4IBDA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibdA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibdA02
4IBGA 4GHAA 4IBJA 4IBIA 3KS4A 4IBCA 4IJFA 3L29A 4IBFA 4IBBA 3L26A 4GHLA 4IBEA 3L2AA 4LG2A 4IJEA 3L28A 4IBDA 3KS8A 3FKEA 4IBKA 5BPVA 3L25A 4GH9A 3L27A
chains in the Genus database with same CATH superfamily
4IIWA 1CUKA 1L6JA 2ZANA 3GLIB 3H4MA 3KOWE 3W68A 3FE3A 1QYRA 3E46A 1TF0B 4DR7M 1XXHE 4R71A 4YHHM 1EAKA 4Z2IA 4LJ7A 3W67A 3GLHB 4DV5M 3U5ZB 4B3TM 3K1JA 1NY6A 1D0MA 2X8AA 4IJFA 2EUCA 2AHMA 2WSCF 1YU1A 1HNZM 4LF4M 4X66M 2RRUA 2MROB 1R5LA 1Q3CA 4GKKM 1GKIA 1P3QQ 4MGYE 2UXBM 1K82A 2UXDM 4HMEA 1E9SA 1W1PA 2X49A 3WHKA 2KXEA 3AV0A 3HU3A 3WD2A 2F5NA 3LQQA 4DUZM 1NSFA 2HCBA 2QQ8A 4B08A 5KO3A 1IBLM 2YQZA 4EIWA 4L16A 4MGIE 1PJJA 5LMNM 4B7GA 1NV9A 4LGMA 2LVAA 2Y2PA 2CHQA 2C5RA 2UUBM 3LMMA 4KO8A 1W1TA 4Z2HA 2DKLA 4IBCA 2UWXA 1L2DA 1W1VA 1QQWA 3QAUA 1D0LA 2DAKA 2K9DA 2L7IA 3FUWA 4IBEA 1E6PA 1JR3D 2EO2A 4PCZA 1IBMM 3UK6A 2C9CA 3WHLA 1YSYA 2HKJA 3ZCBB 4MB7A 3RGPA 1TH4A 3T1HM 1CK7A 1YU0A 1IN5A 1IY2A 2JY5A 3LCVB 2OQ4A 5KQ8A 4LF5M 3FTFA 1YU3A 2UU9M 2R0IA 2QNJA 4ITQA 2L4EA 3GO8A 3L25A 2UUCM 1NHWC 2BJWA 2CE7A 3GQ5A 3WD1A 5FTJA 1QO6A 1UM8A 4LFCM 2D7HA 3SYKA 2EA0A 1XNRM 4NZ1A 5C1BA 3BBZA 3IECA 1BVSA 2GNOA 2X4AA 1XXHA 4IBBA 1MJGM 5EP3A 2JCHA 2I7PA 2ZBKB 3BOSA 2YNMD 4NSRA 1IXSA 1NHGC 3B7ZA 1GVNA 2XGNA 3HHWA 3RFWA 2LBCA 2B3TA 3GRRA 3HJ8A 1N75A 2LHCA 3A46A 2KRUA 2ZM6M 2WZJA 3SASA 4GC5A 1HNWM 2P5TA 3GRVA 4DV0M 1AUAA 3GLFE 4WP2A 4G4OA 1G59A 1VG5A 2KZSA 3J7AS 4LCBA 1LV7A 2R18A 1K3WA 4TX8A 4NYYA 5BPVA 2QENA 4M0WA 1WGLA 2LXEA 1R7RA 2BJVA 3I51A 4FW9A 1GOIA 3HHZA 2DZNB 2XFSA 1GO5A 2IOUA 4DR1M 1Z5BA 2VQFM 3U6QA 1IXZA 5ITQA 2Q2EB 3VLFB 2VQEM 2QBYA 2F5PA 1V92A 4WURA 4OJPA 4OJOA 1E6ZA 1D0KA 4NC6A 2ZTDA 3AOEA 2KW0A 3LW5F 1YUEA 2DENA 3HX3A 4QOZC 4DR5M 1KYIA 1OAOC 2C99A 4B3MM 1JB0F 3GQ4A 4OJ6A 5F3WA 1QAQA 4Z2GA 5H37D 3LVVA 4DV6M 3QYBA 4Y28F 2LH0A 2DAMA 4L6V6 2R46A 2VDBB 3VK8A 1VDLA 4LZJA 2HWJA 4DR4M 3KOXE 2XLJA 3U60A 2QCUA 1G8PA 2RTSA 5IZ7D 3K2LA 2JY7A 4PDIA 4JI4M 4LZZA 1HR0M 1H8PA 5EJCA 1F4IA 1Z59A 1PM5A 1A5TA 4MB5A 2ZAOA 1HT1E 2Z3XA 4LFBM 2FN2A 1JR3E 2V6ZM 3KDSE 1IN7A 2Y0TA 1CXWA 2DWZB 3I04M 2FE8A 2JP7A 2XSZA 3FUXA 4JXJA 2G5GX 1L2BA 1I94M 1OFHA 1W1YA 1T3TA 5KPRA 5FTLA 2L09A 2Z7JA 2CP8A 2DZOB 2LHGA 3HU1A 1NO1A 2XF3A 3KXEC 1I4WA 1ZMUA 3C58A 3CTWB 4K0KM 4IJEA 3WD3A 3J7BA 1DO2A 1R2ZA 4AI6A 2KNZA 3M6AA 1E9RA 4KT0F 4AG5A 1TH2A 3KSJA 1IXRC 2Y2KA 1JQJC 4BLCA 1OFIA 2JWSA 3U6EA 3MQLA 3WD0A 3C3EA 4GH9A 4IBGA 3GQ3A 1DGHB 4XBOA 1O6IA 4MB3A 1PRBA 2R4EA 1WHCA 2DHRA 2Z4RA 3K9OA 4IBIA 4DV1M 1G41A 4I8OA 3IHPA 2F5SA 2F5QA 4MGKE 1ZAEA 3FUVA 4IBFA 4TUWA 4NXNM 5JI3E 2CHVA 1XXHB 2N35A 1G4AE 4OVZA 2Y0QA 3GLGE 1OIZA 2JZ0A 4ANRA 1YU4A 4DV4M 1IXSB 1XMOM 4DBGB 3KVWA 5ITUA 3QYEA 4JI1M 1GJSA 4GKJM 4YY3M 2E5LM 5EXTA 4Z2JA 2MH8A 4MGHA 2KDLA 4LJ9A 3GLIE 3TWKA 2F4VM 4NZ3A 1L1TA 3U6DA 1PJIA 1WIVA 4LRSA 3SAUA 1XWIA 4X64M 1KSFX 1SXJA 4I5SA 1VDDA 1Y8GA 5A2QS 1OGBA 1PGYA 3GLHE 4A3VB 2OOAA 4R7GA 3PNYA 3Q8XA 5IWAM 3MJ5A 4Z8XA 1R6BX 4NRVA 4GHAA 1NVMA 4CISA 1J7MA 2R44A 3KOZE 5ITRA 3DFZA 4LF6M 1TTEA 4JI6M 1DV0A 2KZUA 1RU3A 3HJSA 2KRKA 3I01M 5EP2A 1W5TA 1JR3A 4DR3M 3KW6A 1IN8A 3T15A 2Y2GA 4GRIA 4Z2KA 3KOYE 3T1YM 1UR8A 2XZFA 1IM2A 2Y2QA 2DI0A 4M0DA 1IN6A 1L8QA 1QAOA 3W0FA 2UXCM 2QZ4A 2JA2A 4OW0A 5L8RF 2O5RA 4AKIA 3F92A 3U60B 4R3DA 2R6FA 2HHHM 1VEJA 4X65M 4D81A 3M7PA 4Z2LA 4FD2A 1XB2B 4NZ4A 3DA1A 1L1ZA 2CV2A 2C98A 4LJ5A 1WR1B 1UFZA 3D8LA 2OPFA 2F5OA 3U6PA 4AZFA 1N33M 4PT5A 3PXGA 3R9XB 3HHXA 3E21A 2K6BA 1SXJC 3E9SA 4JN6A 1DGFA 2EKKA 4X62M 3A42A 2APLA 3QWLA 1OIPA 2H1RA 3AFHA 4L4UA 2FFJA 2JZ1A 5EP4A 1KFVA 3SATA 3FTDA 3NBIA 3GLGA 3THGA 3VDUA 4B7HA 4GC9A 4MM3B 4HLQA 4OJLA 2MJ5B 2LVQD 4IBDA 2RGHA 3FKEA 1ZV1A 1OJLA 5EP1A 1C1KA 3WX7A 2LWXA 3R8FA 3L27A 