4IBDA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibdA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibdA02
4IJFA 4IJEA 3KS8A 4IBFA 3KS4A 3L25A 4IBBA 4GHLA 4GH9A 3FKEA 5BPVA 3L26A 4IBKA 4IBDA 4IBIA 4LG2A 3L27A 4GHAA 3L28A 4IBGA 3L29A 4IBJA 4IBCA 3L2AA 4IBEA
chains in the Genus database with same CATH superfamily
2UWXA 3MMPA 2G5GX 4GIPA 3FUUA 3VDUA 4OJOA 3GRVA 3KOWE 2LBCA 2XLJA 2BWEA 1YU4A 4R7GA 3E46A 4TX8A 2DENA 3GLIA 3FTCA 3GRUA 4MH0E 2HAKA 3HKPA 2Y2JA 3ILKA 4AI6A 5FTMA 5C18A 1PRBA 4LJ9A 3KOXE 2CHGA 4HL4A 1DGGA 4IBIA 2FS1A 2UXBM 2JCHA 1C1KA 4GC5A 1WR1B 3QYEA 5EP4A 1D0MA 2Q2EB 3VDPA 1EFUB 3HGIA 5FSWA 3T6PA 4OUIA 5FTNA 4LCBA 2KNZA 4HMCA 3WD3A 1L8QA 1IN5A 2WSEF 2XGNA 1ZMVA 5EP1A 2FFFB 2W82A 2F4VM 2I7NA 1OFHA 3KSJA 2IOUA 2CEAA 1IY2A 3B89A 4JI3M 1GL7A 4MGYE 3KOYE 3CF0A 3J2PB 4RKUF 4LF4M 5DFLA 5A2QS 2JZ0A 1HT2E 3U60B 3SMPA 1DO0A 2GQFA 2KNAA 2QBYA 3Q8GA 1N75A 4HEOA 4NC6A 3VFDA 3SAVA 1IBMM 3KFUG 3HU3A 5E26A 1E15A 2D7GA 1FJGM 4NYYA 1SXJE 2KNVA 4GHLA 3K9OA 3AFHA 3LVWA 4IBKA 4QHTA 3JR4A 1R2ZA 1W1PA 3DA1A 3J7BA 3WD1A 1ORYB 4R3DA 2KXEA 3FUXA 4M9SA 1E8BA 4HMDA 1YU3A 1R4GA 4DR6M 1YU1A 2CHVA 4B7HA 1OFIA 3PVSA 4IBCA 4LY6A 1W5SA 1N34M 1ZV1A 2WSCF 4LRSA 1G59A 2QHOB 1E9RA 1NNUC 2XF3A 5BR8M 4AW4A 2ZM6M 1JR3E 3KDSE 2O5RA 2R4JA 3ZC7B 4DUYM 3R8FA 4KLNA 1YLAA 3PNYA 8CATA 1HNWM 3A42A 5ITXA 4WW0A 2MJ5B 1H0GA 3U6CA 2UU9M 3AOEA 1GL6A 4NZ3A 3UGJA 3ZH9B 3HSHA 1DV0A 2ZANA 3KP0E 2DKLA 1GO5A 2Y2HA 2Y2OA 2YNMD 3SAWA 1N36M 2JE5A 2J5YA 2OOAA 2QZ4A 2CWBA 1ZQ9A 2OOBA 3BOSA 1X37A 2BWBA 2Y2NA 1IXZA 2DZNB 4B7GA 3LQRA 5LMNM 1NV9A 1Y8GA 5DYGA 3WHKA 4BB9A 1IBLM 3VKGA 5ITYA 1P3QQ 3RGPA 2EUCA 2YFQA 4FWHA 4IJFA 4X66M 2KEBA 2LHCA 4BLCA 1MX0A 3JAMS 4G4OA 5EJCA 1PJJA 4JI1M 5FTLA 1HT1E 2DXIA 2EJSA 3HJSA 2F5SA 2DAGA 4GEWA 3L25A 4TUWA 1OIPA 2L6OA 4FCWA 1K3XA 1W1VA 2A5YB 4LJAA 1XMQM 4AKHA 4L6V6 1IXRC 3J81S 3B7ZA 2Y2IA 2JA2A 5BPVA 1GVNA 3MHVC 3QWLA 3J27B 2DAMA 2DWZB 2XSZA 1XC8A 2Z8YM 4G4RA 3M7GA 3N3FA 2KZUA 3B74A 2N35A 3HJ8A 2KW0A 2LXEA 2RKOA 3LQQA 5IWAM 1PJIA 1Q3BA 1T43A 3HU2A 4Z2HA 3GPPA 4MB7A 4DV5M 2XD5A 3NBXX 4DUZM 3GLFE 3U6OA 5KQ8A 4JN6A 2V1CA 4IBFA 1OKSA 2K6BA 2XH9A 1YU2A 4DR7M 3HONA 2LH0A 2V1UA 2DWNA 2HKJA 3D8LA 3LMMA 5KPTA 4KO8A 3OTOM 4CISA 2Z4RA 2YQZA 2K9DA 1SXJB 4JI5M 3FKEA 2CP8A 4JI7M 5IREB 3AKZA 1TDHA 3FD9A 2DWLA 2ZBKB 5E6JA 1G4AE 3AOGA 3L27A 1UR8A 4LJ4A 2Y2QA 2RGOA 1IXSB 4MM3B 5KQDA 1PJTA 1T6OA 2QPAA 2FOIC 2O25A 4RF1A 4B3MM 2DAIA 4NZ1A 2XEPA 4DBGB 2DWMA 1XWIA 2BNKA 2KA6B 4OVZA 3C3EA 1H8PA 2LTUA 4IJEA 4NRVA 2F5OA 2M5ZA 2UUCM 3GLHA 1OAOC 2JNHA 1GKIA 4NXMM 4MGIE 2O01F 2JXNA 1YU0A 3GO8A 4JXJA 2Y21A 4NL4H 4OJ6A 1VDLA 5H37D 3DOAA 2F5NA 2DHRA 5ITQA 3C58A 4LF5M 1DGHA 3HHXA 2LNHC 3GPXA 3A98B 2F5PA 4DR5M 1NVMA 1QDRA 3W0LB 3JR5A 4AQYM 2FH0A 2Y0QA 3GLGE 5EXTA 3FRIA 3PFIA 5GKNA 5IT9S 7CATA 1XHBA 1AIPC 3SYKA 1NSFA 1IM2A 3MJ5A 4CIZA 4LZZA 3E9SA 3A46A 1IN7A 5KPRA 1HQCA 1Z6TA 4JI2M 4PDIA 4Q7JA 1R2YA 5IZ7D 4B7FA 3AOEC 1L1TA 1XB2B 1XXHE 2C98A 2AHMA 1QAOA 4G6ZA 4PDGA 3I51A 3I4VA 4QNRA 1EAKA 2ZTDA 1E6PA 2FN2A 1HJPA 3FE3A 1PDCA 1PM5A 4B3TM 3SFZA 1D0LA 3F92A 4LF6M 4M0WA 2NQ8C 2ZAMA 2Z4SA 3DFZA 2BJVA 2QSFX 1KYIA 1GPFA 1BVSA 4AG6A 3B7NA 2Y2KA 1PJSA 2QENA 1J5EM 1LV7A 4Z2IA 3U60A 1HNXM 1A5TA 4QOZC 4FW9A 1WXQA 4KODA 5C1BA 3U6EA 2ERCA 2MGWA 3LCUA 2L2DA 1VEGA 2X49A 3K8ZA 3GLFB 3ZQJA 4LF8M 1HQYE 2EA0A 5ITUA 4HMEA 4XK8F 4A3VB 3W0FA 3SBJA 1V33A 1N33M 1E94E 4DR1M 3UMMA 4KT0F 3CF2A 4AZFA 1WGNA 4R71A 3GLIE 3FUWA 2RTSA 3H4JA 5FTJA 2DZOB 2L09A 1WIVA 2JWSA 2D49A 4LRTA 2VIIA 1J7KA 4AKIA 2GNOA 2VQEM 1AIWA 4QNMA 1L6JA 5EXPA 4P17A 2F5QA 4AG5A 4OJ5A 1PJQA 2L4FA 3CF6E 2LVPC 3LCVB 1K82A 4ZPXA 2LVAA 2OQ4A 1QUSA 2P5TA 3FRHA 4FCVA 2CV1A 4HLQA 2JY8A 1G3IA 1QAQA 4LF9M 3SHGB 2UXCM 2Y2LA 3K9PA 3HX3A 1IY0A 3KVWA 1ZAEA 3IHPA 1G8PA 4IBBA 3NWLA 2R65A 1G41A 3D8BA 