4IBDA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibdA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibdA02
4IJEA 4IJFA 4IBEA 4IBBA 3L25A 3L2AA 4IBKA 3KS8A 3L29A 4IBIA 3L28A 4IBCA 4IBJA 4LG2A 3FKEA 4GH9A 3L27A 3KS4A 4GHAA 3L26A 4IBFA 4IBGA 5BPVA 4IBDA 4GHLA
chains in the Genus database with same CATH superfamily
3VK8A 3WD3A 3B7NA 5LMNM 3A42A 1XWIA 2H5XA 4MGZE 2HWJA 1IQPA 2HHHM 4M0DA 3V76A 4PCZA 2KNZA 4LFBM 2UU9M 1OGBA 2UWXA 2JZ1A 1H0GA 2XSZD 3W67A 2N35A 3JR4A 2XH9A 5ITRA 3W0LB 2QZ4A 3EIHA 2R18A 3CF2A 1QDRA 3GQ3A 4L15A 1GL6A 4GRIA 3RGSA 2OOAA 3VK7A 4OUIA 3EIEA 4A3VB 1D2NA 2LVPC 2QCUA 2KNAA 1IN8A 4LF7M 2UXCM 3SC3A 3KXEC 2LHCA 5GKNA 3J2PB 1GL7A 1IXRC 2DVWB 1DV0A 2H1RA 2KW0A 2QQ8A 2XF3A 3U6CA 3VKGA 1R5LA 2KA6B 1IXSA 1YU4A 1GPFA 2ZANA 4LRSA 4B3TM 1YUEA 1NHGC 3KW6A 2ZM6M 4DV1M 1AUAA 1GKIA 1OJLA 5A2QS 5F3WA 1MU5A 4MGYE 1IFYA 2JUJA 3U6DA 4S12A 1IN7A 2DAEA 3SYKA 5KO3A 1IBKM 2Y2GA 3SASA 1N33M 4JN6A 2LTUA 3FD9A 5LMUM 4LCBA 1EE8A 5IWAM 2C9CA 3NWLA 5EP4A 2BWBA 5EP3A 3LMMA 4DV4M 4DV6M 2CHQA 3WD1A 4XK8F 1K3WA 3U6SA 3E46A 4DR7M 2OPFA 3D8LA 3T1HM 3LW5F 2VDBB 3U6PA 5ITXE 3AKZA 1ORYB 1HNZM 3KOXE 1XXHA 3KP1E 3U6OA 1E8BA 1IN5A 3T38A 3WHKA 3I4VA 1YU0A 4AZFA 1T43A 3AOEC 4GC5A 1OIZA 3AV0A 4NXMM 1KS0A 1NV9A 2A5YB 2BNKA 3TE6A 1H0IA 4TX8A 2EJSA 4CISA 3KS8A 2AHMA 4IBJA 1LTMA 5FTLA 4AG6A 4GHAA 4L8RC 1PDCA 4LZZA 2KDLA 1XXHE 5FLXS 3M7GA 4AI6A 1W1VA 4WW0A 1YU2A 2Y2OA 1NO1A 3HJSA 4LF6M 4AKIA 5FTMA 2X4AA 1OAOC 1CXWA 3K9OA 3U5ZB 1HT2E 3GLFB 2EA0A 4JI6M 3H4MA 3LVWA 1GXDA 4G3OA 2JY6B 2FNAA 2GQFA 3RGPA 3A45A 2EO2A 4B3SM 3VDPA 2CV2A 2F5PA 4OW0A 1D0MA 4QHSA 2XD5A 1XNQM 2LWXA 4LFAM 3L2AA 4KLNA 1IY1A 1QAQA 4DV3M 1J5EM 1JB0F 3K1JA 2XZFA 3GRRA 4XBOA 4IBIA 5KPRA 1VEKA 4LGMA 4LF4M 1QUTA 2DZNB 2I7NA 5FTJA 4GITA 1G71A 3THGA 4IBGA 3UJNA 2R6FA 1TH3A 3GPUA 1E88A 1Z59A 3GLFE 3PVSA 2G5GX 3HJQA 3LCUA 2J7NA 2XFTA 3T6PA 4YY3M 1N78A 3GLIA 2VF8A 4AW4A 1NHWC 4HMCA 4PDIA 1IY0A 3HGIA 2Y0QA 1IN4A 1NNJA 1HT1E 2YR0A 3B9PA 5FTNA 3GPXA 2UUBM 1PJQA 3MQLA 3DA1A 3PNYA 2K47A 3B74A 5DYIA 3FUTA 3JAMS 3RFWA 3KDSE 4G6ZA 3L29A 3TWKA 1PJJA 2QBYB 1JR3A 1F4IA 1QVRA 4OVZA 4PD2A 2NQ8C 3QAUA 3SATA 4OJOA 5EP1A 1OQYA 4GH9A 4RF0A 1KSFX 4LG2A 4Z2IA 1SXJD 3U6LA 2KHHA 2HAKA 1Q02A 2RKOA 2KZUA 2MGWA 3FYCA 4FWGA 3MHVC 2VQFM 2D49A 5BPVA 3LVVA 4I4LA 3H4JA 4LJ5A 4CHTB 8CATA 3SBJA 3IECA 4OVZB 2QBYA 4FD2A 3U61B 2FOIC 3J7BA 4HMEA 3E9SA 1UR8A 4ZPXA 1K3XA 2L2DA 1ZMVA 2JZ0A 3HY5A 2VIIA 2CFOA 3GO8A 4HL4A 2FH0A 2OQ4A 3SMSA 1EIJA 3WX7A 1J7KA 4LJ8A 1ED7A 4B7HA 4M9XA 1HQYE 1G4AE 3IG5A 3SAVA 3HONA 1XMOM 1OGGA 