4MB4A 5IREB 1MN3A 3GP1A 1VQ1A 4FWDA 3VKHA 1Z5CA 2JY8A 3BXWA 1NNJA 7CATA 4D82A 3GLHA 4QNLA 2JXNA 1N78A 5EXXA 1QDTA 2Z8YM 4I81A 5LMUM 1J5EM 4JI7M 3SC3A 2OO9A 2J7OA 3A45A 3TL4X 1PJQA 1V34A 1ZMVA 2WSFF 1IN4A 2CRUA 3B7NA 4QNMA 4NYUA 1J09A 4QHTA 4F2LA 4OVZB 3GPXA 3N3FA 1NV8A 1MU5A 2L4FA 3ZH9B 2G3QA 4G6ZA 1OTRA 4QNRA 4OX9M 5KPTA 2CV1A 4DR2M 1XC8A 2Y2IA 4BB9A 3AL0C 1H0GA 4NOOB 2VF8A 3VDPA 3VKGA 3HU2A 4MH0E 3FYDA 4RF0A 3U61A 3FTCA 2BG1A 4CGYB 3TPZA 2XFTA 4NZ5A 4FCVA 3HKPA 4G4NA 1MX0A 4LY6A 3FD9A 4LGYA 3SMPA 3SBJA 2DNAA 4RF1A 1QUTA 1SXJB 4LF7M 1R2YA 1QZMA 5KQDA 4P17A 1IBKM 1GL7A 1EIJA 2CFOA 4ZPXA 1ORYB 1DGGA 3CF0A 2UUAM 3LCUA 1H0IA 3JR5A 2O01F 4G4RA 1GXDA 3LQRA 4HMDA 2G8LA 4HL4A 1QZEA 1W5SA 3UMMA 2CEAA 4Q7JA 1HT2E 1L2CA 4JI2M 4B3RM 2NQ8C 1G71A 1NJFA 1YE9A 2DVWB 2K47A 1GABA 1EE8A 5DYIA 5GKNA 1H6UA 4HEOA 4GEWA 2J7NA 1ZMWA 3GRUA 4LG2A 4LFAM 4L8RC 1IFYA 3L28A 4JYAM 3GPUA 4AQYM 2R45A 5FSWA 1IQPA 1SG9A 4XGIA 4II7A 4CIZA 2ZTCA 4REZA 4NRWA 2KA6B 3HY5A 2DAEA 3AOEC 3GLFA 1OAIA 4JI0M 3T38A 2Y2LA 3V76A 1T43A 2LVOC 4QOSA 2DHYA 4AW4A 3U6SA 4CJ6A 1T6OA 3U6MA 1V33A 2QP9X 4OUIA 2XSZD 1J7KA 1VEKA 1HJPA 5E6JA 4AKHA 1GJTA 2JUJA 1QVRA 1WJ7A 4LJ4A 4GITA 1E6RA 4LJAA 1TDZA 1NJGA 2XZUA 2Y21A 3J27B 2MR9A 1TR8A 1YLAA 2JE5A 5FLXS 1XNQM 4JI5M 3HONA 2RKOA 1FNNA 3SMSA 2QHOB 3KP0E 3HWSA 4FCWA 3DOAA 1GL6A 3GPPA 4CHTB 2XEPA 8CATA 3T6PA 1Q39A 1YUBA 1E8BA 2DAIA 1GPFA 3B74A 2GQFA 3KFUG 3TWMA 2DWLA 3AKZA 3J80S 2BWEA 3MHVC 3SHFA 5ITYA 2R65A 2EKFA 3CGWA 1E32A 3J81S 4HMCA 1D2NA 5FTKA 3FTEA 2R62A 3ZQJA 5DYGA 4DV2M 2Y2HA 3PNVA 2Y20A 3AJIB 3L29A 4PD2A 1TGUA 3L26A 2QBYB 4S12A 1E94E 4LJ8A 4LF9M 3U6LA 3ILKA 3L2AA 4GHLA 2A5YB 3MK6A 4FWHA 5JI2E 3HSHA 3WD4A 3D8BA 1Z6TA 2W82A 3Q8GA 3B89A 3GRYA 4JV5M 2DWNA 3LVWA 3TQSA 1KS0A 4L15A 2EJSA 3U61B 2JY6B 3VFDA 3FYCA 2LTUA 4FCTA 2HAKA 3AOGA 3M0EA 3U6CA 4IBKA 2DXIA 4RKUF 1SXJD 2O25A 2Z4SA 3C3DA 1QUSA 3EIEA 3TE6A 1YU2A 4BBAA 1XHBA 2C9OA 1QANA 4M9ZA 5ITXE 4LF8M 4FVMA 3B7QA 2V5OA 3ZC7B 5BR8M 3I4YA 4B7FA 2DWMA 1QAMA 1R4GA 2RGOA 2DZLA 3FRHA 3NWLA 3IG8A 4UN2B 4GIPA 2Y2JA 3SFZA 1NNUC 1WGNA 2LNHC 2WSEF 4DV7M 3K92A 4Z6YA 5DFLA 1PJSA 4LJ6A 2R4JA 2XD1A 3A98B 2D7EA 2QSFX 3B9PA 1EFUB 2LVNC 3EIHA 3FRIA 4D80A 5IT9S 1GLNA 3K8ZA 1E6NA 3KP1E 2ZAMA 5EQTA 2JNHA 1TDHA 3HZJA 1N77A 3CF6E 1DGHA 2V1CA 5FTMA 5KPZA 3SARA 3GLFB 3GLIA 4NY2A 2M60A 2QPAA 3JR4A 4QHSA 4LRTA 2FH0A 3HHYA 4M9XA 3UGJA 2LVPC 2V1UA 3SYLA 3U5ZA 1E88A 3HGIA 3U6OA 3RE8A 4KHPM 1TH3A 2D7GA 2HL7A 3C9PA 3PFIA 4F1IA 4AKGA 2XD5A 1Q02A 3H4JA 1VEGA 4KLNA 4AG6A 3W0LB 2L7HA 3TWLA 4OJ5A 1DGBA 3HJQA 5C18A 2M5ZA 1NY5A 4XK8F 2Y2OA 4MGZE 3RGSA 3IG5A 3VK7A 3JAMS 4PDGA 1UR9A 2FOIC 2OOBA 4DR6M 1LTMA 3K9PA 4G3OA 1ED7A 1OGGA 2ERCA 1QDRA 3E4RA 1AIWA 2DAGA 3CF2A 4JI3M 3KSXA 4WW0A 3SHGB 2C96A 4NL4H 4IBJA 2KHHA 4RNAA 4OU7A 5ITXA 5EXPA 1HNXM 1DO0A 2BNKA 1XMQM 1Z5AA 2H5XA 4I4LA 1N32M 1HQCA 4FWGA 4GMQA 5FTNA 1PDCA 1HQYE 2J5YA 2XH9A 1K3XA 2K0BX 4B3SM 2KEBA 1X37A 1SXJE 3M7GA 2CWBA 1S3SA 3FUUA 2I7NA 3KS8A 3DZDA 4DUYM 1N36M 5ITTA 3NBXX 3UJNA 1Q3BA 1ZQ9A 1FJGM 4M9SA 3OTOM 1E15A 2L6OA 4NSOB 1IY0A 2CUZA 1IY1A 2KNAA 1WXQA 2FNAA 4NXMM 3KS4A 4KODA 2YR0A 2BWBA 2MGWA 2KNVA 1AIPC 3SAVA 4P16A 3UZUA 2CV0A 5EXSA 5E26A 2D49A 1OQYA 2Y2NA 2L2DA 3I4VA 1PJTA 3PVSA 2VF7A 4L78A 1N34M 5DNYA 2Y2MA 4JI8M 1OKSA 4W5WA 2FS1A 3GLGB 2YFQA 3FUTA 1C7YA 3SAWA 2VIIA 3J2PB 2CHGA 3GPYA 4G4QA 3MMPA 4DV3M 2FFFB 1G3IA
chains in the Genus database with same CATH topology