4L16A 3SYLA 2XZUA 2KRUA 1R5LA 4G4NA 1XMOM 1ED7A 3FTEA 1I94M 1KFVA 4P16A 4OU7A 4GKKM 2QCUA 3AJIB 1TF0B 3TWMA 4XGIA 4I4LA 4DR4M 4CJ6A 4LF7M 2K0BX 1QZEA 3L28A 4FWDA 1NNJA 3GLGB 2HCBA 1Z5BA 1OAIA 1D0KA 1F4IA 3M7PA 2EKFA 4DR3M 4JI0M 4XBOA 3I4YA 1QYRA 2DHYA 1JB0F 2HWJA 3UJNA 4GC9A 1WJ7A 4L4UA 5LMUM 5ITRA 2B3TA 3EIHA 3U6MA 3U5ZB 4GMQA 3HHYA 3FTDA 4MB5A 3SMSA 1QDTA 4Z2KA 1IN6A 4WURA 1XXHB 1OGBA 1T3TA 3PNVA 4JI8M 1HNZM 1QVRA 2XD1A 4OJPA 2V5OA 1UM8A 4B3SM 1QZMA 2FE8A 2L4EA 4II7A 4DV1M 4QOSA 1TDZA 4REZA 5ITXE 5JI3E 5EP3A 1VG5A 4GRIA 5L8RF 4L8RC 4NY2A 1IN4A 1Z59A 2CV2A 4Y28F 2DVWB 4GHAA 3GRYA 3E21A 1IQPA 1G71A 3K2LA 1XNQM 1TH3A 3U61B 3HWSA 3T38A 2CV0A 3L2AA 2L7HA 2MROB 4RNAA 1IBKM 3KXEC 3B9PA 3T1YM 3J7AS 1J7MA 1NY5A 1K3WA 2LHGA 4NSRA 3C3DA 2LWXA 1NJGA 3KS4A 4LGMA 3KOZE 3K1JA 4LJ8A 1NY6A 1R6BX 2R4EA 2XSZD 3UK6A 4FD2A 1SXJA 2DZLA 3WHLA 3RGSA 3T1HM 1C7YA 4G3OA 1IY1A 1TR8A 3GRRA 4D80A 3GPYA 3WX7A 4G4QA 1E6RA 1FNNA 1IXSA 3L26A 3GLIB 1GABA 2C96A 1WHCA 3ZCBB 4MGKE 4FVMA 4MGZE 4NOOB 3SHFA 1SG9A 2JY5A 3E4RA 3TE6A 3SC3A 2DAKA 2APLA 2WSFF 1GOIA 2DAEA 1NV8A 1OJLA 4OX9M 4GITA 3UZUA 1Q39A 4X65M 5KO3A 1VEJA 2ZTCA 1JR3A 3J80S 4OW0A 2J7NA 1W5TA 1NJFA 1QAMA 2DI0A 1JQJC 2ZAOA 3VLFB 1GXDA 2D7EA 1DGBA 2FFJA 3FUTA 3HHWA 5F3WA 4Z2JA 3WD0A 2M60A 1QO6A 4GKJM 4EIWA 2JZ1A 2BG1A 1OIZA 1EIJA 1QANA 4YY3M 3SAUA 2QBYB 3SARA 3VK7A 2UUAM 5FTKA 3CTWB 4IBDA 4LJ7A 2EKKA 4MGHA 3R9XB 3KSXA 1E9SA 4M9XA 2H1RA 1N78A 4PD2A 2MH8A 2OPFA 3KP1E 1NO1A 2Y2GA 2C9CA 4IBGA 3L29A 4NRWA 3CGWA 1SXJD 4JI6M 2OO9A 1Z5AA 2MR9A 3FUVA 3B7QA 1H0IA 1HR0M 4AKGA 1Q02A 3BXWA 1PGYA 2QQ8A 2R0IA 1O6IA 1GJTA 4I5SA 1ZMUA 2G8LA 3U6DA 3IG8A 4OJLA 4F1IA 1MU5A 1TH4A 1YUBA 2JY7A 2Z7JA 4LJ5A 5EQTA 2CUZA 3GLHE 5JI2E 4DV2M 2UUBM 1V34A 1GJSA 4UN2B 1KSFX 4I81A 4MB3A 1XNRM 3HU1A 3AV0A 1KS0A 4Z2GA 4GH9A 3TL4X 1NHGC 3HZJA 2Y20A 3IECA 1TTEA 1D2NA 1JR3D 3U6QA 1VQ1A 1GLNA 1RU3A 3QAUA 4NSOB 3M6AA 4DV3M 4MB4A 4DV6M 2KZSA 1QUTA 2RRUA 1WGLA 3GP1A 2XFSA 2C99A 1CK7A 3GQ4A 1N77A 3M0EA 3NBIA 4IIWA 3GLFA 1L1ZA 2C9OA 2R6FA 4YHHM 1CUKA 4L15A 5ITTA 2H5XA 2J7OA 3VK8A 4BBAA 3C9PA 1QQWA 1TGUA 1LTMA 3W68A 4NYUA 3RE8A 4L78A 3DZDA 4X64M 2CHQA 4FWGA 3SATA 4ANRA 2R46A 3K92A 4M0DA 4K0KM 3W67A 1W1YA 3I04M 2HHHM 3SASA 2X8AA 2VDBB 2EO2A 4LG2A 3Q8XA 4QHSA 1OQYA 1V92A 1E6ZA 1EE8A 3THGA 4NZ5A 1DGFA 1OTRA 4PT5A 1L2BA 1YUEA 4D81A 1VDDA 3TWLA 4Z6YA 3WD2A 4W5WA 3IG5A 4LFAM 2VQFM 1H6UA 2CFOA 5FLXS 3AL0C 3GQ5A 1E32A 2Y0TA 2LVOC 1N32M 2UXDM 3T15A 1SXJC 2KRKA 4WP2A 2QP9X 3V76A 2VF7A 3QYBA 4QNLA 2FNAA 4S12A 2R44A 3KS8A 3U6PA 4Z8XA 5EXSA 1E6NA 1W1TA 2Y2MA 1E88A 3GPUA 2XFTA 2CRUA 3RFWA 4CGYB 2L7IA 3TWKA 2LVQD 5EP2A 4PCZA 2Y2PA 3GQ3A 3PXGA 2R18A 1AUAA 1I4WA 3LW5F 1CXWA 1Q3CA 3U6LA 2HL7A 2CE7A 2RGHA 2XZFA 5KPZA 2WZJA 2E5LM 4LZJA 1DO2A 2K47A 2X4AA 3I01M 3FYCA 1YSYA 2G3QA 3KW6A 3GLGA 3FTFA 1Z5CA 4CHTB 4JI4M 4LFBM 3VKHA 2JY6B 1UR9A 4D82A 4RF0A 2D7HA 4JYAM 5DNYA 4Z2LA 1IFYA 3FYDA 3TQSA 1YE9A 2LVNC 1TH2A 1VEKA 2YR0A 3MK6A 4F2LA 3U6SA 1J09A 3U5ZA 4FCTA 1IN8A 4KHPM 4LGYA 1MJGM 2JUJA 4IBEA 1MN3A 1NHWC 1XXHA 1S3SA 4NXNM 4ITQA 3LVVA 4DV0M 2BJWA 4I8OA 4JV5M 3A45A 3HJQA 4OVZB 4DV4M 4NZ4A 2JP7A 4M9ZA 2I7PA 3HHZA 2R62A 4DV7M 1L2DA 3GLHB 2C5RA 3WD4A 4DR2M 3EIEA 2Z3XA 4B08A 1ZMWA 1UFZA 2DNAA 2V6ZM 4LJ6A 4X62M 1OGGA 2KDLA 3U61A 3MQLA 1L2CA 1DGHB 1R7RA 4LFCM 2VF8A 2KHHA 4IBJA 3TPZA 3BBZA 3HY5A 4B3RM 3H4MA 2R45A 5DYIA 5EXXA 2QNJA
chains in the Genus database with same CATH topology