2Y2IA 3J80S 3SAWA 2MR9A 4GC9A 4FWHA 2D7HA 2Y0TA 2B3TA 2O5RA 3GRYA 5E6JA 2DHRA 1R6BX 1SXJE 4TUWA 4Z2JA 2I7PA 1Z6TA 3GPYA 1QZEA 1QANA 3HKPA 3Q8GA 4HMDA 4Y28F 2DAIA 1IY2A 3HU2A 3BBZA 2L09A 1WGLA 3CGWA 5EXTA 1E6PA 4OJ5A 1G59A 1VQ1A 3J27B 1EAKA 3LQQA 1R2ZA 2CEAA 2DWLA 3TWMA 2FS1A 4R7GA 3ZQJA 2YQZA 2JP7A 3ZC7B 4NZ4A 4KODA 1DO2A 2V1CA 3FUVA 4R3DA 2QPAA 1L1TA 2R44A 1GABA 2CWBA 1OIPA 5JI2E 5KQ8A 3SAUA 4JI1M 1GO5A 2ZAOA 2UUAM 2CUZA 2Q2EB 2L6OA 4IBKA 3W68A 2K6BA 4D81A 4NY2A 1AIPC 3GLFA 4LF9M 4NXNM 4RKUF 2DAGA 2KNVA 1CUKA 2Y20A 2Y21A 4FW9A 2OOBA 4OJPA 1QAOA 3KS4A 4EIWA 5KQDA 5ITTA 4G4NA 4DR2M 1YE9A 4JI0M 3FTEA 1HQCA 2FFFB 2DWMA 1QZMA 2JA2A 3GQ4A 3BOSA 4QOSA 2RRUA 1R4GA 1DGFA 4MH0E 4QHTA 2DZLA 4JI3M 3SHFA 4GIPA 2UUCM 3HSHA 3U61A 4GHLA 4GEWA 4I81A 4RNAA 3VDUA 1GJTA 3ZH9B 3C9PA 3AFHA 3SYLA 2JY5A 4CJ6A 1VDLA 3AL0C 2UXDM 1IBMM 1W1YA 1SG9A 1E32A 2L4FA 1XXHB 2XLJA 1EFUB 3MJ5A 4BLCA 2CV1A 1G41A 2MROB 1N34M 2LVNC 3KP0E 4K0KM 1PGYA 4Z2GA 1OTRA 4DV2M 4CIZA 1YU1A 3HZJA 3MMPA 2LVQD 2DXIA 4JV5M 1IN6A 1G8PA 3J7AS 4AKHA 3KFUG 2LXEA 2CHVA 2Y2LA 4PDGA 3GRVA 1ZV1A 4DUYM 1N75A 3GLIB 2L7HA 2L7IA 2FFJA 4IIWA 2Y2PA 1VEGA 2LNHC 3SFZA 2CV0A 4DUZM 4HEOA 1YU3A 2FE8A 1QO6A 2BWEA 1L1ZA 2JE5A 1UM8A 2R4JA 2ZTDA 4LJ7A 1H8PA 4LGYA 2ZTCA 2Z8YM 1VG5A 4DBGB 3FE3A 5C1BA 4B7FA 4LF8M 3ILKA 5IREB 1Y8GA 1IXSB 2F5SA 3FTDA 1TTEA 1NY5A 1W5TA 5EXSA 4L16A 4OU7A 4NZ5A 3B7ZA 3I04M 4L6V6 4D80A 1ZQ9A 4MB4A 3UGJA 3AOEA 1L8QA 5FSWA 3HHXA 3GLGE 2Z3XA 1XB2B 3W0FA 4LY6A 5EXXA 4QOZC 2R46A 2LHGA 4LF5M 5KPTA 1W5SA 4KT0F 1Q3BA 1WR1B 2JY7A 2KEBA 4IJEA 4OJLA 3U5ZA 4DR1M 4JI8M 5IZ7D 4DR6M 4JI2M 3CF0A 3MK6A 4NYYA 4GMQA 5EQTA 4B7GA 3SARA 3FTFA 2K0BX 1V34A 2QHOB 1XMQM 2APLA 1L2CA 4M9SA 4QNRA 4X62M 4BBAA 1K82A 1TR8A 3GLIE 2JY8A 1P3QQ 2R4EA 4DR4M 3WD0A 3DZDA 2LH0A 1KYIA 3M7PA 1I94M 4Z2KA 1Z5CA 3BXWA 3HHWA 3L27A 2V1UA 4I5SA 2CP8A 5FTKA 3C3EA 2VF7A 3UK6A 1N77A 1NJGA 1PJSA 3HJ8A 4LJ6A 2XGNA 1DGHA 4WP2A 4BB9A 4NYUA 4G4OA 2LBCA 1TF0B 5DNYA 4NL4H 2D7GA 4DV7M 2HL7A 1OFIA 2DAKA 2DWNA 1QAMA 4Z8XA 5E26A 4MGHA 3B89A 3KSXA 4FCVA 1HNXM 4NRWA 1DO0A 4HLQA 2G8LA 2C99A 3PNVA 1HR0M 2FN2A 4X66M 1XNRM 2WSCF 3ZCBB 3SHGB 1T3TA 1R7RA 2J7OA 2C9OA 4MM3B 1YSYA 1YLAA 4FCTA 4F1IA 4JYAM 4UN2B 2MH8A 5BR8M 3E21A 1I4WA 3JR5A 4GKKM 3L26A 4M0WA 2Y2KA 4GKJM 4NZ3A 1E6NA 4Z2HA 2DZOB 1C1KA 1WGNA 1WJ7A 3I01M 2IOUA 4B3MM 2R45A 3CF6E 4DR5M 1N36M 2EKKA 1Q39A 1D0LA 3GLHE 3U6EA 2DENA 1MJGM 1OKSA 4L78A 4ITQA 1NJFA 3OTOM 4LJ9A 2RGOA 4IBEA 4MGIE 3SMPA 4AG5A 4G4QA 3K2LA 1PRBA 1E9SA 2X8AA 2DHYA 3AOGA 2JNHA 5ITXA 1TDHA 1JR3E 2RTSA 4Z6YA 1O6IA 4F2LA 