4IBDA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibdA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibdA02
3L26A 4GH9A 4IBEA 4IJFA 3L27A 3L2AA 4IBIA 5BPVA 4IBJA 3L29A 4GHAA 4IBKA 4LG2A 3KS4A 4IBCA 4GHLA 4IBDA 3L25A 4IBFA 4IBGA 4IJEA 3L28A 3FKEA 3KS8A 4IBBA
chains in the Genus database with same CATH superfamily
1YUEA 1G41A 1XB2B 2QENA 4X66M 3HZJA 3HU1A 2DHYA 3KFUG 1TGUA 1Z5BA 3IECA 1EIJA 1FNNA 1DGHA 3FUVA 4JI6M 3A98B 4F2LA 1F4IA 2D49A 1IN7A 1ED7A 2KNZA 4NOOB 3LVVA 2CHQA 3VK8A 2J5YA 3UJNA 1GJSA 1ZMUA 1YU0A 2XFTA 3M7GA 3U5ZB 3M6AA 4JV5M 2DKLA 1NV8A 2CE7A 2JZ1A 2K6BA 2XZFA 4NYYA 2RRUA 1IY0A 1OKSA 2QPAA 2LWXA 2YQZA 2O25A 4D81A 1GVNA 2JZ0A 4OJ6A 3U6SA 3E9SA 5E26A 2MGWA 3HKPA 4QHTA 1R5LA 4LCBA 2UU9M 2Y2NA 1QAOA 3BXWA 3I4YA 1K82A 2QNJA 1VEGA 2KDLA 1X37A 4GH9A 4XGIA 1XMQM 4MB5A 3W0FA 3VDPA 2DI0A 3HU3A 1E88A 3L29A 3GLIB 1RU3A 4DR4M 3A42A 3LCUA 5KQDA 2HKJA 4OJOA 4LGMA 2B3TA 2LVQD 1PDCA 4EIWA 2XGNA 4L15A 4M0WA 4AKHA 3C3EA 3L25A 1Z6TA 1CUKA 4JN6A 1GOIA 2CWBA 3HHWA 2L4FA 1PJSA 5ITYA 5DNYA 4LRTA 2L6OA 4MGYE 4XBOA 1NNJA 3I51A 4JYAM 2J7OA 1HR0M 1PM5A 1V92A 2KZSA 5IREB 3SFZA 1DO0A 3LW5F 1G4AE 1TH2A 1Z5CA 4Z2GA 5BPVA 4IBIA 3QWLA 5FLXS 1N34M 1HNXM 3VKGA 2JP7A 3AFHA 3FTCA 3B9PA 3FYDA 4M9XA 3Q8XA 2D7HA 1NNUC 4MGHA 2Z4RA 1Q39A 5EQTA 1QDRA 5FTKA 1W5TA 1XXHB 4FWHA 4LFAM 3THGA 3UK6A 4DV2M 3CF6E 4B3MM 1IY1A 4G4OA 1D2NA 1IBLM 3PNVA 3CGWA 3ZH9B 5KPRA 3MMPA 2G3QA 3JAMS 1ORYB 3IHPA 3Q8GA 3U6EA 3PNYA 2Y2OA 2WSEF 4LJ8A 4DR2M 2OPFA 2F5SA 4QOZC 4NZ1A 3KOXE 3C3DA 3AJIB 3E4RA 2D7EA 4NXNM 1OQYA 2GNOA 2LH0A 3CTWB 2KW0A 3IG5A 4L78A 2X8AA 3DZDA 3C58A 2VIIA 1ZQ9A 2V5OA 3AV0A 3SMPA 1PGYA 1NJGA 4P17A 1L1ZA 2R18A 3RGSA 2FOIC 3J2PB 2JY5A 1OAOC 1VG5A 2BNKA 2H5XA 1EE8A 2EKKA 1QO6A 4FCVA 1W1YA 4X64M 2RTSA 2JE5A 2F4VM 3SASA 2UUAM 4NRWA 4HMCA 4LF6M 1TDHA 2YNMD 3KP1E 1E6PA 4JI0M 2KNVA 3LQRA 2RKOA 2L4EA 3T6PA 2DZOB 3VDUA 2QQ8A 1XNRM 5DYIA 3QAUA 1Q3BA 1FJGM 1AUAA 2LXEA 4QNMA 2ERCA 3MHVC 5IWAM 4TX8A 1OJLA 1KSFX 2X4AA 2OOBA 4AI6A 3GRUA 3KVWA 1N78A 4LJ7A 4DR1M 2JUJA 4FVMA 1GL7A 2LTUA 4KT0F 4M9SA 4JI1M 3SAUA 4B3RM 2G5GX 2XD1A 1E6ZA 2LHGA 3HU2A 4PD2A 1VDDA 2R65A 4QOSA 1J09A 2ZANA 4IBKA 3R8FA 4UN2B 1QANA 2YR0A 4CJ6A 3SHGB 2JY7A 3AKZA 4L16A 4WP2A 3GPUA 1AIPC 2CRUA 3K9PA 5H37D 3B89A 4WURA 4ZPXA 1D0LA 1NJFA 2KRKA 3B7QA 3R9XB 5EJCA 3VLFB 1Q3CA 2QZ4A 4AZFA 2OQ4A 2DAIA 1T3TA 4I5SA 2C96A 4I81A 1E32A 2CFOA 2LBCA 1QZEA 4TUWA 3WD4A 4JI5M 4M9ZA 1OFIA 3WD3A 3HJQA 2WZJA 3B7ZA 2C5RA 2C9OA 5EP4A 7CATA 2L2DA 3AL0C 3TQSA 2CV1A 2EA0A 3BBZA 4JI3M 2YFQA 1N32M 2BJVA 2F5OA 4LJ9A 3JR4A 4LGYA 3UGJA 2LHCA 5GKNA 4HMEA 3GLHB 3PFIA 4LRSA 1XMOM 3GPYA 3RGPA 1V34A 3B74A 2VQFM 4X62M 4DV0M 4DV3M 1A5TA 3KSXA 2DXIA 4FD2A 1J5EM 1TTEA 2DWNA 1EFUB 2QP9X 3UMMA 1GJTA 4GKKM 5EXXA 1D0KA 1MX0A 3C9PA 3GLIE 4HEOA 5JI3E 1P3QQ 3KXEC 5JI2E 1H0GA 3E21A 3M7PA 1IM2A 3TWKA 4PCZA 2ZAOA 1GL6A 2FH0A 1JB0F 3DFZA 1JR3A 2VQEM 4JXJA 3A46A 3WD2A 3MJ5A 1HQCA 2UXCM 4NRVA 1G8PA 3KSJA 1E8BA 4NZ5A 3W68A 4R3DA 1VQ1A 4OUIA 5EXSA 5ITRA 2BG1A 4AQYM 3GPXA 2K9DA 1K3XA 4OX9M 1UR8A 2C98A 4OW0A 4A3VB 1YLAA 1Z59A 4REZA 3H4MA 4LJ5A 5KPZA 3U6LA 3J7AS 2UUCM 3N3FA 3FRHA 1NV9A 4DV7M 2DENA 2HAKA 3GLGB 3CF0A 1N75A 1SXJA 1H0IA 3HJSA 5BR8M 4B7HA 2BJWA 3HHZA 2Q2EB 3U6PA 2FFJA 2MH8A 2W82A 3SAWA 1DV0A 3EIHA 3FD9A 2KA6B 3FUXA 4AG5A 4NYUA 1WGNA 4OJPA 3ZCBB 1UFZA 4IJFA 1DGFA 5FTLA 1UM8A 3FUTA 2LVAA 4R7GA 2CHGA 4Y28F 4Z8XA 3TE6A 4MM3B 2UXBM 2F5NA 1YSYA 1IN4A 1CK7A 5LMUM 4FCWA 1Q02A 5C1BA 3GLFA 4M0DA 3VFDA 2QBYB 4L6V6 2DWMA 2Y2MA 2CEAA 2R0IA 4PDGA 3FRIA 2EO2A 1QAQA 4FWGA 4LZZA 1GO5A 3BOSA 4NC6A 4IJEA 2Y0QA 1WXQA 1H6UA 1QYRA 2Z7JA 3FUWA 4DR5M 1KFVA 3TWLA 3HGIA 3DA1A 2I7NA 1TF0B 3WD0A 3TWMA 4QNRA 3I04M 4LFCM 1JR3E 4GEWA 1R2YA 1VEJA 3U6QA 3U5ZA 3CF2A 4II7A 2Y2QA 4DV4M 2NQ8C 4G4QA 1NHWC 3ZC7B 2F5PA 4LJ4A 1S3SA 3GRYA 