2UWXA 4GIPA 2G5GX 3VDUA 3FUUA 4OJOA 3GRVA 3KOWE 2XLJA 1YU4A 4R7GA 3GLIA 3FTCA 3GRUA 4MH0E 3HKPA 2Y2JA 3ILKA 4AI6A 5FTMA 5C18A 4LJ9A 3KOXE 2CHGA 4HL4A 1DGGA 4IBIA 2UXBM 2JCHA 1C1KA 4GC5A 5EP4A 5FSWA 4OU7A 2Q2EB 3VDPA 4OUIA 3HGIA 5FTNA 4LCBA 1L8QA 1IN5A 2XGNA 5EP1A 2FFFB 2W82A 2F4VM 2I7NA 1OFHA 3KSJA 2IOUA 2CEAA 1IY2A 4JI3M 1GL7A 4MGYE 3KOYE 3CF0A 3J2PB 4LF4M 5A2QS 1HT2E 3U60B 3SMPA 1DO0A 2QBYA 1N75A 3VFDA 3SAVA 1IBMM 3KFUG 3HU3A 5E26A 4NYYA 2D7GA 1FJGM 1SXJE 4GHLA 3AFHA 3LVWA 4IBKA 4QHTA 3JR4A 1R2ZA 3DA1A 3J7BA 1ORYB 4R3DA 2KXEA 3FUXA 4M9SA 1YU3A 4DR6M 1YU1A 2CHVA 4B7HA 1OFIA 3PVSA 4IBCA 4LY6A 1W5SA 1N34M 4LRSA 1G59A 1E9RA 1NNUC 2XF3A 5BR8M 4AW4A 2ZM6M 3KDSE 4DUYM 2O5RA 2R4JA 3ZC7B 3R8FA 4KLNA 3PNYA 8CATA 1HNWM 3A42A 5ITXA 4WW0A 3U6CA 2UU9M 3AOEA 1GL6A 4NZ3A 3UGJA 3ZH9B 3HSHA 2ZANA 3KP0E 2Y2HA 2Y2OA 2YNMD 3SAWA 1N36M 2JE5A 2QZ4A 1ZQ9A 3BOSA 1X37A 2Y2NA 1IXZA 2DZNB 4B7GA 3LQRA 5LMNM 5DYGA 3WHKA 1IBLM 4BB9A 3VKGA 5ITYA 3RGPA 2EUCA 2YFQA 4FWHA 4IJFA 4X66M 2KEBA 4BLCA 3JAMS 1MX0A 4G4OA 1PJJA 5EJCA 4JI1M 5FTLA 1HT1E 2DXIA 4TUWA 3HJSA 2F5SA 3L25A 1K3XA 2L6OA 4FCWA 2A5YB 4LJAA 1XMQM 4AKHA 1IXRC 3J81S 2Y2IA 2JA2A 5BPVA 1GVNA 3MHVC 3QWLA 3J27B 2DWZB 2XSZA 1XC8A 4G4RA 3M7GA 3N3FA 2KZUA 3HJ8A 2KW0A 2LXEA 2RKOA 3LQQA 5IWAM 1PJIA 1Q3BA 3HU2A 3GPPA 4MB7A 4DV5M 2XD5A 4DUZM 3U6OA 5KQ8A 4JN6A 2V1CA 4IBFA 3HONA 2XH9A 1YU2A 4DR7M 2LH0A 2V1UA 2DWNA 2HKJA 3D8LA 3LMMA 5KPTA 4KO8A 3OTOM 4CISA 2Z4RA 2YQZA 1SXJB 4JI5M 3FKEA 4JI7M 5IREB 3AKZA 1TDHA 3FD9A 2DWLA 2ZBKB 5E6JA 1G4AE 3AOGA 3L27A 2Y2QA 4LJ4A 2RGOA 1IXSB 4MM3B 5KQDA 2QPAA 2FOIC 4B3MM 4RF1A 4NZ1A 2XEPA 2DWMA 1XWIA 2BNKA 2KA6B 4OVZA 4IJEA 4NRVA 2F5OA 2M5ZA 2UUCM 3GLHA 1GKIA 4NXMM 4MGIE 1YU0A 3GO8A 4JXJA 2Y21A 4NL4H 4OJ6A 5H37D 3DOAA 2F5NA 2DHRA 5ITQA 3C58A 4LF5M 1DGHA 3HHXA 2LNHC 3GPXA 3A98B 2F5PA 4DR5M 1NVMA 3W0LB 3JR5A 4AQYM 2Y0QA 5EXTA 3PFIA 5GKNA 5IT9S 7CATA 1XHBA 3SYKA 1NSFA 1IM2A 3MJ5A 4LZZA 3E9SA 3A46A 1IN7A 5KPRA 1HQCA 1Z6TA 4JI2M 4PDIA 1R2YA 5IZ7D 4B7FA 3AOEC 1L1TA 2C98A 2AHMA 1QAOA 4G6ZA 4PDGA 3I51A 3I4VA 4QNRA 1PM5A 4B3TM 3SFZA 4LF6M 4M0WA 2NQ8C 2ZAMA 2Z4SA 3DFZA 2BJVA 1KYIA 4AG6A 2Y2KA 1J5EM 2QENA 1LV7A 3U60A 1HNXM 4QOZC 4FW9A 1WXQA 4KODA 5C1BA 3U6EA 2ERCA 4LF8M 2X49A 3K8ZA 3GLFB 1HQYE 2EA0A 5ITUA 4A3VB 3W0FA 3SBJA 1N33M 1E94E 4DR1M 3UMMA 3CF2A 4AZFA 3FUWA 5FTJA 2DZOB 2L09A 4LRTA 2VIIA 1J7KA 4AKIA 2VQEM 4QNMA 5EXPA 2F5QA 4AG5A 4OJ5A 3CF6E 1K82A 4ZPXA 2OQ4A 2P5TA 4FCVA 2CV1A 4HLQA 1G3IA 1QAQA 4LF9M 3SHGB 2UXCM 2Y2LA 1IY0A 3KVWA 1ZAEA 4IBBA 1G8PA 3NWLA 2R65A 1G41A 3D8BA 4L16A 3SYLA 2XZUA 2KRUA 4G4NA 1XMOM 3FTEA 1I94M 1KFVA 4P16A 4GKKM 2QCUA 3AJIB 3TWMA 4XGIA 4I4LA 4DR4M 4LF7M 3L28A 4FWDA 1NNJA 3GLGB 2HCBA 1Z5BA 4DR3M 4JI0M 4XBOA 3I4YA 1QYRA 3UJNA 4GC9A 4L4UA 5LMUM 5ITRA 3EIHA 3U6MA 3U5ZB 4GMQA 3HHYA 3FTDA 3SMSA 1IN6A 4WURA 1XXHB 1T3TA 3PNVA 4JI8M 1HNZM 1QVRA 2XD1A 4OJPA 1UM8A 4B3SM 1QZMA 2FE8A 4II7A 4DV1M 4QOSA 1TDZA 4REZA 5ITXE 5JI3E 5EP3A 4GRIA 4L8RC 4NY2A 1IN4A 1Z59A 2CV2A 2DVWB 4GHAA 3GRYA 1IQPA 3K2LA 1XNQM 1TH3A 3U61B 3HWSA 3T38A 2CV0A 3L2AA 2L7HA 4RNAA 1IBKM 3KXEC 3B9PA 3T1YM 3J7AS 1NY5A 1K3WA 4NSRA 3KS4A 1NJGA 2LWXA 4LGMA 4LJ8A 3KOZE 3K1JA 1NY6A 1R6BX 2R4EA 2XSZD 3UK6A 4FD2A 1SXJA 3WHLA 3RGSA 3T1HM 1IY1A 3GRRA 4D80A 3GPYA 3WX7A 4G4QA 1FNNA 3L26A 3GLIB 2C96A 3ZCBB 4MGKE 4FVMA 4MGZE 4NOOB 3SHFA 3E4RA 3TE6A 3SC3A 4OX9M 1OJLA 4GITA 3UZUA 1Q39A 4X65M 5KO3A 1JR3A 3J80S 4OW0A 2J7NA 1W5TA 1NJFA 1QAMA 2ZAOA 1JQJC 3VLFB 2D7EA 1DGBA 2FFJA 3FUTA 3HHWA 5F3WA 2M60A 4GKJM 4EIWA 2BG1A 1QANA 4YY3M 3SAUA 2QBYB 3SARA 3VK7A 2UUAM 5FTKA 3CTWB 4IBDA 4LJ7A 4MGHA 3R9XB 3KSXA 1E9SA 4M9XA 2H1RA 1N78A 4PD2A 2OPFA 3KP1E 2Y2GA 2C9CA 4IBGA 3L29A 4NRWA 1SXJD 4JI6M 1Z5AA 3FUVA 1HR0M 4AKGA 4I5SA 2G8LA 3U6DA 3IG8A 4OJLA 1MU5A 1TH4A 1YUBA 2Z7JA 5EQTA 4LJ5A 5JI2E 2CUZA 4DV2M 2UUBM 1KSFX 4I81A 1XNRM 3HU1A 3AV0A 4GH9A 3TL4X 1NHGC 2Y20A 3U6QA 1D2NA 1JR3D 1GLNA 3QAUA 4NSOB 3M6AA 4DV3M 4DV6M 2KZSA 3GP1A 2XFSA 2C99A 3GQ4A 1N77A 3M0EA 3NBIA 4IIWA 3GLFA 1L1ZA 2C9OA 4YHHM 4L15A 5ITTA 2J7OA 3VK8A 4BBAA 1QQWA 1TGUA 4NYUA 3RE8A 4L78A 3DZDA 4X64M 2CHQA 4FWGA 3SATA 4K0KM 2R46A 3K92A 4M0DA 2HHHM 3SASA 2X8AA 2EO2A 4LG2A 3Q8XA 4QHSA 1EE8A 