3L28A 1PJTA 2LVAA 4WURA 2XZUA 1TDZA 4ANRA 2KXEA 4NOOB 2XEPA 1ZAEA 3FKEA 3TWLA 4I8OA 4LFCM 3IHPA 1QUSA 1G3IA 3HX3A 4MGKE 3GLHA 4IBFA 1FJGM 4NSOB 3FTCA 5DYGA 2OO9A 2MJ5B 1L2BA 3IG8A 5ITYA 3F92A 4L4UA 2KRUA 2GNOA 4X64M 3HHZA 3VFDA 4B3RM 3VLFB 3R9XB 1V92A 3HU3A 5KPZA 1E15A 2VQEM 3GLGA 5ITQA 4DV0M 2C96A 1QQWA 1SXJA 4FVMA 2K9DA 2F5NA 4JI4M 4LJ4A 2KRKA 2Z4RA 2JXNA 3J81S 1WIVA 2WSEF 1Z5AA 2O01F 3FUUA 1A5TA 3HWSA 1IXZA 2ERCA 3I4YA 3NBXX 2DAMA 4CGYB 1TH2A 2EKFA 4KHPM 4IBCA 2M5ZA 3R8FA 3K9PA 1GJSA 2DI0A 4MB3A 4OJ6A 5ITUA 3KSJA 3FRHA 3RE8A 4X65M 4NC6A 7CATA 4QNMA 2Z7JA 4R71A 4REZA 3WD4A 2Z4SA 3KOWE 1MN3A 4IBDA 4G4RA 1E6ZA 4W5WA 1WHCA 4JI5M 2BJVA 1XC8A 4QNLA 1MX0A 3QYEA 3C3DA 4PT5A 2DNAA 4IJFA 4AKGA 3A98B 2YNMD 4D82A 1JR3D 4OX9M 4FWDA 3D8BA 4JI7M 3KOYE 1JQJC 2CHGA 4P16A 3GLGB 2CRUA 3UMMA 4Q7JA 1D0KA 1TGUA 1E6RA 2Y2HA 3FRIA 1NV8A 2QNJA 4DV5M 1OAIA 1KFVA 1WXQA 1VDDA 1C7YA 4XGIA 3U60B 4DR3M 4LJAA 3AJIB 3LCVB 4NZ1A 1V33A 2LVOC 2W82A 3M0EA 2DWZB 1J09A 4AQYM 1PM5A 3LQRA 3GLHB 1YUBA 2HKJA 5JI3E 1W1TA 2C98A 2Y2NA 1PJIA 3HU1A 3CTWB 2HCBA 1IBLM 1NNUC 2KZSA 2WZJA 3PXGA 3DOAA 1N32M 2F5QA 4M9ZA 1LV7A 4NRVA 2R65A 1QDTA 3N3FA 5DFLA 3WD2A 1GVNA 3T15A 2F4VM 3NBIA 2BG1A 2QENA 5EP2A 1E9RA 3K92A 1BVSA 2JWSA 2F5OA 3WHLA 3VKHA 1DGGA 4IBBA 1OFHA 3PFIA 2V5OA 1AIWA 3U60A 3L25A 1ZMUA 1UFZA 2X49A 3DFZA 3GRUA 3Q8XA 3GPPA 3KVWA 1L2DA 1HNWM 1W1PA 1T6OA 1E94E 1SXJC 1ZMWA 4MB7A 1NY6A 2EUCA 5EJCA 5C18A 2QP9X 5L8RF 2C5RA 2QSFX 2CE7A 2XFSA 1CK7A 3QYBA 4P17A 4MB5A 3TQSA 1NSFA 4YHHM 3KOZE 2Y2MA 2L4EA 2Y2JA 2YFQA 4JXJA 2R0IA 1GLNA 1TH4A 1L6JA 2O25A 2G3QA 3A46A 1UR9A 3U6MA 1QYRA 2P5TA 2RGHA 1X37A 2V6ZM 2XD1A 1R2YA 3FUXA 2XSZA 4LZJA 2M60A 2JCHA 5IT9S 1GOIA 4Z2LA 3U6QA 3I51A 1NVMA 1FNNA 1Q3CA 3M6AA 5H37D 3TL4X 3QWLA 3C58A 3GQ5A 4FCWA 2ZBKB 3GP1A 4RF1A 1IM2A 4B08A 1S3SA 1VEJA 1Z5BA 1DGHB 1XHBA 4KO8A 3T1YM 2E5LM 1RU3A 3E4RA 1SXJB 3FYDA 4LRTA 1H6UA 2DKLA 3FUWA 1HJPA 4NSRA 3TPZA 5EXPA 2UXBM 2WSFF 2Y2QA 1DGBA 2D7EA 3K8ZA 3UZUA 1J7MA 2J5YA 2R62A 2ZAMA 3HHYA 2BJWA 3B7QA 4II7A
chains in the Genus database with same CATH topology
3VK8A 5LMNM 3A42A 1XWIA 4MGZE 1IQPA 2HHHM 4M0DA 4PCZA 4LFBM 2UU9M 2UWXA 2XSZD 3JR4A 2XH9A 5ITRA 3W0LB 2QZ4A 3EIHA 2R18A 3CF2A 3GQ3A 4L15A 1GL6A 4GRIA 3RGSA 4OUIA 3VK7A 3EIEA 4A3VB 1D2NA 2QCUA 4LF7M 1IN8A 2UXCM 3SC3A 3KXEC 5GKNA 3J2PB 1GL7A 1IXRC 2DVWB 2H1RA 2KW0A 3U6CA 2XF3A 3VKGA 2KA6B 1YU4A 2ZANA 4LRSA 4B3TM 1YUEA 1NHGC 3KW6A 2ZM6M 4DV1M 5F3WA 1GKIA 1OJLA 5A2QS 1MU5A 4MGYE 3U6DA 4S12A 1IN7A 3SYKA 5KO3A 1IBKM 2Y2GA 3SASA 1N33M 4JN6A 3FD9A 5LMUM 4LCBA 1EE8A 