4JI2M 1E15A 4D82A 4LF7M 4IIWA 2Y2KA 2BWBA 1TDZA 2XF3A 2CV2A 3J81S 2DHRA 2IOUA 1DGHB 3AOEA 1QUSA 3KP0E 4XK8F 5KO3A 3SYKA 5KQ8A 1SXJE 2DAGA 3W0LB 4NY2A 1YU1A 1ZAEA 1T6OA 3WHKA 3GLIA 4JI8M 1MN3A 4MB7A 4F1IA 3T1YM 1L2CA 2CHVA 2F5QA 3KS8A 1H8PA 1PJIA 1BVSA 2CP8A 1NSFA 1XWIA 4G4NA 2R45A 2VF8A 1WR1B 3A45A 3QYEA 4AG6A 1HNZM 1JR3D 2G8LA 3D8BA 4LJ6A 2LVNC 3L26A 3FTEA 4GKJM 2EKFA 3D8LA 5KPTA 1CXWA 3HY5A 1OIPA 2K47A 2KNAA 3AOGA 3NWLA 3PVSA 1IBMM 4NZ3A 3GLGA 2JCHA 4LF5M 4S12A 3U6OA 3GLFE 2RGOA 4IBDA 3HSHA 5ITUA 4DR7M 1ZMVA 3QYBA 3FE3A 4K0KM 3DOAA 3TPZA 3SARA 3IG8A 4DR6M 4LJAA 4MH0E 4Q7JA 5EP1A 1K3WA 2ZAMA 1O6IA 4Z2JA 1NY6A 1SXJD 1PJQA 3LQQA 3L28A 1C1KA 2Z8YM 1Y8GA 1JQJC 2ZBKB 3FUUA 1GLNA 3SHFA 2H1RA 1QUTA 2AHMA 2VF7A 1IXSB 1OFHA 1XXHA 1XC8A 4B7GA 2FFFB 4B3TM 1NY5A 1W1TA 4B3SM 4NL4H 3K8ZA 4YHHM 2RGHA 2P5TA 3VKHA 1HT2E 4Z6YA 4IBJA 1T43A 3HJ8A 3UZUA 3U6CA 1OGGA 4LY6A 4OVZB 5F3WA 1IQPA 2XSZD 4RKUF 4MB4A 3K9OA 4IBCA 4DV6M 3NBIA 2O01F 3SYLA 2XLJA 4IBFA 3KW6A 4PDIA 3RFWA 3RE8A 3KDSE 2Y2JA 1E94E 2XD5A 4NXMM 2JXNA 4B08A 4MB3A 2ZTCA 1MJGM 1ZMWA 3GQ3A 1IXZA 3LMMA 4MGKE 2Y2IA 4DUYM 1YU3A 3W67A 2ZTDA 1IFYA 1W1PA 1OAIA 4ITQA 4Z2KA 4I8OA 1TH4A 5E6JA 3HHXA 4L8RC 1UR9A 2V1CA 2D7GA 3NBXX 2K0BX 2CV0A 3L27A 4FWDA 2HL7A 4BLCA 4CIZA 3KOZE 1KYIA 1IN6A 1HQYE 5EXPA 3GLGE 1YU2A 1R2ZA 4AW4A 1GKIA 4LG2A 2DAKA 2Y2LA 1IN8A 4LF9M 2C9CA 5IZ7D 2R62A 4RF0A 3HX3A 1HT1E 2HCBA 1I94M 1GXDA 4P16A 1WIVA 3PXGA 2Z3XA 3U61B 1W1VA 2Y2PA 1KS0A 5DYGA 2C99A 3LCVB 3GPPA 4RF1A 1GABA 2DVWB 2DZLA 1J7MA 4GMQA 3FKEA 5LMNM 2Y0TA 4GIPA 1XXHE 4CGYB 3K2LA 4LFBM 1YU4A 4FCTA 1NVMA 1V33A 1EAKA 4OJ5A 3SATA 3HWSA 4X65M 2MJ5B 5FTMA 3U6DA 4QNLA 3FTDA 2DAMA 5A2QS 2XEPA 4KODA 1WGLA 2Y2GA 4DBGB 2VDBB 4G6ZA 5EP2A 2L09A 1HJPA 3OTOM 1DGGA 1YE9A 4HL4A 2XSZA 3SMSA 5ITTA 3GQ4A 4GHLA 5FTNA 8CATA 4AKIA 5C18A 1WJ7A 4LZJA 4R71A 1IXSA 2KXEA 4OJLA 2R4JA 4FW9A 4NZ4A 1N33M 4G3OA 1OGBA 3F92A 3B7NA 5ITXE 1IBKM 1SXJC 1IY2A 1PJTA 2A5YB 2L7IA 2DZNB 4JI7M 2XH9A 3LVWA 4OVZA 3J7BA 5FSWA 4Z2IA 2OOAA 3HONA 1VDLA 2V1UA 3GLHA 1QQWA 4DUZM 3K1JA 3T15A 1G3IA 3L2AA 4NSRA 1SG9A 1QDTA 2JWSA 4PT5A 5IT9S 4HLQA 2DWLA 4GRIA 1L2BA 3SBJA 4GHAA 3J80S 4DV1M 1D0MA 1TR8A 1E6NA 5EP3A 4GC5A 3U60B 5ITQA 1DGBA 1TH3A 2APLA 3MQLA 2Y20A 1R4GA 2BWEA 1VEKA 3SC3A 1YUBA 3T1HM 3WD1A 3GQ5A 1QVRA 2EJSA 2LVOC 2WSFF 2Y21A 3JR5A 1E6RA 2EUCA 2R44A 4WW0A 3WHLA 1XNQM 5EXTA 4G4RA 4Z2LA 2HHHM 2R6FA 3MK6A 3ILKA 1HNWM 1QAMA 2I7PA 2E5LM 3WX7A 3I01M 2KEBA 3KOYE 3T38A 3I4VA 2KRUA 2MROB 2FE8A 3VK7A 1L2DA 2DWZB 2JA2A 4KO8A 4IBEA 2KZUA 2O5RA 1OIZA 3U61A 4D80A 2XFSA 2MR9A 4MGZE 4QHSA 2M5ZA 3EIEA 3GO8A 1N36M 5FTJA 3U6MA 2JNHA 2UWXA 2R4EA 1PJJA 3FTFA 3H4JA 2JY6B 2JY8A 1E9RA 2HWJA 4GITA 3HHYA 3ZQJA 2QCUA 1NO1A 1IXRC 2FN2A 4MGIE 3SAVA 2QHOB 3AOEC 2M60A 4L4UA 4LF8M 1PRBA 2LVPC 2UUBM 1IN5A 4W5WA 4KHPM 1L6JA 4CHTB 1L8QA 1NHGC 2L7HA 1Z5AA 4KLNA 3TL4X 1AIWA 3GLHE 4IBBA 1LV7A 4RNAA 4NSOB 1WHCA 4BB9A 2QBYA 2CUZA 2J7NA 1SXJB 1J7KA 4DR3M 2N35A 2DNAA 1G59A 3FYCA 4GC9A 2XZUA 4BBAA 1MU5A 1DO2A 3KOWE 1LTMA 1I4WA 2WSCF 4I4LA 2Y2HA 4HMDA 3KS4A 3K92A 2UXDM 1E9SA 3J27B 2ZM6M 3GRRA 1N77A 3E46A 4AKGA 2Z4SA 4LF4M 4DV5M 2QSFX 1G71A 2OO9A 4CISA 1XHBA 2DAEA 2FNAA 2GQFA 4IBGA 5L8RF 1GPFA 4Z2HA 4OU7A 1QZMA 1W5SA 1L1TA 3GRVA 4ANRA 4YY3M 4JI4M 2X49A 3GLFB 5ITXA 2R46A 1R7RA 2V6ZM 4B7FA 1R6BX 2KHHA 2LNHC 3GP1A 1OTRA 2FS1A 5DFLA 3V76A 1C7YA 3U60A 3M0EA 1ZV1A
chains in the Genus database with same CATH topology