3THGA 4NZ5A 1DGFA 1L2BA 4PT5A 1YUEA 4D81A 1VDDA 3TWLA 4Z6YA 4W5WA 3IG5A 4LFAM 2VQFM 1H6UA 2CFOA 5FLXS 3AL0C 3GQ5A 1E32A 2Y0TA 2UXDM 1N32M 3T15A 1SXJC 2KRKA 2QP9X 4QNLA 2FNAA 4S12A 3KS8A 3U6PA 4Z8XA 5EXSA 2Y2MA 3GPUA 2XFTA 3RFWA 4CGYB 2Y2PA 2L7IA 3TWKA 4PCZA 5EP2A 3GQ3A 3PXGA 2R18A 1I4WA 1Q3CA 3U6LA 2HL7A 2CE7A 2RGHA 2XZFA 5KPZA 2E5LM 4LZJA 1DO2A 2K47A 2X4AA 3FYCA 1YSYA 3KW6A 3GLGA 3FTFA 1Z5CA 4CHTB 4JI4M 4LFBM 3VKHA 4D82A 4RF0A 2D7HA 4JYAM 5DNYA 3FYDA 3TQSA 1YE9A 1TH2A 2YR0A 3MK6A 3U6SA 1J09A 3U5ZA 4FCTA 1IN8A 4KHPM 4LGYA 4IBEA 1NHWC 1XXHA 1S3SA 4NXNM 4ITQA 3LVVA 4DV0M 2BJWA 4I8OA 4JV5M 3A45A 3HJQA 4OVZB 4DV4M 4NZ4A 4M9ZA 2I7PA 3HHZA 2R62A 4DV7M 1L2DA 3GLHB 2C5RA 4DR2M 3EIEA 2Z3XA 4B08A 4LJ6A 2V6ZM 4X62M 3U61A 1L2CA 1DGHB 1R7RA 4LFCM 4IBJA 3TPZA 4B3RM 3H4MA 2R45A 5DYIA 5EXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  4IJE A;  3KS8 A;  4IBF A;  3KS4 A;  3L25 A;  4IBB A;  4GHL A;  4GH9 A;  3FKE A;  5BPV A;  3L26 A;  4IBK A;  4IBD A;  4IBI A;  4LG2 A;  3L27 A;  4GHA A;  3L28 A;  4IBG A;  3L29 A;  4IBJ A;  4IBC A;  3L2A A;  4IBE A; 
#chains in the Genus database with same CATH topology
 2UWX A;  3MMP A;  2G5G X;  4GIP A;  3FUU A;  3VDU A;  4OJO A;  3GRV A;  3KOW E;  2LBC A;  2XLJ A;  2BWE A;  1YU4 A;  4R7G A;  3E46 A;  4TX8 A;  2DEN A;  3GLI A;  3FTC A;  3GRU A;  4MH0 E;  2HAK A;  3HKP A;  2Y2J A;  3ILK A;  4AI6 A;  5FTM A;  5C18 A;  1PRB A;  4LJ9 A;  3KOX E;  2CHG A;  4HL4 A;  1DGG A;  4IBI A;  2FS1 A;  2UXB M;  2JCH A;  1C1K A;  4GC5 A;  1WR1 B;  3QYE A;  5EP4 A;  1D0M A;  2Q2E B;  3VDP A;  1EFU B;  3HGI A;  5FSW A;  3T6P A;  4OUI A;  5FTN A;  4LCB A;  2KNZ A;  4HMC A;  3WD3 A;  1L8Q A;  1IN5 A;  2WSE F;  2XGN A;  1ZMV A;  5EP1 A;  2FFF B;  2W82 A;  2F4V M;  2I7N A;  1OFH A;  3KSJ A;  2IOU A;  2CEA A;  1IY2 A;  3B89 A;  4JI3 M;  1GL7 A;  4MGY E;  3KOY E;  3CF0 A;  3J2P B;  4RKU F;  4LF4 M;  5DFL A;  5A2Q S;  2JZ0 A;  1HT2 E;  3U60 B;  3SMP A;  1DO0 A;  2GQF A;  2KNA A;  2QBY A;  3Q8G A;  1N75 A;  4HEO A;  4NC6 A;  3VFD A;  3SAV A;  1IBM M;  3KFU G;  3HU3 A;  5E26 A;  1E15 A;  2D7G A;  1FJG M;  4NYY A;  1SXJ E;  2KNV A;  4GHL A;  3K9O A;  3AFH A;  3LVW A;  4IBK A;  4QHT A;  3JR4 A;  1R2Z A;  1W1P A;  3DA1 A;  3J7B A;  3WD1 A;  1ORY B;  4R3D A;  2KXE A;  3FUX A;  4M9S A;  1E8B A;  4HMD A;  1YU3 A;  1R4G A;  4DR6 M;  1YU1 A;  2CHV A;  4B7H A;  1OFI A;  3PVS A;  4IBC A;  4LY6 A;  1W5S A;  1N34 M;  1ZV1 A;  2WSC F;  4LRS A;  1G59 A;  2QHO B;  1E9R A;  1NNU C;  2XF3 A;  5BR8 M;  4AW4 A;  2ZM6 M;  1JR3 E;  3KDS E;  2O5R A;  2R4J A;  3ZC7 B;  4DUY M;  3R8F A;  4KLN A;  1YLA A;  3PNY A;  8CAT A;  1HNW M;  3A42 A;  5ITX A;  4WW0 A;  2MJ5 B;  1H0G A;  3U6C A;  2UU9 M;  3AOE A;  1GL6 A;  4NZ3 A;  3UGJ A;  3ZH9 B;  3HSH A;  1DV0 A;  2ZAN A;  3KP0 E;  2DKL A;  1GO5 A;  2Y2H A;  2Y2O A;  2YNM D;  3SAW A;  1N36 M;  2JE5 A;  2J5Y A;  2OOA A;  2QZ4 A;  2CWB A;  1ZQ9 A;  2OOB A;  3BOS A;  1X37 A;  2BWB A;  2Y2N A;  1IXZ A;  2DZN B;  4B7G A;  3LQR A;  5LMN M;  1NV9 A;  1Y8G A;  5DYG A;  3WHK A;  4BB9 A;  1IBL M;  3VKG A;  5ITY A;  1P3Q Q;  3RGP A;  2EUC A;  2YFQ A;  4FWH A;  4IJF A;  4X66 M;  2KEB A;  2LHC A;  4BLC A;  1MX0 A;  3JAM S;  4G4O A;  5EJC A;  1PJJ A;  4JI1 M;  5FTL A;  1HT1 E;  2DXI A;  2EJS A;  3HJS A;  2F5S A;  2DAG A;  4GEW A;  3L25 A;  4TUW A;  1OIP A;  2L6O A;  4FCW A;  1K3X A;  1W1V A;  2A5Y B;  4LJA A;  1XMQ M;  4AKH A;  4L6V 6;  1IXR C;  3J81 S;  3B7Z A;  2Y2I A;  2JA2 A;  5BPV A;  1GVN A;  3MHV C;  3QWL A;  3J27 B;  2DAM A;  2DWZ B;  2XSZ A;  1XC8 A;  2Z8Y M;  4G4R A;  3M7G A;  3N3F A;  2KZU A;  3B74 A;  2N35 A;  3HJ8 A;  2KW0 A;  2LXE A;  2RKO A;  3LQQ A;  5IWA M;  1PJI A;  1Q3B A;  1T43 A;  3HU2 A;  4Z2H A;  3GPP A;  4MB7 A;  4DV5 M;  2XD5 A;  3NBX X;  4DUZ M;  3GLF E;  