5IWAM 2C9CA 3NWLA 5EP4A 5EP3A 3LMMA 4DV4M 4DV6M 2CHQA 1K3WA 3U6SA 4DR7M 2OPFA 3D8LA 3T1HM 3U6PA 5ITXE 3AKZA 1ORYB 1HNZM 3KOXE 1XXHA 3KP1E 3U6OA 1IN5A 3T38A 3WHKA 3I4VA 1YU0A 4AZFA 3AOEC 4GC5A 3AV0A 4NXMM 2A5YB 2BNKA 3TE6A 3KS8A 4CISA 2AHMA 4IBJA 5FTLA 4AG6A 4GHAA 4L8RC 4LZZA 5FLXS 3M7GA 4AI6A 1YU2A 4WW0A 2Y2OA 4LF6M 3HJSA 4AKIA 5FTMA 2X4AA 3U5ZB 1HT2E 3GLFB 2EA0A 4JI6M 3H4MA 3LVWA 2FNAA 3RGPA 3A45A 2EO2A 4B3SM 3VDPA 2CV2A 2F5PA 4OW0A 4QHSA 2XD5A 1XNQM 2LWXA 4LFAM 3L2AA 4KLNA 1IY1A 1QAQA 4DV3M 1J5EM 3K1JA 4LF8M 2XZFA 3GRRA 4XBOA 4IBIA 5KPRA 4LF4M 4LGMA 2DZNB 2I7NA 5FTJA 4GITA 3THGA 4IBGA 3UJNA 3GPUA 1TH3A 1Z59A 3PVSA 2G5GX 3HJQA 2XFTA 2J7NA 4YY3M 1N78A 3GLIA 4AW4A 1NHWC 4PDIA 1IY0A 3HGIA 2Y0QA 1IN4A 1NNJA 1HT1E 2YR0A 3B9PA 5FTNA 3GPXA 2UUBM 3DA1A 3PNYA 2K47A 5DYIA 3FUTA 3JAMS 3RFWA 3KDSE 4G6ZA 3L29A 3TWKA 1PJJA 2QBYB 1JR3A 1QVRA 4OVZA 4PD2A 2NQ8C 3QAUA 3SATA 4OJOA 5EP1A 4RF0A 4GH9A 4LG2A 1KSFX 1SXJD 3U6LA 2RKOA 2KZUA 3FYCA 4FWGA 3MHVC 2VQFM 5BPVA 3LVVA 4I4LA 4LJ5A 4CHTB 8CATA 3SBJA 4OVZB 2QBYA 4FD2A 3U61B 2FOIC 3J7BA 3E9SA 4ZPXA 1K3XA 2VIIA 2CFOA 3GO8A 4HL4A 2OQ4A 3WX7A 3SMSA 1J7KA 4LJ8A 4B7HA 4M9XA 1HQYE 1G4AE 3IG5A 3SAVA 3HONA 1XMOM 2Y2IA 3J80S 3SAWA 4GC9A 4FWHA 2D7HA 2Y0TA 3GRYA 2O5RA 5E6JA 2DHRA 1R6BX 1SXJE 4TUWA 2I7PA 1Z6TA 3GPYA 1QANA 3HKPA 1IY2A 3HU2A 2L09A 5EXTA 4OJ5A 1G59A 3J27B 3LQQA 1R2ZA 2CEAA 2DWLA 3TWMA 4R7GA 2YQZA 3ZC7B 4NZ4A 4KODA 1DO2A 2V1CA 3FUVA 4R3DA 2QPAA 1L1TA 5JI2E 4JI1M 5KQ8A 3SAUA 2ZAOA 2UUAM 2CUZA 2Q2EB 2L6OA 4IBKA 4D81A 4NY2A 3GLFA 4LF9M 4NXNM 2Y20A 2Y21A 4FW9A 4OJPA 1QAOA 3KS4A 4EIWA 5KQDA 5ITTA 4G4NA 4DR2M 1YE9A 4JI0M 3FTEA 1HQCA 2FFFB 2DWMA 1QZMA 2JA2A 3GQ4A 3BOSA 4QOSA 1DGFA 4MH0E 4QHTA 3SHFA 4JI3M 4GIPA 2UUCM 3HSHA 3U61A 4GHLA 4I81A 4RNAA 3VDUA 3ZH9B 3AFHA 3SYLA 3AL0C 2UXDM 1IBMM 1E32A 2XLJA 1XXHB 3MJ5A 4BLCA 2CV1A 1G41A 1N34M 4K0KM 3KP0E 4DV2M 1YU1A 2DXIA 4JV5M 1IN6A 1G8PA 3J7AS 4AKHA 3KFUG 2LXEA 2CHVA 2Y2LA 4PDGA 3GRVA 4DUYM 1N75A 3GLIB 2L7HA 2L7IA 2FFJA 4IIWA 2Y2PA 2LNHC 3SFZA 2CV0A 4DUZM 1YU3A 2FE8A 1L1ZA 2JE5A 1UM8A 2R4JA 4LJ7A 4LGYA 5C1BA 4B7FA 3ILKA 5IREB 2F5SA 1IXSB 3FTDA 1NY5A 1W5TA 5EXSA 4L16A 4OU7A 4NZ5A 4D80A 1ZQ9A 3UGJA 3AOEA 1L8QA 5FSWA 3HHXA 2Z3XA 3W0FA 4LY6A 5EXXA 4QOZC 2R46A 4LF5M 5KPTA 1W5SA 1Q3BA 2KEBA 4OJLA 4IJEA 3U5ZA 4DR1M 4JI8M 5IZ7D 4DR6M 4JI2M 3CF0A 3MK6A 4NYYA 4GMQA 5EQTA 4B7GA 3SARA 3FTFA 1XMQM 1L2CA 4M9SA 4QNRA 4X62M 4BBAA 1K82A 2R4EA 4DR4M 3DZDA 2LH0A 1KYIA 1I94M 1Z5CA 3HHWA 3L27A 2V1UA 4I5SA 5FTKA 3UK6A 1N77A 1NJGA 3HJ8A 4LJ6A 2XGNA 1DGHA 4BB9A 4NYUA 4G4OA 