4IIWA 2ZANA 3GLIB 3H4MA 3KOWE 1QYRA 4DR7M 4YHHM 4LJ7A 3GLHB 4DV5M 3U5ZB 4B3TM 3K1JA 1NY6A 4IJFA 2X8AA 2EUCA 2AHMA 1YU1A 1HNZM 4LF4M 4X66M 1Q3CA 4GKKM 1GKIA 4MGYE 2UXDM 2UXBM 1K82A 1E9SA 2X49A 3WHKA 2KXEA 3AV0A 3HU3A 2F5NA 3LQQA 4DUZM 1NSFA 2HCBA 4B08A 5KO3A 1IBLM 2YQZA 4EIWA 4L16A 4MGIE 1PJJA 5LMNM 4B7GA 4LGMA 2Y2PA 2CHQA 2C5RA 2UUBM 3LMMA 4KO8A 4IBCA 2UWXA 1L2DA 1QQWA 3QAUA 3FUWA 2L7IA 4IBEA 1JR3D 2EO2A 4PCZA 1IBMM 3UK6A 2C9CA 3WHLA 1YSYA 2HKJA 3ZCBB 4MB7A 3RGPA 1TH4A 3T1HM 1YU0A 1IN5A 1IY2A 2OQ4A 5KQ8A 4LF5M 3FTFA 1YU3A 2UU9M 4ITQA 3GO8A 3L25A 2UUCM 1NHWC 2BJWA 2CE7A 3GQ5A 5FTJA 1UM8A 4LFCM 2D7HA 3SYKA 2EA0A 1XNRM 4NZ1A 5C1BA 5EP3A 2X4AA 1XXHA 4IBBA 2JCHA 2I7PA 2ZBKB 3BOSA 2YNMD 4NSRA 1NHGC 3HHWA 1GVNA 2XGNA 3RFWA 3GRRA 3HJ8A 1N75A 3A46A 2KRUA 2ZM6M 3SASA 4GC5A 1HNWM 2P5TA 3GRVA 4DV0M 4G4OA 1G59A 2KZSA 3J7AS 4LCBA 1LV7A 2R18A 1K3WA 4NYYA 5BPVA 2QENA 4M0WA 2LXEA 1R7RA 2BJVA 3I51A 4FW9A 3HHZA 2DZNB 2XFSA 2IOUA 4DR1M 1Z5BA 2VQFM 3U6QA 1IXZA 5ITQA 2Q2EB 3VLFB 2VQEM 2QBYA 2F5PA 4WURA 4OJPA 4OJOA 3AOEA 1YUEA 2KW0A 4QOZC 4DR5M 1KYIA 4B3MM 2C99A 4OJ6A 3GQ4A 5F3WA 1QAQA 5H37D 3LVVA 4DV6M 2LH0A 2R46A 3VK8A 4LZJA 4DR4M 3KOXE 2XLJA 3U60A 2QCUA 1G8PA 5IZ7D 3K2LA 4PDIA 4JI4M 4LZZA 1HR0M 5EJCA 1Z59A 1PM5A 2ZAOA 1HT1E 2Z3XA 4LFBM 2V6ZM 3KDSE 1IN7A 2Y0TA 2DWZB 4JXJA 2FE8A 2XSZA 3FUXA 1L2BA 2G5GX 1I94M 1OFHA 1T3TA 5KPRA 5FTLA 2L09A 2Z7JA 2DZOB 3HU1A 4K0KM 2XF3A 3KXEC 1I4WA 3C58A 3CTWB 4IJEA 3J7BA 1DO2A 1R2ZA 4AI6A 3M6AA 4AG5A 1E9RA 1TH2A 3KSJA 1IXRC 2Y2KA 1JQJC 4BLCA 1OFIA 3U6EA 4GH9A 4IBGA 3GQ3A 1DGHB 4XBOA 2R4EA 2DHRA 2Z4RA 4IBIA 4DV1M 1G41A 4I8OA 2F5SA 2F5QA 4MGKE 1ZAEA 3FUVA 4IBFA 4TUWA 4NXNM 5JI3E 2CHVA 1XXHB 1YU4A 1G4AE 4OVZA 2Y0QA 4DV4M 1IXSB 1XMOM 3KVWA 5ITUA 4JI1M 4GKJM 4YY3M 2E5LM 5EXTA 4MGHA 4LJ9A 4NZ3A 3TWKA 2F4VM 1L1TA 3U6DA 1PJIA 4LRSA 3SAUA 1XWIA 4X64M 1KSFX 1SXJA 4I5SA 1VDDA 5A2QS 4A3VB 5IWAM 4R7GA 3PNYA 3Q8XA 3MJ5A 4Z8XA 1R6BX 4NRVA 4GHAA 1NVMA 4CISA 3KOZE 5ITRA 3DFZA 4LF6M 4JI6M 2KZUA 5EP2A 3HJSA 2KRKA 1W5TA 1JR3A 4DR3M 3KW6A 1IN8A 3T15A 2Y2GA 4GRIA 3KOYE 3T1YM 2XZFA 1IM2A 2Y2QA 4M0DA 1IN6A 1L8QA 1QAOA 3W0FA 2UXCM 2QZ4A 2JA2A 4OW0A 2O5RA 4AKIA 3U60B 4R3DA 2HHHM 4X65M 4D81A 4FD2A 4NZ4A 3DA1A 1L1ZA 2CV2A 2C98A 4LJ5A 3D8LA 2OPFA 2F5OA 3U6PA 4AZFA 1N33M 4PT5A 3PXGA 3R9XB 3HHXA 4JN6A 1SXJC 3E9SA 4X62M 1DGFA 3A42A 3QWLA 2H1RA 3AFHA 4L4UA 2FFJA 5EP4A 1KFVA 3SATA 3FTDA 3NBIA 3GLGA 3THGA 3VDUA 4B7HA 4GC9A 4MM3B 4HLQA 4OJLA 4IBDA 2RGHA 3FKEA 1OJLA 5EP1A 1C1KA 3WX7A 2LWXA 3R8FA 3L27A 5IREB 3GP1A 3VKHA 4FWDA 1Z5CA 1NNJA 7CATA 4D82A 3GLHA 4QNLA 1N78A 5EXXA 2Y2IA 5LMUM 4I81A 1J5EM 4JI7M 3SC3A 2J7OA 3A45A 3TL4X 4NYUA 4QNMA 1IN4A 1J09A 4QHTA 3GPXA 4OVZB 3N3FA 1MU5A 3ZH9B 4G6ZA 4QNRA 4OX9M 5KPTA 2CV1A 4DR2M 1XC8A 4BB9A 3AL0C 4NOOB 3VDPA 3VKGA 3HU2A 4MH0E 3FYDA 4RF0A 3U61A 3FTCA 2BG1A 4CGYB 3TPZA 2XFTA 4NZ5A 4FCVA 3HKPA 4G4NA 1MX0A 4LY6A 3FD9A 4LGYA 3SMPA 3SBJA 4RF1A 1SXJB 4LF7M 1R2YA 1QZMA 5KQDA 1IBKM 1GL7A 2CFOA 4ZPXA 1ORYB 1DGGA 3CF0A 2UUAM 3JR5A 4G4RA 3LQRA 2G8LA 4HL4A 1W5SA 3UMMA 2CEAA 1HT2E 1L2CA 4JI2M 4B3RM 2NQ8C 1NJFA 1YE9A 2DVWB 2K47A 1EE8A 5DYIA 5GKNA 1H6UA 2J7NA 3GRUA 4LG2A 4LFAM 4L8RC 3L28A 4JYAM 3GPUA 4AQYM 2R45A 5FSWA 1IQPA 4XGIA 4II7A 4NRWA 4REZA 2KA6B 3AOEC 3GLFA 2Y2LA 4JI0M 3T38A 4QOSA 4AW4A 3U6SA 3U6MA 2QP9X 4OUIA 2XSZD 1J7KA 5E6JA 4AKHA 1QVRA 4LJ4A 4GITA 4LJAA 1TDZA 1NJGA 2XZUA 2Y21A 3J27B 2JE5A 5FLXS 1XNQM 4JI5M 3HONA 2RKOA 1FNNA 3SMSA 3KP0E 3HWSA 4FCWA 3DOAA 1GL6A 3GPPA 4CHTB 2XEPA 8CATA 1Q39A 1YUBA 3KFUG 3TWMA 2DWLA 3AKZA 3J80S 3SHFA 3MHVC 5ITYA 2R65A 3J81S 1E32A 1D2NA 5FTKA 3FTEA 2R62A 5DYGA 4DV2M 2Y2HA 3PNVA 2Y20A 3AJIB 3L29A 4PD2A 1TGUA 3L26A 2QBYB 4S12A 1E94E 4LJ8A 4LF9M 3U6LA 3ILKA 3L2AA 4GHLA 2A5YB 3MK6A 4FWHA 5JI2E 3HSHA 3D8BA 1Z6TA 2W82A 3GRYA 4JV5M 2DWNA 3LVWA 3TQSA 4L15A 3U61B 3VFDA 3FYCA 4FCTA 3AOGA 3M0EA 3U6CA 4IBKA 2DXIA 1SXJD 2Z4SA 3EIEA 3TE6A 1YU2A 4BBAA 1XHBA 2C9OA 1QANA 4M9ZA 5ITXE 4LF8M 4FVMA 3ZC7B 5BR8M 3I4YA 4B7FA 2DWMA 1QAMA 2RGOA 3NWLA 3IG8A 4GIPA 2Y2JA 3SFZA 1NNUC 2LNHC 4DV7M 3K92A 4Z6YA 4LJ6A 2XD1A 2R4JA 3A98B 2D7EA 3B9PA 3EIHA 4D80A 5IT9S 1GLNA 3K8ZA 3KP1E 2ZAMA 5EQTA 1TDHA 1N77A 3CF6E 1DGHA 2V1CA 5FTMA 