1YUEA 1G41A 2QENA 4X66M 3HU1A 3KFUG 1TGUA 1Z5BA 1FNNA 1DGHA 3FUVA 4JI6M 3A98B 1IN7A 4NOOB 3LVVA 2CHQA 3VK8A 3UJNA 1YU0A 2XFTA 3M7GA 3U5ZB 3M6AA 4JV5M 2CE7A 2XZFA 4NYYA 1IY0A 2QPAA 2LWXA 2YQZA 4D81A 1GVNA 4OJ6A 3U6SA 3E9SA 5E26A 3HKPA 4QHTA 4LCBA 2UU9M 2Y2NA 1QAOA 3I4YA 1K82A 1X37A 4GH9A 4XGIA 1XMQM 3W0FA 3VDPA 3HU3A 3L29A 3GLIB 4DR4M 3A42A 5KQDA 2HKJA 4OJOA 4LGMA 4EIWA 2XGNA 4L15A 4M0WA 4AKHA 3L25A 1Z6TA 4JN6A 3HHWA 5ITYA 5DNYA 4LRTA 2L6OA 4MGYE 4XBOA 1NNJA 3I51A 4JYAM 2J7OA 1HR0M 1PM5A 2KZSA 5IREB 3SFZA 1DO0A 1G4AE 1TH2A 1Z5CA 5BPVA 4IBIA 3QWLA 5FLXS 1N34M 1HNXM 3VKGA 3AFHA 3FTCA 3B9PA 3FYDA 4M9XA 3Q8XA 2D7HA 1NNUC 4MGHA 2Z4RA 1Q39A 5EQTA 5FTKA 4LFAM 1W5TA 1XXHB 4FWHA 3THGA 4DV2M 3UK6A 3CF6E 4B3MM 1IY1A 4G4OA 1D2NA 1IBLM 3PNVA 3ZH9B 5KPRA 3JAMS 1ORYB 3U6EA 3PNYA 2Y2OA 4LJ8A 4DR2M 2OPFA 2F5SA 4QOZC 4NZ1A 3KOXE 3E4RA 3AJIB 4NXNM 2D7EA 2LH0A 3CTWB 2KW0A 3IG5A 4L78A 2X8AA 3DZDA 3C58A 2VIIA 1ZQ9A 3AV0A 3SMPA 1NJGA 1L1ZA 2R18A 3RGSA 2FOIC 3J2PB 2BNKA 1EE8A 4FCVA 4X64M 2JE5A 2F4VM 3SASA 2UUAM 4NRWA 4LF6M 1TDHA 2YNMD 3KP1E 4JI0M 3LQRA 3VDUA 2RKOA 2DZOB 1XNRM 5DYIA 3QAUA 1Q3BA 1FJGM 2LXEA 4QNMA 2ERCA 3MHVC 5IWAM 1OJLA 1KSFX 2X4AA 4AI6A 3GRUA 3KVWA 1N78A 4LJ7A 4DR1M 4FVMA 1GL7A 4JI1M 4M9SA 3SAUA 4B3RM 2G5GX 2XD1A 3HU2A 4PD2A 1VDDA 2R65A 4QOSA 1J09A 2ZANA 4IBKA 3R8FA 1QANA 2YR0A 3SHGB 3AKZA 4L16A 3GPUA 5H37D 3J81S 4WURA 4ZPXA 1NJFA 2KRKA 3R9XB 5EJCA 3VLFB 1Q3CA 2QZ4A 4AZFA 2OQ4A 4I5SA 1T3TA 2C96A 4I81A 1E32A 2CFOA 4TUWA 4JI5M 4M9ZA 1OFIA 3HJQA 2C5RA 2C9OA 5EP4A 7CATA 3AL0C 3TQSA 2CV1A 2EA0A 4JI3M 2YFQA 1N32M 2BJVA 2F5OA 4LJ9A 3JR4A 4LGYA 3UGJA 5GKNA 3GLHB 3PFIA 4LRSA 1XMOM 3GPYA 3RGPA 2VQFM 4DV0M 4X62M 4DV3M 3KSXA 2DXIA 4FD2A 1J5EM 2DWNA 2QP9X 3UMMA 4GKKM 5EXXA 1MX0A 5JI3E 3KXEC 5JI2E 1IM2A 3TWKA 4PCZA 2ZAOA 1GL6A 3DFZA 1JR3A 2VQEM 4JXJA 3A46A 3MJ5A 1HQCA 2UXCM 4NRVA 1G8PA 3KSJA 4NZ5A 4R3DA 4OUIA 5EXSA 5ITRA 2BG1A 4AQYM 3GPXA 1K3XA 4OX9M 2C98A 4OW0A 4A3VB 4REZA 1Z59A 3U6LA 3H4MA 4LJ5A 5KPZA 3J7AS 2UUCM 3N3FA 4DV7M 3GLGB 3CF0A 1N75A 1SXJA 3HJSA 5BR8M 4B7HA 2BJWA 3HHZA 2Q2EB 3U6PA 2FFJA 3SAWA 2W82A 3EIHA 3FD9A 2KA6B 3FUXA 4AG5A 4NYUA 4OJPA 3ZCBB 4IJFA 1DGFA 5FTLA 1UM8A 3FUTA 4R7GA 4Z8XA 2CHGA 3TE6A 2UXBM 4MM3B 2F5NA 1YSYA 1IN4A 5LMUM 4FCWA 5C1BA 3GLFA 4M0DA 3VFDA 2QBYB 2DWMA 2Y2MA 2CEAA 4PDGA 2EO2A 1QAQA 4FWGA 4LZZA 3BOSA 4IJEA 2Y0QA 1WXQA 1H6UA 1QYRA 2Z7JA 3FUWA 4DR5M 1KFVA 3TWLA 3HGIA 3DA1A 2I7NA 3TWMA 4QNRA 4LFCM 1R2YA 3U6QA 3U5ZA 3CF2A 4II7A 2Y2QA 4DV4M 2NQ8C 4G4QA 1NHWC 3ZC7B 2F5PA 4LJ4A 1S3SA 3GRYA 4JI2M 4D82A 4LF7M 4IIWA 2Y2KA 1TDZA 2XF3A 2CV2A 2DHRA 2IOUA 1DGHB 3AOEA 3KP0E 5KO3A 3SYKA 5KQ8A 1SXJE 3W0LB 4NY2A 1YU1A 1ZAEA 3WHKA 3GLIA 4JI8M 4MB7A 3T1YM 1L2CA 2F5QA 2CHVA 3KS8A 1PJIA 1NSFA 1XWIA 4G4NA 2R45A 1HNZM 4AG6A 3A45A 1JR3D 2G8LA 3D8BA 4LJ6A 3L26A 3FTEA 4GKJM 3D8LA 5KPTA 2K47A 3PVSA 3AOGA 3NWLA 4NZ3A 1IBMM 3GLGA 2JCHA 4LF5M 4S12A 3U6OA 2RGOA 4IBDA 3HSHA 5ITUA 4DR7M 4K0KM 3DOAA 3TPZA 3SARA 3IG8A 4DR6M 4LJAA 4MH0E 5EP1A 1K3WA 2ZAMA 1NY6A 1SXJD 3LQQA 3L28A 1C1KA 2ZBKB 1JQJC 3FUUA 1GLNA 3SHFA 2H1RA 2AHMA 1IXSB 1OFHA 1XXHA 1XC8A 4B7GA 2FFFB 4B3TM 1NY5A 4B3SM 4NL4H 3K8ZA 4YHHM 2RGHA 2P5TA 3VKHA 1HT2E 4Z6YA 4IBJA 3HJ8A 3UZUA 3U6CA 4LY6A 4OVZB 5F3WA 1IQPA 2XSZD 4IBCA 4DV6M 3NBIA 3SYLA 2XLJA 4IBFA 3KW6A 4PDIA 3RFWA 3RE8A 3KDSE 2Y2JA 1E94E 2XD5A 4NXMM 4B08A 3GQ3A 1IXZA 3LMMA 4MGKE 2Y2IA 4DUYM 1YU3A 4ITQA 4I8OA 1TH4A 5E6JA 3HHXA 2V1CA 2D7GA 2CV0A 3L27A 4FWDA 2HL7A 4BLCA 3KOZE 1KYIA 1IN6A 1HQYE 5EXPA 1R2ZA 4AW4A 1GKIA 4LG2A 2Y2LA 1IN8A 4LF9M 2C9CA 5IZ7D 2R62A 4RF0A 1HT1E 2HCBA 1I94M 4P16A 3PXGA 2Z3XA 3U61B 2Y2PA 5DYGA 2C99A 3GPPA 4RF1A 2DVWB 4GMQA 3FKEA 5LMNM 2Y0TA 4GIPA 4CGYB 3K2LA 4LFBM 1YU4A 4FCTA 1NVMA 4OJ5A 3SATA 3HWSA 4X65M 5FTMA 3U6DA 4QNLA 3FTDA 5A2QS 2XEPA 4KODA 2Y2GA 4G6ZA 5EP2A 2DWLA 2L09A 3OTOM 1DGGA 1YE9A 4HL4A 2XSZA 3SMSA 5ITTA 3GQ4A 4GHLA 5FTNA 8CATA 4AKIA 5C18A 4LZJA 2KXEA 4OJLA 2R4JA 4FW9A 4NZ4A 1N33M 5ITXE 1IBKM 1SXJC 1IY2A 2A5YB 2L7IA 2DZNB 4JI7M 2XH9A 3LVWA 4OVZA 3J7BA 5FSWA 3HONA 2V1UA 3GLHA 1QQWA 4DUZM 3K1JA 3T15A 1G3IA 3L2AA 4NSRA 5IT9S 4PT5A 4HLQA 4GRIA 1L2BA 3SBJA 4GHAA 3J80S 4DV1M 5EP3A 4GC5A 3U60B 5ITQA 1DGBA 1TH3A 2Y20A 