5DNYA 4NL4H 2D7GA 4DV7M 2HL7A 1OFIA 2DWNA 1QAMA 4Z8XA 5E26A 4MGHA 3KSXA 4FCVA 1HNXM 4NRWA 1DO0A 4HLQA 2G8LA 2C99A 3PNVA 1HR0M 4X66M 1XNRM 3ZCBB 3SHGB 1T3TA 1R7RA 2J7OA 2C9OA 4MM3B 1YSYA 4FCTA 4JYAM 5BR8M 1I4WA 3JR5A 4GKKM 3L26A 4M0WA 2Y2KA 4GKJM 4NZ3A 2DZOB 1C1KA 2IOUA 4B3MM 2R45A 3CF6E 4DR5M 1N36M 1Q39A 3U6EA 4L78A 4ITQA 1NJFA 3OTOM 4LJ9A 2RGOA 4IBEA 4MGIE 3SMPA 4AG5A 4G4QA 3K2LA 2X8AA 1E9SA 3AOGA 5ITXA 1TDHA 4Z6YA 3L28A 4WURA 2XZUA 1TDZA 2KXEA 4NOOB 2XEPA 1ZAEA 3FKEA 3TWLA 4I8OA 1G3IA 4MGKE 3GLHA 4IBFA 1FJGM 4NSOB 3FTCA 5DYGA 1L2BA 3IG8A 5ITYA 4L4UA 4X64M 2KRUA 3HHZA 4B3RM 3VFDA 3VLFB 3R9XB 3HU3A 5KPZA 2VQEM 3GLGA 5ITQA 4DV0M 2C96A 1QQWA 1SXJA 4FVMA 4JI4M 2F5NA 4LJ4A 2KRKA 2Z4RA 3J81S 1Z5AA 3FUUA 4CGYB 3HWSA 4LFCM 1IXZA 2ERCA 3I4YA 4KHPM 1TH2A 4IBCA 2M5ZA 3R8FA 4OJ6A 5ITUA 3KSJA 3RE8A 4X65M 7CATA 4QNMA 2Z7JA 4REZA 2Z4SA 3KOWE 4IBDA 4G4RA 4W5WA 4JI5M 2BJVA 1XC8A 4QNLA 1MX0A 4PT5A 4IJFA 4AKGA 3A98B 2YNMD 4D82A 1JR3D 4OX9M 4FWDA 3D8BA 4JI7M 3KOYE 1JQJC 2CHGA 4P16A 3GLGB 3UMMA 2Y2HA 1TGUA 4DV5M 1KFVA 1WXQA 1VDDA 4XGIA 3U60B 4DR3M 4LJAA 3AJIB 4NZ1A 2W82A 3M0EA 2DWZB 1J09A 4AQYM 1PM5A 3LQRA 3GLHB 1YUBA 2HKJA 5JI3E 2C98A 2Y2NA 1PJIA 3HU1A 3CTWB 2HCBA 1IBLM 1NNUC 2KZSA 3PXGA 3DOAA 1N32M 2F5QA 4M9ZA 1LV7A 4NRVA 2R65A 3N3FA 1GVNA 3T15A 2F4VM 3NBIA 2BG1A 2QENA 5EP2A 1E9RA 3K92A 2F5OA 3WHLA 3VKHA 1DGGA 4IBBA 1OFHA 3PFIA 3U60A 3L25A 3DFZA 2X49A 3Q8XA 3GPPA 3GRUA 1L2DA 1HNWM 3KVWA 1E94E 1SXJC 4MB7A 1NY6A 2EUCA 5EJCA 5C18A 2QP9X 2C5RA 2CE7A 2XFSA 3TQSA 1NSFA 4YHHM 3KOZE 2Y2MA 2Y2JA 2YFQA 4JXJA 1GLNA 1TH4A 3A46A 3U6MA 1QYRA 2P5TA 2RGHA 1X37A 2V6ZM 2XD1A 1R2YA 3FUXA 2XSZA 4LZJA 2M60A 2JCHA 5IT9S 3U6QA 1NVMA 1FNNA 1Q3CA 3M6AA 5H37D 3TL4X 3QWLA 3C58A 3GQ5A 4FCWA 2ZBKB 3GP1A 4RF1A 1IM2A 4B08A 1S3SA 1Z5BA 1DGHB 1XHBA 4KO8A 3T1YM 2E5LM 3E4RA 1SXJB 3FYDA 4LRTA 1H6UA 3FUWA 4NSRA 3TPZA 2UXBM 5EXPA 2Y2QA 3K8ZA 1DGBA 2D7EA 3UZUA 2R62A 2ZAMA 3HHYA 2BJWA 3I51A 4II7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJE A;  4IJF A;  4IBE A;  4IBB A;  3L25 A;  3L2A A;  4IBK A;  3KS8 A;  3L29 A;  4IBI A;  3L28 A;  4IBC A;  4IBJ A;  4LG2 A;  3FKE A;  4GH9 A;  3L27 A;  3KS4 A;  4GHA A;  3L26 A;  4IBF A;  4IBG A;  5BPV A;  4IBD A;  4GHL A; 
#chains in the Genus database with same CATH topology