5KPZA 3SARA 3GLFB 3GLIA 4NY2A 2M60A 2QPAA 3JR4A 4QHSA 4LRTA 3HHYA 4M9XA 3UGJA 2V1UA 3SYLA 3U5ZA 3HGIA 3U6OA 3RE8A 4KHPM 1TH3A 2D7GA 2HL7A 3PFIA 4AKGA 2XD5A 4KLNA 4AG6A 3W0LB 2L7HA 3TWLA 4OJ5A 1DGBA 3HJQA 5C18A 2M5ZA 1NY5A 2Y2OA 4MGZE 3RGSA 3IG5A 3VK7A 3JAMS 4PDGA 2FOIC 4DR6M 2ERCA 3E4RA 3CF2A 4JI3M 3KSXA 4WW0A 3SHGB 2C96A 4NL4H 4IBJA 4RNAA 4OU7A 5ITXA 5EXPA 1HNXM 1DO0A 2BNKA 1XMQM 1Z5AA 4I4LA 1N32M 1HQCA 4FWGA 4GMQA 5FTNA 1HQYE 2XH9A 1K3XA 4B3SM 2KEBA 1X37A 1SXJE 3M7GA 1S3SA 3FUUA 2I7NA 3KS8A 3DZDA 4DUYM 1N36M 5ITTA 3UJNA 1Q3BA 1ZQ9A 1FJGM 4M9SA 3OTOM 2L6OA 4NSOB 1IY0A 2CUZA 1IY1A 1WXQA 2FNAA 4NXMM 3KS4A 4KODA 2YR0A 3SAVA 4P16A 3UZUA 2CV0A 5EXSA 5E26A 2Y2NA 3I4VA 3PVSA 4L78A 1N34M 5DNYA 2Y2MA 4JI8M 4W5WA 3GLGB 2YFQA 3FUTA 3SAWA 2VIIA 3J2PB 2CHGA 3GPYA 4G4QA 4DV3M 2FFFB 1G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBG A;  4GHA A;  4IBJ A;  4IBI A;  3KS4 A;  4IBC A;  4IJF A;  3L29 A;  4IBF A;  4IBB A;  3L26 A;  4GHL A;  4IBE A;  3L2A A;  4LG2 A;  4IJE A;  3L28 A;  4IBD A;  3KS8 A;  3FKE A;  4IBK A;  5BPV A;  3L25 A;  4GH9 A;  3L27 A; 
#chains in the Genus database with same CATH topology
 4IIW A;  1CUK A;  1L6J A;  2ZAN A;  3GLI B;  3H4M A;  3KOW E;  3W68 A;  3FE3 A;  1QYR A;  3E46 A;  1TF0 B;  4DR7 M;  1XXH E;  4R71 A;  4YHH M;  1EAK A;  4Z2I A;  4LJ7 A;  3W67 A;  3GLH B;  4DV5 M;  3U5Z B;  4B3T M;  3K1J A;  1NY6 A;  1D0M A;  2X8A A;  4IJF A;  2EUC A;  2AHM A;  2WSC F;  1YU1 A;  1HNZ M;  4LF4 M;  4X66 M;  2RRU A;  2MRO B;  1R5L A;  1Q3C A;  4GKK M;  1GKI A;  1P3Q Q;  4MGY E;  2UXB M;  1K82 A;  2UXD M;  4HME A;  1E9S A;  1W1P A;  2X49 A;  3WHK A;  2KXE A;  3AV0 A;  3HU3 A;  3WD2 A;  2F5N A;  3LQQ A;  4DUZ M;  1NSF A;  2HCB A;  2QQ8 A;  4B08 A;  5KO3 A;  1IBL M;  2YQZ A;  4EIW A;  4L16 A;  4MGI E;  1PJJ A;  5LMN M;  4B7G A;  1NV9 A;  4LGM A;  2LVA A;  2Y2P A;  2CHQ A;  2C5R A;  2UUB M;  3LMM A;  4KO8 A;  1W1T A;  4Z2H A;  2DKL A;  4IBC A;  2UWX A;  1L2D A;  1W1V A;  1QQW A;  3QAU A;  1D0L A;  2DAK A;  2K9D A;  2L7I A;  3FUW A;  4IBE A;  1E6P A;  1JR3 D;  2EO2 A;  4PCZ A;  1IBM M;  3UK6 A;  2C9C A;  3WHL A;  1YSY A;  2HKJ A;  3ZCB B;  4MB7 A;  3RGP A;  1TH4 A;  3T1H M;  1CK7 A;  1YU0 A;  1IN5 A;  1IY2 A;  2JY5 A;  3LCV B;  2OQ4 A;  5KQ8 A;  4LF5 M;  3FTF A;  1YU3 A;  2UU9 M;  2R0I A;  2QNJ A;  4ITQ A;  2L4E A;  3GO8 A;  3L25 A;  2UUC M;  1NHW C;  2BJW A;  2CE7 A;  3GQ5 A;  3WD1 A;  5FTJ A;  1QO6 A;  1UM8 A;  4LFC M;  2D7H A;  3SYK A;  2EA0 A;  1XNR M;  4NZ1 A;  5C1B A;  3BBZ A;  3IEC A;  1BVS A;  2GNO A;  2X4A A;  1XXH A;  4IBB A;  1MJG M;  5EP3 A;  2JCH A;  2I7P A;  2ZBK B;  3BOS A;  2YNM D;  4NSR A;  1IXS A;  1NHG C;  3B7Z A;  1GVN A;  2XGN A;  3HHW A;  3RFW A;  2LBC A;  2B3T A;  3GRR A;  3HJ8 A;  1N75 A;  2LHC A;  3A46 A;  2KRU A;  2ZM6 M;  2WZJ A;  3SAS A;  4GC5 A;  1HNW M;  2P5T A;  3GRV A;  4DV0 M;  1AUA A;  3GLF E;  4WP2 A;  4G4O A;  1G59 A;  1VG5 A;  2KZS A;  3J7A S;  4LCB A;  1LV7 A;  2R18 A;  1K3W A;  4TX8 A;  4NYY A;  5BPV A;  2QEN A;  4M0W A;  1WGL A;  2LXE A;  1R7R A;  2BJV A;  3I51 A;  4FW9 A;  1GOI A;  3HHZ A;  2DZN B;  2XFS A;  1GO5 A;  2IOU A;  4DR1 M;  1Z5B A;  2VQF M;  3U6Q A;  1IXZ A;  5ITQ A;  2Q2E B;  3VLF B;  2VQE M;  2QBY A;  2F5P A;  1V92 A;  4WUR A;  4OJP A;  4OJO A;  1E6Z A;  1D0K A;  4NC6 A;  2ZTD A;  3AOE A;  2KW0 A;  3LW5 F;  1YUE A;  2DEN A;  3HX3 A;  4QOZ C;  4DR5 M;  1KYI A;  1OAO C;  2C99 A;  4B3M M;  1JB0 F;  3GQ4 A;  4OJ6 A;  5F3W A;  1QAQ A;  4Z2G A;  5H37 D;  3LVV A;  4DV6 M;  3QYB A;  4Y28 F;  2LH0 A;  2DAM A;  4L6V 6;  2R46 A;  2VDB B;  3VK8 A;  1VDL A;  4LZJ A;  2HWJ A;  4DR4 M;  3KOX E;  2XLJ A;  3U60 A;  2QCU A;  1G8P A;  2RTS A;  5IZ7 D;  3K2L A;  2JY7 A;  4PDI A;  4JI4 M;  4LZZ A;  1HR0 M;  1H8P A;  5EJC A;  1F4I A;  1Z59 A;  1PM5 