3SC3A 1YUBA 3T1HM 3GQ5A 1QVRA 2Y21A 3JR5A 2EUCA 4WW0A 3WHLA 1XNQM 5EXTA 4G4RA 2HHHM 3MK6A 1HNWM 3ILKA 3WX7A 1QAMA 2I7PA 2E5LM 2KEBA 3KOYE 3T38A 3I4VA 2KRUA 4L8RC 2FE8A 3VK7A 1L2DA 2DWZB 2JA2A 4KO8A 4IBEA 2KZUA 2O5RA 3U61A 4D80A 2XFSA 4MGZE 4QHSA 2M5ZA 3EIEA 3GO8A 1N36M 5FTJA 3U6MA 2UWXA 2R4EA 1PJJA 3FTFA 1E9RA 4GITA 3HHYA 2QCUA 1IXRC 4MGIE 3SAVA 3AOEC 4L4UA 2M60A 4LF8M 2UUBM 1IN5A 4W5WA 4KHPM 4CHTB 1L8QA 1NHGC 2L7HA 1Z5AA 4KLNA 3TL4X 4IBBA 1LV7A 4RNAA 4NSOB 4BB9A 2QBYA 2CUZA 2J7NA 1SXJB 1J7KA 4DR3M 1G59A 3FYCA 4GC9A 2XZUA 4BBAA 1MU5A 1DO2A 3KOWE 1I4WA 4I4LA 2Y2HA 3KS4A 3K92A 2UXDM 1E9SA 3J27B 2ZM6M 3GRRA 1N77A 4AKGA 2Z4SA 4LF4M 4DV5M 4CISA 1XHBA 2FNAA 4IBGA 4OU7A 1QZMA 1W5SA 1L1TA 3GRVA 4YY3M 4JI4M 2X49A 3GLFB 5ITXA 2R46A 1R7RA 2V6ZM 4B7FA 1R6BX 2LNHC 3GP1A 1YU2A 3U60A 3M0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L26 A;  4GH9 A;  4IBE A;  4IJF A;  3L27 A;  3L2A A;  4IBI A;  5BPV A;  4IBJ A;  3L29 A;  4GHA A;  4IBK A;  4LG2 A;  3KS4 A;  4IBC A;  4GHL A;  4IBD A;  3L25 A;  4IBF A;  4IBG A;  4IJE A;  3L28 A;  3FKE A;  3KS8 A;  4IBB A; 
#chains in the Genus database with same CATH topology
 1YUE A;  1G41 A;  1XB2 B;  2QEN A;  4X66 M;  3HZJ A;  3HU1 A;  2DHY A;  3KFU G;  1TGU A;  1Z5B A;  3IEC A;  1EIJ A;  1FNN A;  1DGH A;  3FUV A;  4JI6 M;  3A98 B;  4F2L A;  1F4I A;  2D49 A;  1IN7 A;  1ED7 A;  2KNZ A;  4NOO B;  3LVV A;  2CHQ A;  3VK8 A;  2J5Y A;  3UJN A;  1GJS A;  1ZMU A;  1YU0 A;  2XFT A;  3M7G A;  3U5Z B;  3M6A A;  4JV5 M;  2DKL A;  1NV8 A;  2CE7 A;  2JZ1 A;  2K6B A;  2XZF A;  4NYY A;  2RRU A;  1IY0 A;  1OKS A;  2QPA A;  2LWX A;  2YQZ A;  2O25 A;  4D81 A;  1GVN A;  2JZ0 A;  4OJ6 A;  3U6S A;  3E9S A;  5E26 A;  2MGW A;  3HKP A;  4QHT A;  1R5L A;  4LCB A;  2UU9 M;  2Y2N A;  1QAO A;  3BXW A;  3I4Y A;  1K82 A;  2QNJ A;  1VEG A;  2KDL A;  1X37 A;  4GH9 A;  4XGI A;  1XMQ M;  4MB5 A;  3W0F A;  3VDP A;  2DI0 A;  3HU3 A;  1E88 A;  3L29 A;  3GLI B;  1RU3 A;  4DR4 M;  3A42 A;  3LCU A;  5KQD A;  2HKJ A;  4OJO A;  4LGM A;  2B3T A;  2LVQ D;  1PDC A;  4EIW A;  2XGN A;  4L15 A;  4M0W A;  4AKH A;  3C3E A;  3L25 A;  1Z6T A;  1CUK A;  4JN6 A;  1GOI A;  2CWB A;  3HHW A;  2L4F A;  1PJS A;  5ITY A;  5DNY A;  4LRT A;  2L6O A;  4MGY E;  4XBO A;  1NNJ A;  3I51 A;  4JYA M;  2J7O A;  1HR0 M;  1PM5 A;  1V92 A;  2KZS A;  5IRE B;  3SFZ A;  1DO0 A;  3LW5 F;  1G4A E;  1TH2 A;  1Z5C A;  4Z2G A;  5BPV A;  4IBI A;  3QWL A;  5FLX S;  1N34 M;  1HNX M;  3VKG A;  2JP7 A;  3AFH A;  3FTC A;  3B9P A;  3FYD A;  4M9X A;  3Q8X A;  2D7H A;  1NNU C;  4MGH A;  2Z4R A;  1Q39 A;  5EQT A;  1QDR A;  5FTK A;  1W5T A;  1XXH B;  4FWH A;  4LFA M;  3THG A;  3UK6 A;  4DV2 M;  3CF6 E;  4B3M M;  1IY1 A;  4G4O A;  1D2N A;  1IBL M;  3PNV A;  3CGW A;  3ZH9 B;  5KPR A;  3MMP A;  2G3Q A;  3JAM S;  1ORY B;  3IHP A;  3Q8G A;  3U6E A;  3PNY A;  2Y2O A;  2WSE F;  4LJ8 A;  4DR2 M;  2OPF A;  2F5S A;  4QOZ C;  4NZ1 A;  3KOX E;  3C3D A;  3AJI B;  3E4R A;  2D7E A;  4NXN M;  1OQY A;  2GNO A;  2LH0 A;  3CTW B;  2KW0 A;  3IG5 A;  4L78 A;  2X8A A;  3DZD A;  3C58 A;  2VII A;  1ZQ9 A;  2V5O A;  3AV0 A;  3SMP A;  1PGY A;  1NJG A;  4P17 A;  1L1Z A;  2R18 A;  3RGS A;  2FOI C;  3J2P B;  2JY5 A;  1OAO C;  1VG5 A;  2BNK A;  2H5X A;  1EE8 A;  2EKK A;  1QO6 A;  4FCV A;  1W1Y A;  4X64 M;  2RTS A;  2JE5 A;  2F4V M;  3SAS A;  2UUA M;  4NRW A;  4HMC A;  4LF6 M;  1TDH A;  2YNM D;  3KP1 E;  1E6P A;  4JI0 M;  2KNV A;  3LQR A;  2RKO A;  2L4E A;  3T6P A;  2DZO B;  3VDU A;  2QQ8 A;  1XNR M;  5DYI A;  3QAU A;  1Q3B A;  1FJG M;  1AUA A;  2LXE A;  4QNM A;  2ERC A;  3MHV C;  5IWA M;  4TX8 A;  1OJL A;  1KSF X;  2X4A A;  2OOB A;  4AI6 A;  3GRU A;  3KVW A;  1N78 A;  4LJ7 A;  4DR1 M;  2JUJ A;  4FVM A;  1GL7 A;  2LTU A;  4KT0 F;  4M9S A;  4JI1 M;  3SAU A;  4B3R M;  2G5G X;  2XD1 