3U6O A;  5KQ8 A;  4JN6 A;  2V1C A;  4IBF A;  1OKS A;  2K6B A;  2XH9 A;  1YU2 A;  4DR7 M;  3HON A;  2LH0 A;  2V1U A;  2DWN A;  2HKJ A;  3D8L A;  3LMM A;  5KPT A;  4KO8 A;  3OTO M;  4CIS A;  2Z4R A;  2YQZ A;  2K9D A;  1SXJ B;  4JI5 M;  3FKE A;  2CP8 A;  4JI7 M;  5IRE B;  3AKZ A;  1TDH A;  3FD9 A;  2DWL A;  2ZBK B;  5E6J A;  1G4A E;  3AOG A;  3L27 A;  1UR8 A;  4LJ4 A;  2Y2Q A;  2RGO A;  1IXS B;  4MM3 B;  5KQD A;  1PJT A;  1T6O A;  2QPA A;  2FOI C;  2O25 A;  4RF1 A;  4B3M M;  2DAI A;  4NZ1 A;  2XEP A;  4DBG B;  2DWM A;  1XWI A;  2BNK A;  2KA6 B;  4OVZ A;  3C3E A;  1H8P A;  2LTU A;  4IJE A;  4NRV A;  2F5O A;  2M5Z A;  2UUC M;  3GLH A;  1OAO C;  2JNH A;  1GKI A;  4NXM M;  4MGI E;  2O01 F;  2JXN A;  1YU0 A;  3GO8 A;  4JXJ A;  2Y21 A;  4NL4 H;  4OJ6 A;  1VDL A;  5H37 D;  3DOA A;  2F5N A;  2DHR A;  5ITQ A;  3C58 A;  4LF5 M;  1DGH A;  3HHX A;  2LNH C;  3GPX A;  3A98 B;  2F5P A;  4DR5 M;  1NVM A;  1QDR A;  3W0L B;  3JR5 A;  4AQY M;  2FH0 A;  2Y0Q A;  3GLG E;  5EXT A;  3FRI A;  3PFI A;  5GKN A;  5IT9 S;  7CAT A;  1XHB A;  1AIP C;  3SYK A;  1NSF A;  1IM2 A;  3MJ5 A;  4CIZ A;  4LZZ A;  3E9S A;  3A46 A;  1IN7 A;  5KPR A;  1HQC A;  1Z6T A;  4JI2 M;  4PDI A;  4Q7J A;  1R2Y A;  5IZ7 D;  4B7F A;  3AOE C;  1L1T A;  1XB2 B;  1XXH E;  2C98 A;  2AHM A;  1QAO A;  4G6Z A;  4PDG A;  3I51 A;  3I4V A;  4QNR A;  1EAK A;  2ZTD A;  1E6P A;  2FN2 A;  1HJP A;  3FE3 A;  1PDC A;  1PM5 A;  4B3T M;  3SFZ A;  1D0L A;  3F92 A;  4LF6 M;  4M0W A;  2NQ8 C;  2ZAM A;  2Z4S A;  3DFZ A;  2BJV A;  2QSF X;  1KYI A;  1GPF A;  1BVS A;  4AG6 A;  3B7N A;  2Y2K A;  1PJS A;  2QEN A;  1J5E M;  1LV7 A;  4Z2I A;  3U60 A;  1HNX M;  1A5T A;  4QOZ C;  4FW9 A;  1WXQ A;  4KOD A;  5C1B A;  3U6E A;  2ERC A;  2MGW A;  3LCU A;  2L2D A;  1VEG A;  2X49 A;  3K8Z A;  3GLF B;  3ZQJ A;  4LF8 M;  1HQY E;  2EA0 A;  5ITU A;  4HME A;  4XK8 F;  4A3V B;  3W0F A;  3SBJ A;  1V33 A;  1N33 M;  1E94 E;  4DR1 M;  3UMM A;  4KT0 F;  3CF2 A;  4AZF A;  1WGN A;  4R71 A;  3GLI E;  3FUW A;  2RTS A;  3H4J A;  5FTJ A;  2DZO B;  2L09 A;  1WIV A;  2JWS A;  2D49 A;  4LRT A;  2VII A;  1J7K A;  4AKI A;  2GNO A;  2VQE M;  1AIW A;  4QNM A;  1L6J A;  5EXP A;  4P17 A;  2F5Q A;  4AG5 A;  4OJ5 A;  1PJQ A;  2L4F A;  3CF6 E;  2LVP C;  3LCV B;  1K82 A;  4ZPX A;  2LVA A;  2OQ4 A;  1QUS A;  2P5T A;  3FRH A;  4FCV A;  2CV1 A;  4HLQ A;  2JY8 A;  1G3I A;  1QAQ A;  4LF9 M;  3SHG B;  2UXC M;  2Y2L A;  3K9P A;  3HX3 A;  1IY0 A;  3KVW A;  1ZAE A;  3IHP A;  1G8P A;  4IBB A;  3NWL A;  2R65 A;  1G41 A;  3D8B A;  4L16 A;  3SYL A;  2XZU A;  2KRU A;  1R5L A;  4G4N A;  1XMO M;  1ED7 A;  3FTE A;  1I94 M;  1KFV A;  4P16 A;  4OU7 A;  4GKK M;  2QCU A;  3AJI B;  1TF0 B;  3TWM A;  4XGI A;  4I4L A;  4DR4 M;  4CJ6 A;  4LF7 M;  2K0B X;  1QZE A;  3L28 A;  4FWD A;  1NNJ A;  3GLG B;  2HCB A;  1Z5B A;  1OAI A;  1D0K A;  1F4I A;  3M7P A;  2EKF A;  4DR3 M;  4JI0 M;  4XBO A;  3I4Y A;  1QYR A;  2DHY A;  1JB0 F;  2HWJ A;  3UJN A;  4GC9 A;  1WJ7 A;  4L4U A;  5LMU M;  5ITR A;  2B3T A;  3EIH A;  3U6M A;  3U5Z B;  4GMQ A;  3HHY A;  3FTD A;  4MB5 A;  3SMS A;  1QDT A;  4Z2K A;  1IN6 A;  4WUR A;  1XXH B;  1OGB A;  1T3T A;  3PNV A;  4JI8 M;  1HNZ M;  1QVR A;  2XD1 A;  4OJP A;  2V5O A;  1UM8 A;  4B3S M;  1QZM A;  2FE8 A;  2L4E A;  4II7 A;  4DV1 M;  4QOS A;  1TDZ A;  4REZ A;  5ITX E;  5JI3 E;  5EP3 A;  1VG5 A;  4GRI A;  5L8R F;  4L8R C;  4NY2 A;  1IN4 A;  1Z59 A;  2CV2 A;  4Y28 F;  2DVW B;  4GHA A;  3GRY A;  3E21 A;  1IQP A;  1G71 A;  3K2L A;  1XNQ M;  1TH3 A;  3U61 B;  3HWS A;  3T38 A;  2CV0 A;  3L2A A;  2L7H A;  2MRO B;  4RNA A;  1IBK M;  3KXE C;  3B9P A;  3T1Y M;  3J7A S;  1J7M A;  1NY5 A;  1K3W A;  2LHG A;  4NSR A;  3C3D A;  2LWX A;  1NJG A;  3KS4 A;  4LGM A;  3KOZ E;  3K1J A;  4LJ8 A;  1NY6 A;  1R6B X;  2R4E A;  2XSZ D;  