A;  1A5T A;  4MB5 A;  2ZAO A;  1HT1 E;  2Z3X A;  4LFB M;  2FN2 A;  1JR3 E;  2V6Z M;  3KDS E;  1IN7 A;  2Y0T A;  1CXW A;  2DWZ B;  3I04 M;  2FE8 A;  2JP7 A;  2XSZ A;  3FUX A;  4JXJ A;  2G5G X;  1L2B A;  1I94 M;  1OFH A;  1W1Y A;  1T3T A;  5KPR A;  5FTL A;  2L09 A;  2Z7J A;  2CP8 A;  2DZO B;  2LHG A;  3HU1 A;  1NO1 A;  2XF3 A;  3KXE C;  1I4W A;  1ZMU A;  3C58 A;  3CTW B;  4K0K M;  4IJE A;  3WD3 A;  3J7B A;  1DO2 A;  1R2Z A;  4AI6 A;  2KNZ A;  3M6A A;  1E9R A;  4KT0 F;  4AG5 A;  1TH2 A;  3KSJ A;  1IXR C;  2Y2K A;  1JQJ C;  4BLC A;  1OFI A;  2JWS A;  3U6E A;  3MQL A;  3WD0 A;  3C3E A;  4GH9 A;  4IBG A;  3GQ3 A;  1DGH B;  4XBO A;  1O6I A;  4MB3 A;  1PRB A;  2R4E A;  1WHC A;  2DHR A;  2Z4R A;  3K9O A;  4IBI A;  4DV1 M;  1G41 A;  4I8O A;  3IHP A;  2F5S A;  2F5Q A;  4MGK E;  1ZAE A;  3FUV A;  4IBF A;  4TUW A;  4NXN M;  5JI3 E;  2CHV A;  1XXH B;  2N35 A;  1G4A E;  4OVZ A;  2Y0Q A;  3GLG E;  1OIZ A;  2JZ0 A;  4ANR A;  1YU4 A;  4DV4 M;  1IXS B;  1XMO M;  4DBG B;  3KVW A;  5ITU A;  3QYE A;  4JI1 M;  1GJS A;  4GKJ M;  4YY3 M;  2E5L M;  5EXT A;  4Z2J A;  2MH8 A;  4MGH A;  2KDL A;  4LJ9 A;  3GLI E;  3TWK A;  2F4V M;  4NZ3 A;  1L1T A;  3U6D A;  1PJI A;  1WIV A;  4LRS A;  3SAU A;  1XWI A;  4X64 M;  1KSF X;  1SXJ A;  4I5S A;  1VDD A;  1Y8G A;  5A2Q S;  1OGB A;  1PGY A;  3GLH E;  4A3V B;  2OOA A;  4R7G A;  3PNY A;  3Q8X A;  5IWA M;  3MJ5 A;  4Z8X A;  1R6B X;  4NRV A;  4GHA A;  1NVM A;  4CIS A;  1J7M A;  2R44 A;  3KOZ E;  5ITR A;  3DFZ A;  4LF6 M;  1TTE A;  4JI6 M;  1DV0 A;  2KZU A;  1RU3 A;  3HJS A;  2KRK A;  3I01 M;  5EP2 A;  1W5T A;  1JR3 A;  4DR3 M;  3KW6 A;  1IN8 A;  3T15 A;  2Y2G A;  4GRI A;  4Z2K A;  3KOY E;  3T1Y M;  1UR8 A;  2XZF A;  1IM2 A;  2Y2Q A;  2DI0 A;  4M0D A;  1IN6 A;  1L8Q A;  1QAO A;  3W0F A;  2UXC M;  2QZ4 A;  2JA2 A;  4OW0 A;  5L8R F;  2O5R A;  4AKI A;  3F92 A;  3U60 B;  4R3D A;  2R6F A;  2HHH M;  1VEJ A;  4X65 M;  4D81 A;  3M7P A;  4Z2L A;  4FD2 A;  1XB2 B;  4NZ4 A;  3DA1 A;  1L1Z A;  2CV2 A;  2C98 A;  4LJ5 A;  1WR1 B;  1UFZ A;  3D8L A;  2OPF A;  2F5O A;  3U6P A;  4AZF A;  1N33 M;  4PT5 A;  3PXG A;  3R9X B;  3HHX A;  3E21 A;  2K6B A;  1SXJ C;  3E9S A;  4JN6 A;  1DGF A;  2EKK A;  4X62 M;  3A42 A;  2APL A;  3QWL A;  1OIP A;  2H1R A;  3AFH A;  4L4U A;  2FFJ A;  2JZ1 A;  5EP4 A;  1KFV A;  3SAT A;  3FTD A;  3NBI A;  3GLG A;  3THG A;  3VDU A;  4B7H A;  4GC9 A;  4MM3 B;  4HLQ A;  4OJL A;  2MJ5 B;  2LVQ D;  4IBD A;  2RGH A;  3FKE A;  1ZV1 A;  1OJL A;  5EP1 A;  1C1K A;  3WX7 A;  2LWX A;  3R8F A;  3L27 A;  4MB4 A;  5IRE B;  1MN3 A;  3GP1 A;  1VQ1 A;  4FWD A;  3VKH A;  1Z5C A;  2JY8 A;  3BXW A;  1NNJ A;  7CAT A;  4D82 A;  3GLH A;  4QNL A;  2JXN A;  1N78 A;  5EXX A;  1QDT A;  2Z8Y M;  4I81 A;  5LMU M;  1J5E M;  4JI7 M;  3SC3 A;  2OO9 A;  2J7O A;  3A45 A;  3TL4 X;  1PJQ A;  1V34 A;  1ZMV A;  2WSF F;  1IN4 A;  2CRU A;  3B7N A;  4QNM A;  4NYU A;  1J09 A;  4QHT A;  4F2L A;  4OVZ B;  3GPX A;  3N3F A;  1NV8 A;  1MU5 A;  2L4F A;  3ZH9 B;  2G3Q A;  4G6Z A;  1OTR A;  4QNR A;  4OX9 M;  5KPT A;  2CV1 A;  4DR2 M;  1XC8 A;  2Y2I A;  4BB9 A;  3AL0 C;  1H0G A;  4NOO B;  2VF8 A;  3VDP A;  3VKG A;  3HU2 A;  4MH0 E;  3FYD A;  4RF0 A;  3U61 A;  3FTC A;  2BG1 A;  4CGY B;  3TPZ A;  2XFT A;  4NZ5 A;  4FCV A;  3HKP A;  4G4N A;  1MX0 A;  4LY6 A;  3FD9 A;  4LGY A;  3SMP A;  3SBJ A;  2DNA A;  4RF1 A;  1QUT A;  1SXJ B;  4LF7 M;  1R2Y A;  1QZM A;  5KQD A;  4P17 A;  1IBK M;  1GL7 A;  1EIJ A;  2CFO A;  4ZPX A;  1ORY B;  1DGG A;  3CF0 A;  2UUA M;  3LCU A;  1H0I A;  3JR5 A;  2O01 F;  4G4R A;  1GXD A;  3LQR A;  4HMD A;  2G8L A;  4HL4 A;  1QZE A;  1W5S A;  3UMM A;  2CEA A;  4Q7J A;  1HT2 E;  1L2C A;  4JI2 M;  4B3R M;  2NQ8 C;  1G71 A;  1NJF A;  1YE9 A;  2DVW B;  2K47 A;  1GAB A;  1EE8 A;  5DYI A;  5GKN A;  1H6U A;  4HEO A;  