A;  1E6Z A;  2LHG A;  3HU2 A;  4PD2 A;  1VDD A;  2R65 A;  4QOS A;  1J09 A;  2ZAN A;  4IBK A;  3R8F A;  4UN2 B;  1QAN A;  2YR0 A;  4CJ6 A;  3SHG B;  2JY7 A;  3AKZ A;  4L16 A;  4WP2 A;  3GPU A;  1AIP C;  2CRU A;  3K9P A;  5H37 D;  3B89 A;  4WUR A;  4ZPX A;  1D0L A;  1NJF A;  2KRK A;  3B7Q A;  3R9X B;  5EJC A;  3VLF B;  1Q3C A;  2QZ4 A;  4AZF A;  2OQ4 A;  2DAI A;  1T3T A;  4I5S A;  2C96 A;  4I81 A;  1E32 A;  2CFO A;  2LBC A;  1QZE A;  4TUW A;  3WD4 A;  4JI5 M;  4M9Z A;  1OFI A;  3WD3 A;  3HJQ A;  2WZJ A;  3B7Z A;  2C5R A;  2C9O A;  5EP4 A;  7CAT A;  2L2D A;  3AL0 C;  3TQS A;  2CV1 A;  2EA0 A;  3BBZ A;  4JI3 M;  2YFQ A;  1N32 M;  2BJV A;  2F5O A;  4LJ9 A;  3JR4 A;  4LGY A;  3UGJ A;  2LHC A;  5GKN A;  4HME A;  3GLH B;  3PFI A;  4LRS A;  1XMO M;  3GPY A;  3RGP A;  1V34 A;  3B74 A;  2VQF M;  4X62 M;  4DV0 M;  4DV3 M;  1A5T A;  3KSX A;  2DXI A;  4FD2 A;  1J5E M;  1TTE A;  2DWN A;  1EFU B;  2QP9 X;  3UMM A;  1GJT A;  4GKK M;  5EXX A;  1D0K A;  1MX0 A;  3C9P A;  3GLI E;  4HEO A;  5JI3 E;  1P3Q Q;  3KXE C;  5JI2 E;  1H0G A;  3E21 A;  3M7P A;  1IM2 A;  3TWK A;  4PCZ A;  2ZAO A;  1GL6 A;  2FH0 A;  1JB0 F;  3DFZ A;  1JR3 A;  2VQE M;  4JXJ A;  3A46 A;  3WD2 A;  3MJ5 A;  1HQC A;  2UXC M;  4NRV A;  1G8P A;  3KSJ A;  1E8B A;  4NZ5 A;  3W68 A;  4R3D A;  1VQ1 A;  4OUI A;  5EXS A;  5ITR A;  2BG1 A;  4AQY M;  3GPX A;  2K9D A;  1K3X A;  4OX9 M;  1UR8 A;  2C98 A;  4OW0 A;  4A3V B;  1YLA A;  1Z59 A;  4REZ A;  3H4M A;  4LJ5 A;  5KPZ A;  3U6L A;  3J7A S;  2UUC M;  3N3F A;  3FRH A;  1NV9 A;  4DV7 M;  2DEN A;  2HAK A;  3GLG B;  3CF0 A;  1N75 A;  1SXJ A;  1H0I A;  3HJS A;  5BR8 M;  4B7H A;  2BJW A;  3HHZ A;  2Q2E B;  3U6P A;  2FFJ A;  2MH8 A;  2W82 A;  3SAW A;  1DV0 A;  3EIH A;  3FD9 A;  2KA6 B;  3FUX A;  4AG5 A;  4NYU A;  1WGN A;  4OJP A;  3ZCB B;  1UFZ A;  4IJF A;  1DGF A;  5FTL A;  1UM8 A;  3FUT A;  2LVA A;  4R7G A;  2CHG A;  4Y28 F;  4Z8X A;  3TE6 A;  4MM3 B;  2UXB M;  2F5N A;  1YSY A;  1IN4 A;  1CK7 A;  5LMU M;  4FCW A;  1Q02 A;  5C1B A;  3GLF A;  4M0D A;  3VFD A;  2QBY B;  4L6V 6;  2DWM A;  2Y2M A;  2CEA A;  2R0I A;  4PDG A;  3FRI A;  2EO2 A;  1QAQ A;  4FWG A;  4LZZ A;  1GO5 A;  3BOS A;  4NC6 A;  4IJE A;  2Y0Q A;  1WXQ A;  1H6U A;  1QYR A;  2Z7J A;  3FUW A;  4DR5 M;  1KFV A;  3TWL A;  3HGI A;  3DA1 A;  2I7N A;  1TF0 B;  3WD0 A;  3TWM A;  4QNR A;  3I04 M;  4LFC M;  1JR3 E;  4GEW A;  1R2Y A;  1VEJ A;  3U6Q A;  3U5Z A;  3CF2 A;  4II7 A;  2Y2Q A;  4DV4 M;  2NQ8 C;  4G4Q A;  1NHW C;  3ZC7 B;  2F5P A;  4LJ4 A;  1S3S A;  3GRY A;  4JI2 M;  1E15 A;  4D82 A;  4LF7 M;  4IIW A;  2Y2K A;  2BWB A;  1TDZ A;  2XF3 A;  2CV2 A;  3J81 S;  2DHR A;  2IOU A;  1DGH B;  3AOE A;  1QUS A;  3KP0 E;  4XK8 F;  5KO3 A;  3SYK A;  5KQ8 A;  1SXJ E;  2DAG A;  3W0L B;  4NY2 A;  1YU1 A;  1ZAE A;  1T6O A;  3WHK A;  3GLI A;  4JI8 M;  1MN3 A;  4MB7 A;  4F1I A;  3T1Y M;  1L2C A;  2CHV A;  2F5Q A;  3KS8 A;  1H8P A;  1PJI A;  1BVS A;  2CP8 A;  1NSF A;  1XWI A;  4G4N A;  2R45 A;  2VF8 A;  1WR1 B;  3A45 A;  3QYE A;  4AG6 A;  1HNZ M;  1JR3 D;  2G8L A;  3D8B A;  4LJ6 A;  2LVN C;  3L26 A;  3FTE A;  4GKJ M;  2EKF A;  3D8L A;  5KPT A;  1CXW A;  3HY5 A;  1OIP A;  2K47 A;  2KNA A;  3AOG A;  3NWL A;  3PVS A;  1IBM M;  4NZ3 A;  3GLG A;  2JCH A;  4LF5 M;  4S12 A;  3U6O A;  3GLF E;  2RGO A;  4IBD A;  3HSH A;  5ITU A;  4DR7 M;  1ZMV A;  3QYB A;  3FE3 A;  4K0K M;  3DOA A;  3TPZ A;  3SAR A;  3IG8 A;  4DR6 M;  4LJA A;  4MH0 E;  4Q7J A;  5EP1 A;  1K3W A;  2ZAM A;  1O6I A;  4Z2J A;  1NY6 A;  1SXJ D;  1PJQ A;  3LQQ A;  3L28 A;  1C1K A;  2Z8Y M;  1Y8G A;  1JQJ C;  2ZBK B;  3FUU A;  1GLN A;  3SHF A;  2H1R A;  1QUT A;  2AHM A;  2VF7 A;  1IXS B;  1OFH A;  1XXH A;  1XC8 A;  4B7G A;  2FFF B;  4B3T M;  1NY5 A;  1W1T A;  4B3S M;  4NL4 H;  3K8Z A;  4YHH M;  2RGH A;  2P5T A;  