  2ZAN A;  4OJO A;  3GQ3 A;  2CUZ A;  4LJA A;  1GL6 A;  3UZU A;  4DV4 M;  2F5Q A;  5ITU A;  4LJ8 A;  3SHF A;  2CHQ A;  3J80 S;  3U5Z B;  3VK7 A;  1IBL M;  2HL7 A;  1XNR M;  3R9X B;  2KZS A;  3LQR A;  4QNR A;  4LFC M;  2D7G A;  3CF2 A;  3GLH A;  1IY0 A;  4B7H A;  2DHR A;  2W82 A;  3LVV A;  4GKK M;  3T38 A;  2DWN A;  3I4V A;  2UXC M;  4DR2 M;  1DGF A;  1ZQ9 A;  4JI4 M;  3KSJ A;  1TGU A;  3JAM S;  3J7A S;  1XMQ M;  3DOA A;  3KOZ E;  1IQP A;  3NWL A;  4M0W A;  3ZH9 B;  2QPA A;  4KHP M;  1GVN A;  1QAQ A;  1L1T A;  1L2B A;  3L2A A;  2FE8 A;  3KOX E;  4LZZ A;  1QAN A;  2V6Z M;  3FUV A;  4HL4 A;  4NRV A;  4PDG A;  3H4M A;  2NQ8 C;  4AG5 A;  1DGH A;  2DVW B;  4NY2 A;  3FUW A;  4IBE A;  3DFZ A;  2FFF B;  5KPZ A;  1J5E M;  4LF4 M;  4NZ4 A;  3Q8X A;  2Y2H A;  2V1C A;  1ORY B;  1YU1 A;  2FNA A;  5KPR A;  1XHB A;  4IJF A;  4P16 A;  1Z5A A;  4L16 A;  2XSZ D;  2YR0 A;  2C5R A;  3E9S A;  4NL4 H;  2VQE M;  4B3R M;  1YU0 A;  5FTJ A;  1Q3B A;  1QAO A;  3D8L A;  3KS8 A;  2FFJ A;  4NZ3 A;  2HHH M;  1TDZ A;  2Y20 A;  2Y2I A;  4FCV A;  4LJ7 A;  2Y21 A;  1MX0 A;  4XBO A;  4JI8 M;  3I51 A;  2UU9 M;  4IBK A;  3GPX A;  4LFA M;  4B3S M;  5FLX S;  5E26 A;  1R2Z A;  1TH4 A;  1N34 M;  2V1U A;  1IM2 A;  4AZF A;  3K2L A;  3AOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...