 3VK8 A;  3WD3 A;  3B7N A;  5LMN M;  3A42 A;  1XWI A;  2H5X A;  4MGZ E;  2HWJ A;  1IQP A;  2HHH M;  4M0D A;  3V76 A;  4PCZ A;  2KNZ A;  4LFB M;  2UU9 M;  1OGB A;  2UWX A;  2JZ1 A;  1H0G A;  2XSZ D;  3W67 A;  2N35 A;  3JR4 A;  2XH9 A;  5ITR A;  3W0L B;  2QZ4 A;  3EIH A;  2R18 A;  3CF2 A;  1QDR A;  3GQ3 A;  4L15 A;  1GL6 A;  4GRI A;  3RGS A;  2OOA A;  3VK7 A;  4OUI A;  3EIE A;  4A3V B;  1D2N A;  2LVP C;  2QCU A;  2KNA A;  1IN8 A;  4LF7 M;  2UXC M;  3SC3 A;  3KXE C;  2LHC A;  5GKN A;  3J2P B;  1GL7 A;  1IXR C;  2DVW B;  1DV0 A;  2H1R A;  2KW0 A;  2QQ8 A;  2XF3 A;  3U6C A;  3VKG A;  1R5L A;  2KA6 B;  1IXS A;  1YU4 A;  1GPF A;  2ZAN A;  4LRS A;  4B3T M;  1YUE A;  1NHG C;  3KW6 A;  2ZM6 M;  4DV1 M;  1AUA A;  1GKI A;  1OJL A;  5A2Q S;  5F3W A;  1MU5 A;  4MGY E;  1IFY A;  2JUJ A;  3U6D A;  4S12 A;  1IN7 A;  2DAE A;  3SYK A;  5KO3 A;  1IBK M;  2Y2G A;  3SAS A;  1N33 M;  4JN6 A;  2LTU A;  3FD9 A;  5LMU M;  4LCB A;  1EE8 A;  5IWA M;  2C9C A;  3NWL A;  5EP4 A;  2BWB A;  5EP3 A;  3LMM A;  4DV4 M;  4DV6 M;  2CHQ A;  3WD1 A;  4XK8 F;  1K3W A;  3U6S A;  3E46 A;  4DR7 M;  2OPF A;  3D8L A;  3T1H M;  3LW5 F;  2VDB B;  3U6P A;  5ITX E;  3AKZ A;  1ORY B;  1HNZ M;  3KOX E;  1XXH A;  3KP1 E;  3U6O A;  1E8B A;  1IN5 A;  3T38 A;  3WHK A;  3I4V A;  1YU0 A;  4AZF A;  1T43 A;  3AOE C;  4GC5 A;  1OIZ A;  3AV0 A;  4NXM M;  1KS0 A;  1NV9 A;  2A5Y B;  2BNK A;  3TE6 A;  1H0I A;  4TX8 A;  2EJS A;  4CIS A;  3KS8 A;  2AHM A;  4IBJ A;  1LTM A;  5FTL A;  4AG6 A;  4GHA A;  4L8R C;  1PDC A;  4LZZ A;  2KDL A;  1XXH E;  5FLX S;  3M7G A;  4AI6 A;  1W1V A;  4WW0 A;  1YU2 A;  2Y2O A;  1NO1 A;  3HJS A;  4LF6 M;  4AKI A;  5FTM A;  2X4A A;  1OAO C;  1CXW A;  3K9O A;  3U5Z B;  1HT2 E;  3GLF B;  2EA0 A;  4JI6 M;  3H4M A;  3LVW A;  1GXD A;  4G3O A;  2JY6 B;  2FNA A;  2GQF A;  3RGP A;  3A45 A;  2EO2 A;  4B3S M;  3VDP A;  2CV2 A;  2F5P A;  4OW0 A;  1D0M A;  4QHS A;  2XD5 A;  1XNQ M;  2LWX A;  4LFA M;  3L2A A;  4KLN A;  1IY1 A;  1QAQ A;  4DV3 M;  1J5E M;  1JB0 F;  3K1J A;  2XZF A;  3GRR A;  4XBO A;  4IBI A;  5KPR A;  1VEK A;  4LGM A;  4LF4 M;  1QUT A;  2DZN B;  2I7N A;  5FTJ A;  4GIT A;  1G71 A;  3THG A;  4IBG A;  3UJN A;  2R6F A;  1TH3 A;  3GPU A;  1E88 A;  1Z59 A;  3GLF E;  3PVS A;  2G5G X;  3HJQ A;  3LCU A;  2J7N A;  2XFT A;  3T6P A;  4YY3 M;  1N78 A;  3GLI A;  2VF8 A;  4AW4 A;  1NHW C;  4HMC A;  4PDI A;  1IY0 A;  3HGI A;  2Y0Q A;  1IN4 A;  1NNJ A;  1HT1 E;  2YR0 A;  3B9P A;  5FTN A;  3GPX A;  2UUB M;  1PJQ A;  3MQL A;  3DA1 A;  3PNY A;  2K47 A;  3B74 A;  5DYI A;  3FUT A;  3JAM S;  3RFW A;  3KDS E;  4G6Z A;  3L29 A;  3TWK A;  1PJJ A;  2QBY B;  1JR3 A;  1F4I A;  1QVR A;  4OVZ A;  4PD2 A;  2NQ8 C;  3QAU A;  3SAT A;  4OJO A;  5EP1 A;  1OQY A;  4GH9 A;  4RF0 A;  1KSF X;  4LG2 A;  4Z2I A;  1SXJ D;  3U6L A;  2KHH A;  2HAK A;  1Q02 A;  2RKO