4GEW A;  2J7N A;  1ZMW A;  3GRU A;  4LG2 A;  4LFA M;  4L8R C;  1IFY A;  3L28 A;  4JYA M;  3GPU A;  4AQY M;  2R45 A;  5FSW A;  1IQP A;  1SG9 A;  4XGI A;  4II7 A;  4CIZ A;  2ZTC A;  4REZ A;  4NRW A;  2KA6 B;  3HY5 A;  2DAE A;  3AOE C;  3GLF A;  1OAI A;  4JI0 M;  3T38 A;  2Y2L A;  3V76 A;  1T43 A;  2LVO C;  4QOS A;  2DHY A;  4AW4 A;  3U6S A;  4CJ6 A;  1T6O A;  3U6M A;  1V33 A;  2QP9 X;  4OUI A;  2XSZ D;  1J7K A;  1VEK A;  1HJP A;  5E6J A;  4AKH A;  1GJT A;  2JUJ A;  1QVR A;  1WJ7 A;  4LJ4 A;  4GIT A;  1E6R A;  4LJA A;  1TDZ A;  1NJG A;  2XZU A;  2Y21 A;  3J27 B;  2MR9 A;  1TR8 A;  1YLA A;  2JE5 A;  5FLX S;  1XNQ M;  4JI5 M;  3HON A;  2RKO A;  1FNN A;  3SMS A;  2QHO B;  3KP0 E;  3HWS A;  4FCW A;  3DOA A;  1GL6 A;  3GPP A;  4CHT B;  2XEP A;  8CAT A;  3T6P A;  1Q39 A;  1YUB A;  1E8B A;  2DAI A;  1GPF A;  3B74 A;  2GQF A;  3KFU G;  3TWM A;  2DWL A;  3AKZ A;  3J80 S;  2BWE A;  3MHV C;  3SHF A;  5ITY A;  2R65 A;  2EKF A;  3CGW A;  1E32 A;  3J81 S;  4HMC A;  1D2N A;  5FTK A;  3FTE A;  2R62 A;  3ZQJ A;  5DYG A;  4DV2 M;  2Y2H A;  3PNV A;  2Y20 A;  3AJI B;  3L29 A;  4PD2 A;  1TGU A;  3L26 A;  2QBY B;  4S12 A;  1E94 E;  4LJ8 A;  4LF9 M;  3U6L A;  3ILK A;  3L2A A;  4GHL A;  2A5Y B;  3MK6 A;  4FWH A;  5JI2 E;  3HSH A;  3WD4 A;  3D8B A;  1Z6T A;  2W82 A;  3Q8G A;  3B89 A;  3GRY A;  4JV5 M;  2DWN A;  3LVW A;  3TQS A;  1KS0 A;  4L15 A;  2EJS A;  3U61 B;  2JY6 B;  3VFD A;  3FYC A;  2LTU A;  4FCT A;  2HAK A;  3AOG A;  3M0E A;  3U6C A;  4IBK A;  2DXI A;  4RKU F;  1SXJ D;  2O25 A;  2Z4S A;  3C3D A;  1QUS A;  3EIE A;  3TE6 A;  1YU2 A;  4BBA A;  1XHB A;  2C9O A;  1QAN A;  4M9Z A;  5ITX E;  4LF8 M;  4FVM A;  3B7Q A;  2V5O A;  3ZC7 B;  5BR8 M;  3I4Y A;  4B7F A;  2DWM A;  1QAM A;  1R4G A;  2RGO A;  2DZL A;  3FRH A;  3NWL A;  3IG8 A;  4UN2 B;  4GIP A;  2Y2J A;  3SFZ A;  1NNU C;  1WGN A;  2LNH C;  2WSE F;  4DV7 M;  3K92 A;  4Z6Y A;  5DFL A;  1PJS A;  4LJ6 A;  2R4J A;  2XD1 A;  3A98 B;  2D7E A;  2QSF X;  3B9P A;  1EFU B;  2LVN C;  3EIH A;  3FRI A;  4D80 A;  5IT9 S;  1GLN A;  3K8Z A;  1E6N A;  3KP1 E;  2ZAM A;  5EQT A;  2JNH A;  1TDH A;  3HZJ A;  1N77 A;  3CF6 E;  1DGH A;  2V1C A;  5FTM A;  5KPZ A;  3SAR A;  3GLF B;  3GLI A;  4NY2 A;  2M60 A;  2QPA A;  3JR4 A;  4QHS A;  4LRT A;  2FH0 A;  3HHY A;  4M9X A;  3UGJ A;  2LVP C;  2V1U A;  3SYL A;  3U5Z A;  1E88 A;  3HGI A;  3U6O A;  3RE8 A;  4KHP M;  1TH3 A;  2D7G A;  2HL7 A;  3C9P A;  3PFI A;  4F1I A;  4AKG A;  2XD5 A;  1Q02 A;  3H4J A;  1VEG A;  4KLN A;  4AG6 A;  3W0L B;  2L7H A;  3TWL A;  4OJ5 A;  1DGB A;  3HJQ A;  5C18 A;  2M5Z A;  1NY5 A;  4XK8 F;  2Y2O A;  4MGZ E;  3RGS A;  3IG5 A;  3VK7 A;  3JAM S;  4PDG A;  1UR9 A;  2FOI C;  2OOB A;  4DR6 M;  1LTM A;  3K9P A;  4G3O A;  1ED7 A;  1OGG A;  2ERC A;  1QDR A;  3E4R A;  1AIW A;  2DAG A;  3CF2 A;  4JI3 M;  3KSX A;  4WW0 A;  3SHG B;  2C96 A;  4NL4 H;  4IBJ A;  2KHH A;  4RNA A;  4OU7 A;  5ITX A;  5EXP A;  1HNX M;  1DO0 A;  2BNK A;  1XMQ M;  1Z5A A;  2H5X A;  4I4L A;  1N32 M;  1HQC A;  4FWG A;  4GMQ A;  5FTN A;  1PDC A;  1HQY E;  2J5Y A;  2XH9 A;  1K3X A;  2K0B X;  4B3S M;  2KEB A;  1X37 A;  1SXJ E;  3M7G A;  2CWB A;  1S3S A;  3FUU A;  2I7N A;  3KS8 A;  3DZD A;  4DUY M;  1N36 M;  5ITT A;  3NBX X;  3UJN A;  1Q3B A;  1ZQ9 A;  1FJG M;  4M9S A;  3OTO M;  1E15 A;  2L6O A;  4NSO B;  1IY0 A;  2CUZ A;  1IY1 A;  2KNA A;  1WXQ A;  2FNA A;  4NXM M;  3KS4 A;  4KOD A;  2YR0 A;  2BWB A;  2MGW A;  2KNV A;  1AIP C;  3SAV A;  4P16 A;  3UZU A;  2CV0 A;  5EXS A;  5E26 A;  2D49 A;  1OQY A;  2Y2N A;  2L2D A;  3I4V A;  1PJT A;  3PVS A;  2VF7 A;  4L78 A;  1N34 M;  5DNY A;  2Y2M A;  4JI8 M;  1OKS A;  4W5W A;  2FS1 A;  3GLG B;  2YFQ A;  3FUT A;  1C7Y A;  3SAW A;  2VII A;  3J2P B;  2CHG A;  3GPY A;  4G4Q A;  3MMP A;  4DV3 M;  2FFF B;  1G3I A; 