3UK6 A;  4FD2 A;  1SXJ A;  2DZL A;  3WHL A;  3RGS A;  3T1H M;  1C7Y A;  4G3O A;  1IY1 A;  1TR8 A;  3GRR A;  4D80 A;  3GPY A;  3WX7 A;  4G4Q A;  1E6R A;  1FNN A;  1IXS A;  3L26 A;  3GLI B;  1GAB A;  2C96 A;  1WHC A;  3ZCB B;  4MGK E;  4FVM A;  4MGZ E;  4NOO B;  3SHF A;  1SG9 A;  2JY5 A;  3E4R A;  3TE6 A;  3SC3 A;  2DAK A;  2APL A;  2WSF F;  1GOI A;  2DAE A;  1NV8 A;  1OJL A;  4OX9 M;  4GIT A;  3UZU A;  1Q39 A;  4X65 M;  5KO3 A;  1VEJ A;  2ZTC A;  1JR3 A;  3J80 S;  4OW0 A;  2J7N A;  1W5T A;  1NJF A;  1QAM A;  2DI0 A;  1JQJ C;  2ZAO A;  3VLF B;  1GXD A;  2D7E A;  1DGB A;  2FFJ A;  3FUT A;  3HHW A;  5F3W A;  4Z2J A;  3WD0 A;  2M60 A;  1QO6 A;  4GKJ M;  4EIW A;  2JZ1 A;  2BG1 A;  1OIZ A;  1EIJ A;  1QAN A;  4YY3 M;  3SAU A;  2QBY B;  3SAR A;  3VK7 A;  2UUA M;  5FTK A;  3CTW B;  4IBD A;  4LJ7 A;  2EKK A;  4MGH A;  3R9X B;  3KSX A;  1E9S A;  4M9X A;  2H1R A;  1N78 A;  4PD2 A;  2MH8 A;  2OPF A;  3KP1 E;  1NO1 A;  2Y2G A;  2C9C A;  4IBG A;  3L29 A;  4NRW A;  3CGW A;  1SXJ D;  4JI6 M;  2OO9 A;  1Z5A A;  2MR9 A;  3FUV A;  3B7Q A;  1H0I A;  1HR0 M;  4AKG A;  1Q02 A;  3BXW A;  1PGY A;  2QQ8 A;  2R0I A;  1O6I A;  1GJT A;  4I5S A;  1ZMU A;  2G8L A;  3U6D A;  3IG8 A;  4OJL A;  4F1I A;  1MU5 A;  1TH4 A;  1YUB A;  2JY7 A;  2Z7J A;  4LJ5 A;  5EQT A;  2CUZ A;  3GLH E;  5JI2 E;  4DV2 M;  2UUB M;  1V34 A;  1GJS A;  4UN2 B;  1KSF X;  4I81 A;  4MB3 A;  1XNR M;  3HU1 A;  3AV0 A;  1KS0 A;  4Z2G A;  4GH9 A;  3TL4 X;  1NHG C;  3HZJ A;  2Y20 A;  3IEC A;  1TTE A;  1D2N A;  1JR3 D;  3U6Q A;  1VQ1 A;  1GLN A;  1RU3 A;  3QAU A;  4NSO B;  3M6A A;  4DV3 M;  4MB4 A;  4DV6 M;  2KZS A;  1QUT A;  2RRU A;  1WGL A;  3GP1 A;  2XFS A;  2C99 A;  1CK7 A;  3GQ4 A;  1N77 A;  3M0E A;  3NBI A;  4IIW A;  3GLF A;  1L1Z A;  2C9O A;  2R6F A;  4YHH M;  1CUK A;  4L15 A;  5ITT A;  2H5X A;  2J7O A;  3VK8 A;  4BBA A;  3C9P A;  1QQW A;  1TGU A;  1LTM A;  3W68 A;  4NYU A;  3RE8 A;  4L78 A;  3DZD A;  4X64 M;  2CHQ A;  4FWG A;  3SAT A;  4ANR A;  2R46 A;  3K92 A;  4M0D A;  4K0K M;  3W67 A;  1W1Y A;  3I04 M;  2HHH M;  3SAS A;  2X8A A;  2VDB B;  2EO2 A;  4LG2 A;  3Q8X A;  4QHS A;  1OQY A;  1V92 A;  1E6Z A;  1EE8 A;  3THG A;  4NZ5 A;  1DGF A;  1OTR A;  4PT5 A;  1L2B A;  1YUE A;  4D81 A;  1VDD A;  3TWL A;  4Z6Y A;  3WD2 A;  4W5W A;  3IG5 A;  4LFA M;  2VQF M;  1H6U A;  2CFO A;  5FLX S;  3AL0 C;  3GQ5 A;  1E32 A;  2Y0T A;  2LVO C;  1N32 M;  2UXD M;  3T15 A;  1SXJ C;  2KRK A;  4WP2 A;  2QP9 X;  3V76 A;  2VF7 A;  3QYB A;  4QNL A;  2FNA A;  4S12 A;  2R44 A;  3KS8 A;  3U6P A;  4Z8X A;  5EXS A;  1E6N A;  1W1T A;  2Y2M A;  1E88 A;  3GPU A;  2XFT A;  2CRU A;  3RFW A;  4CGY B;  2L7I A;  3TWK A;  2LVQ D;  5EP2 A;  4PCZ A;  2Y2P A;  3GQ3 A;  3PXG A;  2R18 A;  1AUA A;  1I4W A;  3LW5 F;  1CXW A;  1Q3C A;  3U6L A;  2HL7 A;  2CE7 A;  2RGH A;  2XZF A;  5KPZ A;  2WZJ A;  2E5L M;  4LZJ A;  1DO2 A;  2K47 A;  2X4A A;  3I01 M;  3FYC A;  1YSY A;  2G3Q A;  3KW6 A;  3GLG A;  3FTF A;  1Z5C A;  4CHT B;  4JI4 M;  4LFB M;  3VKH A;  2JY6 B;  1UR9 A;  4D82 A;  4RF0 A;  2D7H A;  4JYA M;  5DNY A;  4Z2L A;  1IFY A;  3FYD A;  3TQS A;  1YE9 A;  2LVN C;  1TH2 A;  1VEK A;  2YR0 A;  3MK6 A;  4F2L A;  3U6S A;  1J09 A;  3U5Z A;  4FCT A;  1IN8 A;  4KHP M;  4LGY A;  1MJG M;  2JUJ A;  4IBE A;  1MN3 A;  1NHW C;  1XXH A;  1S3S A;  4NXN M;  4ITQ A;  3LVV A;  4DV0 M;  2BJW A;  4I8O A;  4JV5 M;  3A45 A;  3HJQ A;  4OVZ B;  4DV4 M;  4NZ4 A;  2JP7 A;  4M9Z A;  2I7P A;  3HHZ A;  2R62 A;  4DV7 M;  1L2D A;  3GLH B;  2C5R A;  3WD4 A;  4DR2 M;  3EIE A;  2Z3X A;  4B08 A;  1ZMW A;  1UFZ A;  2DNA A;  2V6Z M;  4LJ6 A;  4X62 M;  1OGG A;  2KDL A;  3U61 A;  3MQL A;  1L2C A;  1DGH B;  1R7R A;  4LFC M;  2VF8 A;  2KHH A;  4IBJ A;  3TPZ A;  3BBZ A;  3HY5 A;  4B3R M;  3H4M A;  2R45 A;  5DYI A;  5EXX A;  2QNJ A; 