A;  2KZU A;  2MGW A;  3FYC A;  4FWG A;  3MHV C;  2VQF M;  2D49 A;  5BPV A;  3LVV A;  4I4L A;  3H4J A;  4LJ5 A;  4CHT B;  8CAT A;  3SBJ A;  3IEC A;  4OVZ B;  2QBY A;  4FD2 A;  3U61 B;  2FOI C;  3J7B A;  4HME A;  3E9S A;  1UR8 A;  4ZPX A;  1K3X A;  2L2D A;  1ZMV A;  2JZ0 A;  3HY5 A;  2VII A;  2CFO A;  3GO8 A;  4HL4 A;  2FH0 A;  2OQ4 A;  3SMS A;  1EIJ A;  3WX7 A;  1J7K A;  4LJ8 A;  1ED7 A;  4B7H A;  4M9X A;  1HQY E;  1G4A E;  3IG5 A;  3SAV A;  3HON A;  1XMO M;  1OGG A;  2Y2I A;  3J80 S;  3SAW A;  2MR9 A;  4GC9 A;  4FWH A;  2D7H A;  2Y0T A;  2B3T A;  2O5R A;  3GRY A;  5E6J A;  2DHR A;  1R6B X;  1SXJ E;  4TUW A;  4Z2J A;  2I7P A;  1Z6T A;  3GPY A;  1QZE A;  1QAN A;  3HKP A;  3Q8G A;  4HMD A;  4Y28 F;  2DAI A;  1IY2 A;  3HU2 A;  3BBZ A;  2L09 A;  1WGL A;  3CGW A;  5EXT A;  1E6P A;  4OJ5 A;  1G59 A;  1VQ1 A;  3J27 B;  1EAK A;  3LQQ A;  1R2Z A;  2CEA A;  2DWL A;  3TWM A;  2FS1 A;  4R7G A;  3ZQJ A;  2YQZ A;  2JP7 A;  3ZC7 B;  4NZ4 A;  4KOD A;  1DO2 A;  2V1C A;  3FUV A;  4R3D A;  2QPA A;  1L1T A;  2R44 A;  1GAB A;  2CWB A;  1OIP A;  5JI2 E;  5KQ8 A;  3SAU A;  4JI1 M;  1GO5 A;  2ZAO A;  2UUA M;  2CUZ A;  2Q2E B;  2L6O A;  4IBK A;  3W68 A;  2K6B A;  4D81 A;  4NY2 A;  1AIP C;  3GLF A;  4LF9 M;  4NXN M;  4RKU F;  2DAG A;  2KNV A;  1CUK A;  2Y20 A;  2Y21 A;  4FW9 A;  2OOB A;  4OJP A;  1QAO A;  3KS4 A;  4EIW A;  5KQD A;  5ITT A;  4G4N A;  4DR2 M;  1YE9 A;  4JI0 M;  3FTE A;  1HQC A;  2FFF B;  2DWM A;  1QZM A;  2JA2 A;  3GQ4 A;  3BOS A;  4QOS A;  2RRU A;  1R4G A;  1DGF A;  4MH0 E;  4QHT A;  2DZL A;  4JI3 M;  3SHF A;  4GIP A;  2UUC M;  3HSH A;  3U61 A;  4GHL A;  4GEW A;  4I81 A;  4RNA A;  3VDU A;  1GJT A;  3ZH9 B;  3C9P A;  3AFH A;  3SYL A;  2JY5 A;  4CJ6 A;  1VDL A;  3AL0 C;  2UXD M;  1IBM M;  1W1Y A;  1SG9 A;  1E32 A;  2L4F A;  1XXH B;  2XLJ A;  1EFU B;  3MJ5 A;  4BLC A;  2CV1 A;  1G41 A;  2MRO B;  1N34 M;  2LVN C;  3KP0 E;  4K0K M;  1PGY A;  4Z2G A;  1OTR A;  4DV2 M;  4CIZ A;  1YU1 A;  3HZJ A;  3MMP A;  2LVQ D;  2DXI A;  4JV5 M;  1IN6 A;  1G8P A;  3J7A S;  4AKH A;  3KFU G;  2LXE A;  2CHV A;  2Y2L A;  4PDG A;  3GRV A;  1ZV1 A;  4DUY M;  1N75 A;  3GLI B;  2L7H A;  2L7I A;  2FFJ A;  4IIW A;  2Y2P A;  1VEG A;  2LNH C;  3SFZ A;  2CV0 A;  4DUZ M;  4HEO A;  1YU3 A;  2FE8 A;  1QO6 A;  2BWE A;  1L1Z A;  2JE5 A;  1UM8 A;  2R4J A;  2ZTD A;  4LJ7 A;  1H8P A;  4LGY A;  2ZTC A;  2Z8Y M;  1VG5 A;  4DBG B;  3FE3 A;  5C1B A;  4B7F A;  4LF8 M;  3ILK A;  5IRE B;  1Y8G A;  1IXS B;  2F5S A;  3FTD A;  1TTE A;  1NY5 A;  1W5T A;  5EXS A;  4L16 A;  4OU7 A;  