#chains in the Genus database with same CATH homology
 4IIW A;  2ZAN A;  3GLI B;  3H4M A;  3KOW E;  1QYR A;  4DR7 M;  4YHH M;  4LJ7 A;  3GLH B;  4DV5 M;  3U5Z B;  4B3T M;  3K1J A;  1NY6 A;  4IJF A;  2X8A A;  2EUC A;  2AHM A;  1YU1 A;  1HNZ M;  4LF4 M;  4X66 M;  1Q3C A;  4GKK M;  1GKI A;  4MGY E;  2UXD M;  2UXB M;  1K82 A;  1E9S A;  2X49 A;  3WHK A;  2KXE A;  3AV0 A;  3HU3 A;  2F5N A;  3LQQ A;  4DUZ M;  1NSF A;  2HCB A;  4B08 A;  5KO3 A;  1IBL M;  2YQZ A;  4EIW A;  4L16 A;  4MGI E;  1PJJ A;  5LMN M;  4B7G A;  4LGM A;  2Y2P A;  2CHQ A;  2C5R A;  2UUB M;  3LMM A;  4KO8 A;  4IBC A;  2UWX A;  1L2D A;  1QQW A;  3QAU A;  3FUW A;  2L7I A;  4IBE A;  1JR3 D;  2EO2 A;  4PCZ A;  1IBM M;  3UK6 A;  2C9C A;  3WHL A;  1YSY A;  2HKJ A;  3ZCB B;  4MB7 A;  3RGP A;  1TH4 A;  3T1H M;  1YU0 A;  1IN5 A;  1IY2 A;  2OQ4 A;  5KQ8 A;  4LF5 M;  3FTF A;  1YU3 A;  2UU9 M;  4ITQ A;  3GO8 A;  3L25 A;  2UUC M;  1NHW C;  2BJW A;  2CE7 A;  3GQ5 A;  5FTJ A;  1UM8 A;  4LFC M;  2D7H A;  3SYK A;  2EA0 A;  1XNR M;  4NZ1 A;  5C1B A;  5EP3 A;  2X4A A;  1XXH A;  4IBB A;  2JCH A;  2I7P A;  2ZBK B;  3BOS A;  2YNM D;  4NSR A;  1NHG C;  3HHW A;  1GVN A;  2XGN A;  3RFW A;  3GRR A;  3HJ8 A;  1N75 A;  3A46 A;  2KRU A;  2ZM6 M;  3SAS A;  4GC5 A;  1HNW M;  2P5T A;  3GRV A;  4DV0 M;  4G4O A;  1G59 A;  2KZS A;  3J7A S;  4LCB A;  1LV7 A;  2R18 A;  1K3W A;  4NYY A;  5BPV A;  2QEN A;  4M0W A;  2LXE A;  1R7R A;  2BJV A;  3I51 A;  4FW9 A;  3HHZ A;  2DZN B;  2XFS A;  2IOU A;  4DR1 M;  1Z5B A;  2VQF M;  3U6Q A;  1IXZ A;  5ITQ A;  2Q2E B;  3VLF B;  2VQE M;  2QBY A;  2F5P A;  4WUR A;  4OJP A;  4OJO A;  3AOE A;  1YUE A;  2KW0 A;  4QOZ C;  4DR5 M;  1KYI A;  4B3M M;  2C99 A;  4OJ6 A;  3GQ4 A;  5F3W A;  1QAQ A;  5H37 D;  3LVV A;  4DV6 M;  2LH0 A;  2R46 A;  3VK8 A;  4LZJ A;  4DR4 M;  3KOX E;  2XLJ A;  3U60 A;  2QCU A;  1G8P A;  5IZ7 D;  3K2L A;  4PDI A;  4JI4 M;  4LZZ A;  1HR0 M;  5EJC A;  1Z59 A;  1PM5 A;  2ZAO A;  1HT1 E;  2Z3X A;  4LFB M;  2V6Z M;  3KDS E;  1IN7 A;  2Y0T A;  2DWZ B;  4JXJ A;  2FE8 A;  2XSZ A;  3FUX A;  1L2B A;  2G5G X;  1I94 M;  1OFH A;  1T3T A;  5KPR A;  5FTL A;  2L09 A;  2Z7J A;  2DZO B;  3HU1 A;  4K0K M;  2XF3 A;  3KXE C;  1I4W A;  3C58 A;  3CTW B;  4IJE A;  3J7B A;  1DO2 A;  1R2Z A;  4AI6 A;  3M6A A;  4AG5 A;  1E9R A;  1TH2 A;  3KSJ A;  1IXR C;  2Y2K A;  1JQJ C;  4BLC A;  1OFI A;  3U6E A;  4GH9 A;  4IBG A;  3GQ3 A;  1DGH B;  4XBO A;  2R4E A;  2DHR A;  2Z4R A;  4IBI A;  4DV1 M;  1G41 A;  4I8O A;  2F5S A;  2F5Q A;  4MGK E;  1ZAE A;  3FUV A;  4IBF A;  4TUW A;  4NXN M;  5JI3 E;  2CHV A;  1XXH B;  1YU4 A;  1G4A E;  4OVZ A;  2Y0Q A;  4DV4 M;  1IXS B;  1XMO M;  3KVW A;  5ITU A;  4JI1 M;  4GKJ M;  4YY3 M;  2E5L M;  5EXT A;  4MGH A;  4LJ9 A;  4NZ3 A;  3TWK A;  2F4V M;  1L1T A;  3U6D A;  1PJI A;  4LRS A;  3SAU A;  1XWI A;  4X64 M;  1KSF X;  1SXJ A;  4I5S A;  1VDD A;  5A2Q S;  4A3V B;  5IWA M;  4R7G A;  3PNY A;  3Q8X A;  3MJ5 A;  4Z8X A;  1R6B X;  4NRV A;  4GHA A;  1NVM A;  4CIS A;  3KOZ E;  5ITR A;  3DFZ A;  4LF6 M;  4JI6 M;  2KZU A;  5EP2 A;  3HJS A;  2KRK A;  1W5T A;  1JR3 A;  4DR3 M;  3KW6 A;  1IN8 A;  3T15 A;  2Y2G A;  4GRI A;  3KOY E;  3T1Y M;  2XZF A;  1IM2 A;  2Y2Q A;  4M0D A;  1IN6 A;  1L8Q A;  1QAO A;  3W0F A;  2UXC M;  2QZ4 A;  2JA2 A;  4OW0 A;  2O5R A;  4AKI A;  3U60 B;  4R3D A;  2HHH M;  4X65 M;  4D81 A;  4FD2 A;  4NZ4 A;  3DA1 A;  1L1Z A;  2CV2 A;  2C98 A;  4LJ5 A;  3D8L A;  2OPF A;  2F5O A;  3U6P A;  4AZF A;  1N33 M;  4PT5 A;  3PXG A;  3R9X B;  3HHX A;  4JN6 A;  1SXJ C;  3E9S A;  4X62 M;  1DGF A;  3A42 A;  3QWL A;  2H1R A;  3AFH A;  4L4U A;  2FFJ A;  5EP4 A;  1KFV A;  3SAT A;  3FTD A;  3NBI A;  3GLG A;  3THG A;  3VDU A;  4B7H A;  4GC9 A;  4MM3 B;  4HLQ A;  4OJL A;  4IBD A;  2RGH A;  3FKE A;  1OJL A;  5EP1 A;  1C1K A;  