#chains in the Genus database with same CATH homology
 2UWX A;  4GIP A;  2G5G X;  3VDU A;  3FUU A;  4OJO A;  3GRV A;  3KOW E;  2XLJ A;  1YU4 A;  4R7G A;  3GLI A;  3FTC A;  3GRU A;  4MH0 E;  3HKP A;  2Y2J A;  3ILK A;  4AI6 A;  5FTM A;  5C18 A;  4LJ9 A;  3KOX E;  2CHG A;  4HL4 A;  1DGG A;  4IBI A;  2UXB M;  2JCH A;  1C1K A;  4GC5 A;  5EP4 A;  5FSW A;  4OU7 A;  2Q2E B;  3VDP A;  4OUI A;  3HGI A;  5FTN A;  4LCB A;  1L8Q A;  1IN5 A;  2XGN A;  5EP1 A;  2FFF B;  2W82 A;  2F4V M;  2I7N A;  1OFH A;  3KSJ A;  2IOU A;  2CEA A;  1IY2 A;  4JI3 M;  1GL7 A;  4MGY E;  3KOY E;  3CF0 A;  3J2P B;  4LF4 M;  5A2Q S;  1HT2 E;  3U60 B;  3SMP A;  1DO0 A;  2QBY A;  1N75 A;  3VFD A;  3SAV A;  1IBM M;  3KFU G;  3HU3 A;  5E26 A;  4NYY A;  2D7G A;  1FJG M;  1SXJ E;  4GHL A;  3AFH A;  3LVW A;  4IBK A;  4QHT A;  3JR4 A;  1R2Z A;  3DA1 A;  3J7B A;  1ORY B;  4R3D A;  2KXE A;  3FUX A;  4M9S A;  1YU3 A;  4DR6 M;  1YU1 A;  2CHV A;  4B7H A;  1OFI A;  3PVS A;  4IBC A;  4LY6 A;  1W5S A;  1N34 M;  4LRS A;  1G59 A;  1E9R A;  1NNU C;  2XF3 A;  5BR8 M;  4AW4 A;  2ZM6 M;  3KDS E;  4DUY M;  2O5R A;  2R4J A;  3ZC7 B;  3R8F A;  4KLN A;  3PNY A;  8CAT A;  1HNW M;  3A42 A;  5ITX A;  4WW0 A;  3U6C A;  2UU9 M;  3AOE A;  1GL6 A;  4NZ3 A;  3UGJ A;  3ZH9 B;  3HSH A;  2ZAN A;  3KP0 E;  2Y2H A;  2Y2O A;  2YNM D;  3SAW A;  1N36 M;  2JE5 A;  2QZ4 A;  1ZQ9 A;  3BOS A;  1X37 A;  2Y2N A;  1IXZ A;  2DZN B;  4B7G A;  3LQR A;  5LMN M;  5DYG A;  3WHK A;  1IBL M;  4BB9 A;  3VKG A;  5ITY A;  3RGP A;  2EUC A;  2YFQ A;  4FWH A;  4IJF A;  4X66 M;  2KEB A;  4BLC A;  3JAM S;  1MX0 A;  4G4O A;  1PJJ A;  5EJC A;  4JI1 M;  5FTL A;  1HT1 E;  2DXI A;  4TUW A;  3HJS A;  2F5S A;  3L25 A;  1K3X A;  2L6O A;  4FCW A;  2A5Y B;  4LJA A;  1XMQ M;  4AKH A;  1IXR C;  3J81 S;  2Y2I A;  2JA2 A;  5BPV A;  1GVN A;  3MHV C;  3QWL A;  3J27 B;  2DWZ B;  2XSZ A;  1XC8 A;  4G4R A;  3M7G A;  3N3F A;  2KZU A;  3HJ8 A;  2KW0 A;  2LXE A;  2RKO A;  3LQQ A;  5IWA M;  1PJI A;  1Q3B A;  3HU2 A;  3GPP A;  4MB7 A;  4DV5 M;  2XD5 A;  4DUZ M;  3U6O A;  5KQ8 A;  4JN6 A;  2V1C A;  4IBF A;  3HON A;  2XH9 A;  1YU2 A;  4DR7 M;  2LH0 A;  2V1U A;  2DWN A;  2HKJ A;  3D8L A;  3LMM A;  5KPT A;  4KO8 A;  3OTO M;  4CIS A;  2Z4R A;  2YQZ A;  1SXJ B;  4JI5 M;  3FKE A;  4JI7 M;  5IRE B;  3AKZ A;  1TDH A;  3FD9 A;  2DWL A;  2ZBK B;  5E6J A;  1G4A E;  3AOG A;  3L27 A;  2Y2Q A;  4LJ4 A;  2RGO A;  1IXS B;  4MM3 B;  5KQD A;  2QPA A;  2FOI C;  4B3M M;  4RF1 A;  4NZ1 A;  2XEP A;  2DWM A;  1XWI A;  2BNK A;  2KA6 B;  4OVZ A;  4IJE A;  4NRV A;  2F5O A;  2M5Z A;  2UUC M;  3GLH A;  1GKI A;  4NXM M;  4MGI E;  1YU0 A;  3GO8 A;  4JXJ A;  2Y21 A;  4NL4 H;  4OJ6 A;  5H37 D;  3DOA A;  2F5N A;  2DHR A;  5ITQ A;  3C58 A;  4LF5 M;  1DGH A;  3HHX A;  2LNH C;  3GPX A;  3A98 B;  2F5P A;  4DR5 M;  1NVM A;  3W0L B;  3JR5 A;  4AQY M;  2Y0Q A;  5EXT A;  3PFI A;  5GKN A;  5IT9 S;  7CAT A;  1XHB A;  3SYK A;  1NSF A;  1IM2 A;  3MJ5 A;  4LZZ A;  3E9S A;  3A46 A;  1IN7 A;  5KPR A;  1HQC A;  1Z6T A;  4JI2 M;  4PDI A;  1R2Y A;  5IZ7 D;  4B7F A;  3AOE C;  1L1T A;  2C98 A;  2AHM A;  1QAO A;  4G6Z A;  4PDG A;  3I51 A;  3I4V A;  4QNR A;  1PM5 A;  4B3T M;  3SFZ A;  4LF6 M;  4M0W A;  2NQ8 C;  2ZAM A;  2Z4S A;  3DFZ A;  2BJV A;  1KYI A;  4AG6 A;  2Y2K A;  1J5E M;  2QEN A;  1LV7 A;  3U60 A;  1HNX M;  4QOZ C;  4FW9 A;  1WXQ A;  4KOD A;  5C1B A;  3U6E A;  2ERC A;  4LF8 M;  2X49 A;  3K8Z A;  3GLF B;  1HQY E;  2EA0 A;  5ITU A;  4A3V B;  3W0F A;  3SBJ A;  1N33 M;  1E94 E;  4DR1 M;  3UMM A;  3CF2 A;  4AZF A;  3FUW A;  5FTJ A;  2DZO B;  2L09 A;  4LRT A;  2VII A;  1J7K A;  4AKI A;  2VQE M;  4QNM A;  5EXP A;  2F5Q A;  4AG5 A;  4OJ5 A;  3CF6 E;  1K82 A;  4ZPX A;  2OQ4 A;  2P5T A;  4FCV A;  2CV1 A;  4HLQ A;  1G3I A;  1QAQ A;  4LF9 M;  3SHG B;  2UXC M;  2Y2L