3VKH A;  1HT2 E;  4Z6Y A;  4IBJ A;  1T43 A;  3HJ8 A;  3UZU A;  3U6C A;  1OGG A;  4LY6 A;  4OVZ B;  5F3W A;  1IQP A;  2XSZ D;  4RKU F;  4MB4 A;  3K9O A;  4IBC A;  4DV6 M;  3NBI A;  2O01 F;  3SYL A;  2XLJ A;  4IBF A;  3KW6 A;  4PDI A;  3RFW A;  3RE8 A;  3KDS E;  2Y2J A;  1E94 E;  2XD5 A;  4NXM M;  2JXN A;  4B08 A;  4MB3 A;  2ZTC A;  1MJG M;  1ZMW A;  3GQ3 A;  1IXZ A;  3LMM A;  4MGK E;  2Y2I A;  4DUY M;  1YU3 A;  3W67 A;  2ZTD A;  1IFY A;  1W1P A;  1OAI A;  4ITQ A;  4Z2K A;  4I8O A;  1TH4 A;  5E6J A;  3HHX A;  4L8R C;  1UR9 A;  2V1C A;  2D7G A;  3NBX X;  2K0B X;  2CV0 A;  3L27 A;  4FWD A;  2HL7 A;  4BLC A;  4CIZ A;  3KOZ E;  1KYI A;  1IN6 A;  1HQY E;  5EXP A;  3GLG E;  1YU2 A;  1R2Z A;  4AW4 A;  1GKI A;  4LG2 A;  2DAK A;  2Y2L A;  1IN8 A;  4LF9 M;  2C9C A;  5IZ7 D;  2R62 A;  4RF0 A;  3HX3 A;  1HT1 E;  2HCB A;  1I94 M;  1GXD A;  4P16 A;  1WIV A;  3PXG A;  2Z3X A;  3U61 B;  1W1V A;  2Y2P A;  1KS0 A;  5DYG A;  2C99 A;  3LCV B;  3GPP A;  4RF1 A;  1GAB A;  2DVW B;  2DZL A;  1J7M A;  4GMQ A;  3FKE A;  5LMN M;  2Y0T A;  4GIP A;  1XXH E;  4CGY B;  3K2L A;  4LFB M;  1YU4 A;  4FCT A;  1NVM A;  1V33 A;  1EAK A;  4OJ5 A;  3SAT A;  3HWS A;  4X65 M;  2MJ5 B;  5FTM A;  3U6D A;  4QNL A;  3FTD A;  2DAM A;  5A2Q S;  2XEP A;  4KOD A;  1WGL A;  2Y2G A;  4DBG B;  2VDB B;  4G6Z A;  5EP2 A;  2L09 A;  1HJP A;  3OTO M;  1DGG A;  1YE9 A;  4HL4 A;  2XSZ A;  3SMS A;  5ITT A;  3GQ4 A;  4GHL A;  5FTN A;  8CAT A;  4AKI A;  5C18 A;  1WJ7 A;  4LZJ A;  4R71 A;  1IXS A;  2KXE A;  4OJL A;  2R4J A;  4FW9 A;  4NZ4 A;  1N33 M;  4G3O A;  1OGB A;  3F92 A;  3B7N A;  5ITX E;  1IBK M;  1SXJ C;  1IY2 A;  1PJT A;  2A5Y B;  2L7I A;  2DZN B;  4JI7 M;  2XH9 A;  3LVW A;  4OVZ A;  3J7B A;  5FSW A;  4Z2I A;  2OOA A;  3HON A;  1VDL A;  2V1U A;  3GLH A;  1QQW A;  4DUZ M;  3K1J A;  3T15 A;  1G3I A;  3L2A A;  4NSR A;  1SG9 A;  1QDT A;  2JWS A;  4PT5 A;  5IT9 S;  4HLQ A;  2DWL A;  4GRI A;  1L2B A;  3SBJ A;  4GHA A;  3J80 S;  4DV1 M;  1D0M A;  1TR8 A;  1E6N A;  5EP3 A;  4GC5 A;  3U60 B;  5ITQ A;  1DGB A;  1TH3 A;  2APL A;  3MQL A;  2Y20 A;  1R4G A;  2BWE A;  1VEK A;  3SC3 A;  1YUB A;  3T1H M;  3WD1 A;  3GQ5 A;  1QVR A;  2EJS A;  2LVO C;  2WSF F;  2Y21 A;  3JR5 A;  1E6R A;  2EUC A;  2R44 A;  4WW0 A;  3WHL A;  1XNQ M;  5EXT A;  4G4R A;  4Z2L A;  2HHH M;  2R6F A;  3MK6 A;  3ILK A;  1HNW M;  1QAM A;  2I7P A;  2E5L M;  3WX7 A;  3I01 M;  2KEB A;  3KOY E;  3T38 A;  3I4V A;  2KRU A;  2MRO B;  2FE8 A;  3VK7 A;  1L2D A;  2DWZ B;  2JA2 A;  4KO8 A;  4IBE A;  2KZU A;  2O5R A;  1OIZ A;  3U61 A;  4D80 A;  2XFS A;  2MR9 A;  4MGZ E;  4QHS A;  2M5Z A;  3EIE A;  3GO8 A;  1N36 M;  5FTJ A;  3U6M A;  2JNH A;  2UWX A;  2R4E A;  1PJJ A;  3FTF A;  3H4J A;  2JY6 B;  2JY8 A;  1E9R A;  2HWJ A;  4GIT A;  3HHY A;  3ZQJ A;  2QCU A;  1NO1 A;  1IXR C;  2FN2 A;  4MGI E;  3SAV A;  2QHO B;  3AOE C;  2M60 A;  4L4U A;  4LF8 M;  1PRB A;  2LVP C;  2UUB M;  1IN5 A;  4W5W A;  4KHP M;  1L6J A;  4CHT B;  1L8Q A;  1NHG C;  2L7H A;  1Z5A A;  4KLN A;  3TL4 X;  1AIW A;  3GLH E;  4IBB A;  1LV7 A;  4RNA A;  4NSO B;  1WHC A;  4BB9 A;  2QBY A;  2CUZ A;  2J7N A;  1SXJ B;  1J7K A;  4DR3 M;  2N35 A;  2DNA A;  1G59 A;  3FYC A;  4GC9 A;  2XZU A;  4BBA A;  1MU5 A;  1DO2 A;  3KOW E;  1LTM A;  1I4W A;  2WSC F;  4I4L A;  2Y2H A;  4HMD A;  3KS4 A;  3K92 A;  2UXD M;  1E9S A;  3J27 B;  2ZM6 M;  3GRR A;  1N77 A;  3E46 A;  4AKG A;  2Z4S A;  4LF4 M;  4DV5 M;  2QSF X;  1G71 A;  2OO9 A;  4CIS A;  1XHB A;  2DAE A;  2FNA A;  2GQF A;  4IBG A;  5L8R F;  1GPF A;  4Z2H A;  4OU7 A;  1QZM A;  1W5S A;  1L1T A;  3GRV A;  4ANR A;  4YY3 M;  4JI4 M;  2X49 A;  3GLF B;  5ITX A;  2R46 A;  1R7R A;  2V6Z M;  4B7F A;  1R6B X;  2KHH A;  2LNH C;  3GP1 A;  1OTR A;  2FS1 A;  5DFL A;  3V76 A;  1C7Y A;  3U60 A;  3M0E A;  1ZV1 A; 