3WX7 A;  2LWX A;  3R8F A;  3L27 A;  5IRE B;  3GP1 A;  3VKH A;  4FWD A;  1Z5C A;  1NNJ A;  7CAT A;  4D82 A;  3GLH A;  4QNL A;  1N78 A;  5EXX A;  2Y2I A;  5LMU M;  4I81 A;  1J5E M;  4JI7 M;  3SC3 A;  2J7O A;  3A45 A;  3TL4 X;  4NYU A;  4QNM A;  1IN4 A;  1J09 A;  4QHT A;  3GPX A;  4OVZ B;  3N3F A;  1MU5 A;  3ZH9 B;  4G6Z A;  4QNR A;  4OX9 M;  5KPT A;  2CV1 A;  4DR2 M;  1XC8 A;  4BB9 A;  3AL0 C;  4NOO B;  3VDP A;  3VKG A;  3HU2 A;  4MH0 E;  3FYD A;  4RF0 A;  3U61 A;  3FTC A;  2BG1 A;  4CGY B;  3TPZ A;  2XFT A;  4NZ5 A;  4FCV A;  3HKP A;  4G4N A;  1MX0 A;  4LY6 A;  3FD9 A;  4LGY A;  3SMP A;  3SBJ A;  4RF1 A;  1SXJ B;  4LF7 M;  1R2Y A;  1QZM A;  5KQD A;  1IBK M;  1GL7 A;  2CFO A;  4ZPX A;  1ORY B;  1DGG A;  3CF0 A;  2UUA M;  3JR5 A;  4G4R A;  3LQR A;  2G8L A;  4HL4 A;  1W5S A;  3UMM A;  2CEA A;  1HT2 E;  1L2C A;  4JI2 M;  4B3R M;  2NQ8 C;  1NJF A;  1YE9 A;  2DVW B;  2K47 A;  1EE8 A;  5DYI A;  5GKN A;  1H6U A;  2J7N A;  3GRU A;  4LG2 A;  4LFA M;  4L8R C;  3L28 A;  4JYA M;  3GPU A;  4AQY M;  2R45 A;  5FSW A;  1IQP A;  4XGI A;  4II7 A;  4NRW A;  4REZ A;  2KA6 B;  3AOE C;  3GLF A;  2Y2L A;  4JI0 M;  3T38 A;  4QOS A;  4AW4 A;  3U6S A;  3U6M A;  2QP9 X;  4OUI A;  2XSZ D;  1J7K A;  5E6J A;  4AKH A;  1QVR A;  4LJ4 A;  4GIT A;  4LJA A;  1TDZ A;  1NJG A;  2XZU A;  2Y21 A;  3J27 B;  2JE5 A;  5FLX S;  1XNQ M;  4JI5 M;  3HON A;  2RKO A;  1FNN A;  3SMS A;  3KP0 E;  3HWS A;  4FCW A;  3DOA A;  1GL6 A;  3GPP A;  4CHT B;  2XEP A;  8CAT A;  1Q39 A;  1YUB A;  3KFU G;  3TWM A;  2DWL A;  3AKZ A;  3J80 S;  3SHF A;  3MHV C;  5ITY A;  2R65 A;  3J81 S;  1E32 A;  1D2N A;  5FTK A;  3FTE A;  2R62 A;  5DYG A;  4DV2 M;  2Y2H A;  3PNV A;  2Y20 A;  3AJI B;  3L29 A;  4PD2 A;  1TGU A;  3L26 A;  2QBY B;  4S12 A;  1E94 E;  4LJ8 A;  4LF9 M;  3U6L A;  3ILK A;  3L2A A;  4GHL A;  2A5Y B;  3MK6 A;  4FWH A;  5JI2 E;  3HSH A;  3D8B A;  1Z6T A;  2W82 A;  3GRY A;  4JV5 M;  2DWN A;  3LVW A;  3TQS A;  4L15 A;  3U61 B;  3VFD A;  3FYC A;  4FCT A;  3AOG A;  3M0E A;  3U6C A;  4IBK A;  2DXI A;  1SXJ D;  2Z4S A;  3EIE A;  3TE6 A;  1YU2 A;  4BBA A;  1XHB A;  2C9O A;  1QAN A;  4M9Z A;  5ITX E;  4LF8 M;  4FVM A;  3ZC7 B;  5BR8 M;  3I4Y A;  4B7F A;  2DWM A;  1QAM A;  2RGO A;  3NWL A;  3IG8 A;  4GIP A;  2Y2J A;  3SFZ A;  1NNU C;  2LNH C;  4DV7 M;  3K92 A;  4Z6Y A;  4LJ6 A;  2XD1 A;  2R4J A;  3A98 B;  2D7E A;  3B9P A;  3EIH A;  4D80 A;  5IT9 S;  1GLN A;  3K8Z A;  3KP1 E;  2ZAM A;  5EQT A;  1TDH A;  1N77 A;  3CF6 E;  1DGH A;  2V1C A;  5FTM A;  5KPZ A;  3SAR A;  3GLF B;  3GLI A;  4NY2 A;  2M60 A;  2QPA A;  3JR4 A;  4QHS A;  4LRT A;  3HHY A;  4M9X A;  3UGJ A;  2V1U A;  3SYL A;  3U5Z A;  3HGI A;  3U6O A;  3RE8 A;  4KHP M;  1TH3 A;  2D7G A;  2HL7 A;  3PFI A;  4AKG A;  2XD5 A;  4KLN A;  4AG6 A;  3W0L B;  2L7H A;  3TWL A;  4OJ5 A;  1DGB A;  3HJQ A;  5C18 A;  2M5Z A;  1NY5 A;  2Y2O A;  4MGZ E;  3RGS A;  3IG5 A;  3VK7 A;  3JAM S;  4PDG A;  2FOI C;  4DR6 M;  2ERC A;  3E4R A;  3CF2 A;  4JI3 M;  3KSX A;  4WW0 A;  3SHG B;  2C96 A;  4NL4 H;  4IBJ A;  4RNA A;  4OU7 A;  5ITX A;  5EXP A;  1HNX M;  1DO0 A;  2BNK A;  1XMQ M;  1Z5A A;  4I4L A;  1N32 M;  1HQC A;  4FWG A;  4GMQ A;  5FTN A;  1HQY E;  2XH9 A;  1K3X A;  4B3S M;  2KEB A;  1X37 A;  1SXJ E;  3M7G A;  1S3S A;  3FUU A;  2I7N A;  3KS8 A;  3DZD A;  4DUY M;  1N36 M;  5ITT A;  3UJN A;  1Q3B A;  1ZQ9 A;  1FJG M;  4M9S A;  3OTO M;  2L6O A;  4NSO B;  1IY0 A;  2CUZ A;  1IY1 A;  1WXQ A;  2FNA A;  4NXM M;  3KS4 A;  4KOD A;  2YR0 A;  3SAV A;  4P16 A;  3UZU A;  2CV0 A;  5EXS A;  5E26 A;  2Y2N A;  3I4V A;  3PVS A;  4L78 A;  1N34 M;  5DNY A;  2Y2M A;  4JI8 M;  4W5W A;  3GLG B;  2YFQ A;  3FUT A;  3SAW A;  2VII A;  3J2P B;  2CHG A;  3GPY A;  4G4Q A;  4DV3 M;  2FFF B;  1G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...