A;  1IY0 A;  3KVW A;  1ZAE A;  4IBB A;  1G8P A;  3NWL A;  2R65 A;  1G41 A;  3D8B A;  4L16 A;  3SYL A;  2XZU A;  2KRU A;  4G4N A;  1XMO M;  3FTE A;  1I94 M;  1KFV A;  4P16 A;  4GKK M;  2QCU A;  3AJI B;  3TWM A;  4XGI A;  4I4L A;  4DR4 M;  4LF7 M;  3L28 A;  4FWD A;  1NNJ A;  3GLG B;  2HCB A;  1Z5B A;  4DR3 M;  4JI0 M;  4XBO A;  3I4Y A;  1QYR A;  3UJN A;  4GC9 A;  4L4U A;  5LMU M;  5ITR A;  3EIH A;  3U6M A;  3U5Z B;  4GMQ A;  3HHY A;  3FTD A;  3SMS A;  1IN6 A;  4WUR A;  1XXH B;  1T3T A;  3PNV A;  4JI8 M;  1HNZ M;  1QVR A;  2XD1 A;  4OJP A;  1UM8 A;  4B3S M;  1QZM A;  2FE8 A;  4II7 A;  4DV1 M;  4QOS A;  1TDZ A;  4REZ A;  5ITX E;  5JI3 E;  5EP3 A;  4GRI A;  4L8R C;  4NY2 A;  1IN4 A;  1Z59 A;  2CV2 A;  2DVW B;  4GHA A;  3GRY A;  1IQP A;  3K2L A;  1XNQ M;  1TH3 A;  3U61 B;  3HWS A;  3T38 A;  2CV0 A;  3L2A A;  2L7H A;  4RNA A;  1IBK M;  3KXE C;  3B9P A;  3T1Y M;  3J7A S;  1NY5 A;  1K3W A;  4NSR A;  3KS4 A;  1NJG A;  2LWX A;  4LGM A;  4LJ8 A;  3KOZ E;  3K1J A;  1NY6 A;  1R6B X;  2R4E A;  2XSZ D;  3UK6 A;  4FD2 A;  1SXJ A;  3WHL A;  3RGS A;  3T1H M;  1IY1 A;  3GRR A;  4D80 A;  3GPY A;  3WX7 A;  4G4Q A;  1FNN A;  3L26 A;  3GLI B;  2C96 A;  3ZCB B;  4MGK E;  4FVM A;  4MGZ E;  4NOO B;  3SHF A;  3E4R A;  3TE6 A;  3SC3 A;  4OX9 M;  1OJL A;  4GIT A;  3UZU A;  1Q39 A;  4X65 M;  5KO3 A;  1JR3 A;  3J80 S;  4OW0 A;  2J7N A;  1W5T A;  1NJF A;  1QAM A;  2ZAO A;  1JQJ C;  3VLF B;  2D7E A;  1DGB A;  2FFJ A;  3FUT A;  3HHW A;  5F3W A;  2M60 A;  4GKJ M;  4EIW A;  2BG1 A;  1QAN A;  4YY3 M;  3SAU A;  2QBY B;  3SAR A;  3VK7 A;  2UUA M;  5FTK A;  3CTW B;  4IBD A;  4LJ7 A;  4MGH A;  3R9X B;  3KSX A;  1E9S A;  4M9X A;  2H1R A;  1N78 A;  4PD2 A;  2OPF A;  3KP1 E;  2Y2G A;  2C9C A;  4IBG A;  3L29 A;  4NRW A;  1SXJ D;  4JI6 M;  1Z5A A;  3FUV A;  1HR0 M;  4AKG A;  4I5S A;  2G8L A;  3U6D A;  3IG8 A;  4OJL A;  1MU5 A;  1TH4 A;  1YUB A;  2Z7J A;  5EQT A;  4LJ5 A;  5JI2 E;  2CUZ A;  4DV2 M;  2UUB M;  1KSF X;  4I81 A;  1XNR M;  3HU1 A;  3AV0 A;  4GH9 A;  3TL4 X;  1NHG C;  2Y20 A;  3U6Q A;  1D2N A;  1JR3 D;  1GLN A;  3QAU A;  4NSO B;  3M6A A;  4DV3 M;  4DV6 M;  2KZS A;  3GP1 A;  2XFS A;  2C99 A;  3GQ4 A;  1N77 A;  3M0E A;  3NBI A;  4IIW A;  3GLF A;  1L1Z A;  2C9O A;  4YHH M;  4L15 A;  5ITT A;  2J7O A;  3VK8 A;  4BBA A;  1QQW A;  1TGU A;  4NYU A;  3RE8 A;  4L78 A;  3DZD A;  4X64 M;  2CHQ A;  4FWG A;  3SAT A;  4K0K M;  2R46 A;  3K92 A;  4M0D A;  2HHH M;  3SAS A;  2X8A A;  2EO2 A;  4LG2 A;  3Q8X A;  4QHS A;  1EE8 A;  3THG A;  4NZ5 A;  1DGF A;  1L2B A;  4PT5 A;  1YUE A;  4D81 A;  1VDD A;  3TWL A;  4Z6Y A;  4W5W A;  3IG5 A;  4LFA M;  2VQF M;  1H6U A;  2CFO A;  5FLX S;  3AL0 C;  3GQ5 A;  1E32 A;  2Y0T A;  2UXD M;  1N32 M;  3T15 A;  1SXJ C;  2KRK A;  2QP9 X;  4QNL A;  2FNA A;  4S12 A;  3KS8 A;  3U6P A;  4Z8X A;  5EXS A;  2Y2M A;  3GPU A;  2XFT A;  3RFW A;  4CGY B;  2Y2P A;  2L7I A;  3TWK A;  4PCZ A;  5EP2 A;  3GQ3 A;  3PXG A;  2R18 A;  1I4W A;  1Q3C A;  3U6L A;  2HL7 A;  2CE7 A;  2RGH A;  2XZF A;  5KPZ A;  2E5L M;  4LZJ A;  1DO2 A;  2K47 A;  2X4A A;  3FYC A;  1YSY A;  3KW6 A;  3GLG A;  3FTF A;  1Z5C A;  4CHT B;  4JI4 M;  4LFB M;  3VKH A;  4D82 A;  4RF0 A;  2D7H A;  4JYA M;  5DNY A;  3FYD A;  3TQS A;  1YE9 A;  1TH2 A;  2YR0 A;  3MK6 A;  3U6S A;  1J09 A;  3U5Z A;  4FCT A;  1IN8 A;  4KHP M;  4LGY A;  4IBE A;  1NHW C;  1XXH A;  1S3S A;  4NXN M;  4ITQ A;  3LVV A;  4DV0 M;  2BJW A;  4I8O A;  4JV5 M;  3A45 A;  3HJQ A;  4OVZ B;  4DV4 M;  4NZ4 A;  4M9Z A;  2I7P A;  3HHZ A;  2R62 A;  4DV7 M;  1L2D A;  3GLH B;  2C5R A;  4DR2 M;  3EIE A;  2Z3X A;  4B08 A;  4LJ6 A;  2V6Z M;  4X62 M;  3U61 A;  1L2C A;  1DGH B;  1R7R A;  4LFC M;  4IBJ A;  3TPZ A;  4B3R M;  3H4M A;  2R45 A;  5DYI A;  5EXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...