#chains in the Genus database with same CATH homology
 1YUE A;  1G41 A;  2QEN A;  4X66 M;  3HU1 A;  3KFU G;  1TGU A;  1Z5B A;  1FNN A;  1DGH A;  3FUV A;  4JI6 M;  3A98 B;  1IN7 A;  4NOO B;  3LVV A;  2CHQ A;  3VK8 A;  3UJN A;  1YU0 A;  2XFT A;  3M7G A;  3U5Z B;  3M6A A;  4JV5 M;  2CE7 A;  2XZF A;  4NYY A;  1IY0 A;  2QPA A;  2LWX A;  2YQZ A;  4D81 A;  1GVN A;  4OJ6 A;  3U6S A;  3E9S A;  5E26 A;  3HKP A;  4QHT A;  4LCB A;  2UU9 M;  2Y2N A;  1QAO A;  3I4Y A;  1K82 A;  1X37 A;  4GH9 A;  4XGI A;  1XMQ M;  3W0F A;  3VDP A;  3HU3 A;  3L29 A;  3GLI B;  4DR4 M;  3A42 A;  5KQD A;  2HKJ A;  4OJO A;  4LGM A;  4EIW A;  2XGN A;  4L15 A;  4M0W A;  4AKH A;  3L25 A;  1Z6T A;  4JN6 A;  3HHW A;  5ITY A;  5DNY A;  4LRT A;  2L6O A;  4MGY E;  4XBO A;  1NNJ A;  3I51 A;  4JYA M;  2J7O A;  1HR0 M;  1PM5 A;  2KZS A;  5IRE B;  3SFZ A;  1DO0 A;  1G4A E;  1TH2 A;  1Z5C A;  5BPV A;  4IBI A;  3QWL A;  5FLX S;  1N34 M;  1HNX M;  3VKG A;  3AFH A;  3FTC A;  3B9P A;  3FYD A;  4M9X A;  3Q8X A;  2D7H A;  1NNU C;  4MGH A;  2Z4R A;  1Q39 A;  5EQT A;  5FTK A;  4LFA M;  1W5T A;  1XXH B;  4FWH A;  3THG A;  4DV2 M;  3UK6 A;  3CF6 E;  4B3M M;  1IY1 A;  4G4O A;  1D2N A;  1IBL M;  3PNV A;  3ZH9 B;  5KPR A;  3JAM S;  1ORY B;  3U6E A;  3PNY A;  2Y2O A;  4LJ8 A;  4DR2 M;  2OPF A;  2F5S A;  4QOZ C;  4NZ1 A;  3KOX E;  3E4R A;  3AJI B;  4NXN M;  2D7E A;  2LH0 A;  3CTW B;  2KW0 A;  3IG5 A;  4L78 A;  2X8A A;  3DZD A;  3C58 A;  2VII A;  1ZQ9 A;  3AV0 A;  3SMP A;  1NJG A;  1L1Z A;  2R18 A;  3RGS A;  2FOI C;  3J2P B;  2BNK A;  1EE8 A;  4FCV A;  4X64 M;  2JE5 A;  2F4V M;  3SAS A;  2UUA M;  4NRW A;  4LF6 M;  1TDH A;  2YNM D;  3KP1 E;  4JI0 M;  3LQR A;  3VDU A;  2RKO A;  2DZO B;  1XNR M;  5DYI A;  3QAU A;  1Q3B A;  1FJG M;  2LXE A;  4QNM A;  2ERC A;  3MHV C;  5IWA M;  1OJL A;  1KSF X;  2X4A A;  4AI6 A;  3GRU A;  3KVW A;  1N78 A;  4LJ7 A;  4DR1 M;  4FVM A;  1GL7 A;  4JI1 M;  4M9S A;  3SAU A;  4B3R M;  2G5G X;  2XD1 A;  3HU2 A;  4PD2 A;  1VDD A;  2R65 A;  4QOS A;  1J09 A;  2ZAN A;  4IBK A;  3R8F A;  1QAN A;  2YR0 A;  3SHG B;  3AKZ A;  4L16 A;  3GPU A;  5H37 D;  3J81 S;  4WUR A;  4ZPX A;  1NJF A;  2KRK A;  3R9X B;  5EJC A;  3VLF B;  1Q3C A;  2QZ4 A;  4AZF A;  2OQ4 A;  4I5S A;  1T3T A;  2C96 A;  4I81 A;  1E32 A;  2CFO A;  4TUW A;  4JI5 M;  4M9Z A;  1OFI A;  3HJQ A;  2C5R A;  2C9O A;  5EP4 A;  7CAT A;  3AL0 C;  3TQS A;  2CV1 A;  2EA0 A;  4JI3 M;  2YFQ A;  1N32 M;  2BJV A;  2F5O A;  4LJ9 A;  3JR4 A;  4LGY A;  3UGJ A;  5GKN A;  3GLH B;  3PFI A;  4LRS A;  1XMO M;  3GPY A;  3RGP A;  2VQF M;  4DV0 M;  4X62 M;  4DV3 M;  3KSX A;  2DXI A;  4FD2 A;  1J5E M;  2DWN A;  2QP9 X;  3UMM A;  4GKK M;  5EXX A;  1MX0 A;  5JI3 E;  3KXE C;  5JI2 E;  1IM2 A;  3TWK A;  4PCZ A;  2ZAO A;  1GL6 A;  3DFZ A;  1JR3 A;  2VQE M;  4JXJ A;  3A46 A;  3MJ5 A;  1HQC A;  2UXC M;  4NRV A;  1G8P A;  3KSJ A;  4NZ5 A;  4R3D A;  4OUI A;  5EXS A;  5ITR A;  2BG1 A;  4AQY M;  3GPX A;  1K3X A;  4OX9 M;  2C98 A;  4OW0 A;  4A3V B;  4REZ A;  1Z59 A;  3U6L A;  3H4M A;  4LJ5 A;  5KPZ A;  3J7A S;  2UUC M;  3N3F A;  4DV7 M;  3GLG B;  3CF0 A;  1N75 A;  1SXJ A;  3HJS A;  5BR8 M;  4B7H A;  2BJW A;  3HHZ A;  2Q2E B;  3U6P A;  2FFJ A;  3SAW A;  2W82 A;  3EIH A;  3FD9 A;  2KA6 B;  3FUX A;  4AG5 A;  4NYU A;  4OJP A;  3ZCB B;  4IJF A;  1DGF A;  5FTL A;  1UM8 A;  3FUT A;  4R7G A;  4Z8X A;  2CHG A;  3TE6 A;  2UXB M;  4MM3 B;  2F5N A;  1YSY A;  1IN4 A;  5LMU M;  4FCW A;  5C1B A;  3GLF A;  4M0D A;  3VFD A;  2QBY B;  2DWM A;  2Y2M A;  2CEA A;  4PDG A;  2EO2 A;  1QAQ A;  4FWG A;  4LZZ A;  3BOS A;  4IJE A;  2Y0Q A;  1WXQ A;  1H6U A;  1QYR A;  2Z7J A;  3FUW A;  4DR5 M;  1KFV A;  3TWL A;  3HGI A;  3DA1 A;  2I7N A;  3TWM A;  4QNR A;  4LFC M;  1R2Y A;  3U6Q A;  3U5Z A;  3CF2 A;  4II7 A;  2Y2Q A;  4DV4 M;  2NQ8 C;  4G4Q A;  1NHW C;  3ZC7 B;  2F5P A;  4LJ4 A;  1S3S A;  3GRY A;  4JI2 M;  4D82 A;  4LF7 M;  4IIW A;  2Y2K A;  1TDZ A;  2XF3 A;  2CV2 A;  2DHR A;  2IOU A;  1DGH B;  3AOE A;  3KP0 E;  5KO3 A;  3SYK A;  5KQ8 A;  1SXJ E;  3W0L B;  4NY2 A;  1YU1 A;  1ZAE A;  3WHK A;  3GLI A;  4JI8 M;  4MB7 A;  3T1Y M;  1L2C A;  2F5Q A;  2CHV A;  3KS8 A;  1PJI A;  1NSF A;  1XWI A;  4G4N A;  2R45 A;  1HNZ M;  4AG6 A;  3A45 A;  1JR3 D;  2G8L A;  3D8B A;  4LJ6 A;  3L26 A;  3FTE A;  4GKJ M;  3D8L A;  5KPT A;  2K47 A;  3PVS A;  3AOG A;  3NWL A;  4NZ3 A;  1IBM M;  3GLG A;  2JCH A;  4LF5 M;  4S12 A;  3U6O A;  2RGO A;  4IBD A;  3HSH A;  5ITU A;  4DR7 M;  4K0K M;  3DOA A;  3TPZ A;  3SAR A;  3IG8 A;  4DR6 M;  4LJA A;  4MH0 E;  5EP1 A;  1K3W A;  2ZAM A;  1NY6 A;  1SXJ D;  3LQQ A;  3L28 A;  1C1K A;  2ZBK B;  1JQJ C;  3FUU A;  1GLN A;  3SHF A;  2H1R A;  2AHM A;  1IXS B;  1OFH A;  1XXH A;  1XC8 A;  4B7G A;  2FFF B;  4B3T M;  1NY5 A;  4B3S M;  4NL4 H;  3K8Z A;  4YHH M;  2RGH A;  2P5T A;  3VKH A;  1HT2 E;  4Z6Y A;  4IBJ A;  3HJ8 A;  3UZU A;  3U6C A;  4LY6 A;  4OVZ B;  5F3W A;  1IQP A;  2XSZ D;  4IBC A;  4DV6 M;  3NBI A;  3SYL A;  2XLJ A;  4IBF A;  3KW6 A;  4PDI A;  3RFW A;  3RE8 A;  3KDS E;  2Y2J A;  1E94 E;  2XD5 A;  4NXM M;  4B08 A;  3GQ3 A;  1IXZ A;  3LMM A;  4MGK E;  2Y2I A;  4DUY M;  1YU3 A;  4ITQ A;  4I8O A;  1TH4 A;  5E6J A;  3HHX A;  2V1C A;  2D7G A;  2CV0 A;  3L27 A;  4FWD A;  2HL7 A;  4BLC A;  3KOZ E;  1KYI A;  1IN6 A;  1HQY E;  5EXP A;  1R2Z A;  4AW4 A;  1GKI A;  4LG2 A;  2Y2L A;  1IN8 A;  4LF9 M;  2C9C A;  5IZ7 D;  2R62 A;  4RF0 A;  1HT1 E;  2HCB A;  1I94 M;  4P16 A;  3PXG A;  2Z3X A;  3U61 B;  2Y2P A;  5DYG A;  2C99 A;  3GPP A;  4RF1 A;  2DVW B;  4GMQ A;  3FKE A;  5LMN M;  2Y0T A;  4GIP A;  4CGY B;  3K2L A;  4LFB M;  1YU4 A;  4FCT A;  1NVM A;  4OJ5 A;  3SAT A;  3HWS A;  4X65 M;  5FTM A;  3U6D A;  4QNL A;  3FTD A;  5A2Q S;  2XEP A;  4KOD A;  2Y2G A;  4G6Z A;  5EP2 A;  2DWL A;  2L09 A;  3OTO M;  1DGG A;  1YE9 A;  4HL4 A;  2XSZ A;  3SMS A;  5ITT A;  3GQ4 A;  4GHL A;  5FTN A;  8CAT A;  4AKI A;  5C18 A;  4LZJ A;  2KXE A;  4OJL A;  2R4J A;  4FW9 A;  4NZ4 A;  1N33 M;  5ITX E;  1IBK M;  1SXJ C;  1IY2 A;  2A5Y B;  2L7I A;  2DZN B;  4JI7 M;  2XH9 A;  3LVW A;  4OVZ A;  3J7B A;  5FSW A;  3HON A;  2V1U A;  3GLH A;  1QQW A;  4DUZ M;  3K1J A;  3T15 A;  1G3I A;  3L2A A;  4NSR A;  5IT9 S;  4PT5 A;  4HLQ A;  4GRI A;  1L2B A;  3SBJ A;  4GHA A;  3J80 S;  4DV1 M;  5EP3 A;  4GC5 A;  3U60 B;  5ITQ A;  1DGB A;  1TH3 A;  2Y20 A;  3SC3 A;  1YUB A;  3T1H M;  3GQ5 A;  1QVR A;  2Y21 A;  3JR5 A;  2EUC A;  4WW0 A;  3WHL A;  1XNQ M;  5EXT A;  4G4R A;  2HHH M;  3MK6 A;  1HNW M;  3ILK A;  3WX7 A;  1QAM A;  2I7P A;  2E5L M;  2KEB A;  3KOY E;  3T38 A;  3I4V A;  2KRU A;  4L8R C;  2FE8 A;  3VK7 A;  1L2D A;  2DWZ B;  2JA2 A;  4KO8 A;  4IBE A;  2KZU A;  2O5R A;  3U61 A;  4D80 A;  2XFS A;  4MGZ E;  4QHS A;  2M5Z A;  3EIE A;  3GO8 A;  1N36 M;  5FTJ A;  3U6M A;  2UWX A;  2R4E A;  1PJJ A;  3FTF A;  1E9R A;  4GIT A;  3HHY A;  2QCU A;  1IXR C;  4MGI E;  3SAV A;  3AOE C;  4L4U A;  2M60 A;  4LF8 M;  2UUB M;  1IN5 A;  4W5W A;  4KHP M;  4CHT B;  1L8Q A;  1NHG C;  2L7H A;  1Z5A A;  4KLN A;  3TL4 X;  4IBB A;  1LV7 A;  4RNA A;  4NSO B;  4BB9 A;  2QBY A;  2CUZ A;  2J7N A;  1SXJ B;  1J7K A;  4DR3 M;  1G59 A;  3FYC A;  4GC9 A;  2XZU A;  4BBA A;  1MU5 A;  1DO2 A;  3KOW E;  1I4W A;  4I4L A;  2Y2H A;  3KS4 A;  3K92 A;  2UXD M;  1E9S A;  3J27 B;  2ZM6 M;  3GRR A;  1N77 A;  4AKG A;  2Z4S A;  4LF4 M;  4DV5 M;  4CIS A;  1XHB A;  2FNA A;  4IBG A;  4OU7 A;  1QZM A;  1W5S A;  1L1T A;  3GRV A;  4YY3 M;  4JI4 M;  2X49 A;  3GLF B;  5ITX A;  2R46 A;  1R7R A;  2V6Z M;  4B7F A;  1R6B X;  2LNH C;  3GP1 A;  1YU2 A;  3U60 A;  3M0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...