4NZ5 A;  3B7Z A;  3I04 M;  4L6V 6;  4D80 A;  1ZQ9 A;  4MB4 A;  3UGJ A;  3AOE A;  1L8Q A;  5FSW A;  3HHX A;  3GLG E;  2Z3X A;  1XB2 B;  3W0F A;  4LY6 A;  5EXX A;  4QOZ C;  2R46 A;  2LHG A;  4LF5 M;  5KPT A;  1W5S A;  4KT0 F;  1Q3B A;  1WR1 B;  2JY7 A;  2KEB A;  4IJE A;  4OJL A;  3U5Z A;  4DR1 M;  4JI8 M;  5IZ7 D;  4DR6 M;  4JI2 M;  3CF0 A;  3MK6 A;  4NYY A;  4GMQ A;  5EQT A;  4B7G A;  3SAR A;  3FTF A;  2K0B X;  1V34 A;  2QHO B;  1XMQ M;  2APL A;  1L2C A;  4M9S A;  4QNR A;  4X62 M;  4BBA A;  1K82 A;  1TR8 A;  3GLI E;  2JY8 A;  1P3Q Q;  2R4E A;  4DR4 M;  3WD0 A;  3DZD A;  2LH0 A;  1KYI A;  3M7P A;  1I94 M;  4Z2K A;  1Z5C A;  3BXW A;  3HHW A;  3L27 A;  2V1U A;  4I5S A;  2CP8 A;  5FTK A;  3C3E A;  2VF7 A;  3UK6 A;  1N77 A;  1NJG A;  1PJS A;  3HJ8 A;  4LJ6 A;  2XGN A;  1DGH A;  4WP2 A;  4BB9 A;  4NYU A;  4G4O A;  2LBC A;  1TF0 B;  5DNY A;  4NL4 H;  2D7G A;  4DV7 M;  2HL7 A;  1OFI A;  2DAK A;  2DWN A;  1QAM A;  4Z8X A;  5E26 A;  4MGH A;  3B89 A;  3KSX A;  4FCV A;  1HNX M;  4NRW A;  1DO0 A;  4HLQ A;  2G8L A;  2C99 A;  3PNV A;  1HR0 M;  2FN2 A;  4X66 M;  1XNR M;  2WSC F;  3ZCB B;  3SHG B;  1T3T A;  1R7R A;  2J7O A;  2C9O A;  4MM3 B;  1YSY A;  1YLA A;  4FCT A;  4F1I A;  4JYA M;  4UN2 B;  2MH8 A;  5BR8 M;  3E21 A;  1I4W A;  3JR5 A;  4GKK M;  3L26 A;  4M0W A;  2Y2K A;  4GKJ M;  4NZ3 A;  1E6N A;  4Z2H A;  2DZO B;  1C1K A;  1WGN A;  1WJ7 A;  3I01 M;  2IOU A;  4B3M M;  2R45 A;  3CF6 E;  4DR5 M;  1N36 M;  2EKK A;  1Q39 A;  1D0L A;  3GLH E;  3U6E A;  2DEN A;  1MJG M;  1OKS A;  4L78 A;  4ITQ A;  1NJF A;  3OTO M;  4LJ9 A;  2RGO A;  4IBE A;  4MGI E;  3SMP A;  4AG5 A;  4G4Q A;  3K2L A;  1PRB A;  1E9S A;  2X8A A;  2DHY A;  3AOG A;  2JNH A;  5ITX A;  1TDH A;  1JR3 E;  2RTS A;  4Z6Y A;  1O6I A;  4F2L A;  3L28 A;  1PJT A;  2LVA A;  4WUR A;  2XZU A;  1TDZ A;  4ANR A;  2KXE A;  4NOO B;  2XEP A;  1ZAE A;  3FKE A;  3TWL A;  4I8O A;  4LFC M;  3IHP A;  1QUS A;  1G3I A;  3HX3 A;  4MGK E;  3GLH A;  4IBF A;  1FJG M;  4NSO B;  3FTC A;  5DYG A;  2OO9 A;  2MJ5 B;  1L2B A;  3IG8 A;  5ITY A;  3F92 A;  4L4U A;  2KRU A;  2GNO A;  4X64 M;  3HHZ A;  3VFD A;  4B3R M;  3VLF B;  3R9X B;  1V92 A;  3HU3 A;  5KPZ A;  1E15 A;  2VQE M;  3GLG A;  5ITQ A;  4DV0 M;  2C96 A;  1QQW A;  1SXJ A;  4FVM A;  2K9D A;  2F5N A;  4JI4 M;  4LJ4 A;  2KRK A;  2Z4R A;  2JXN A;  3J81 S;  1WIV A;  2WSE F;  1Z5A A;  2O01 F;  3FUU A;  1A5T A;  3HWS A;  1IXZ A;  2ERC A;  3I4Y A;  3NBX X;  2DAM A;  4CGY B;  1TH2 A;  2EKF A;  4KHP M;  4IBC A;  2M5Z A;  3R8F A;  3K9P A;  1GJS A;  2DI0 A;  4MB3 A;  4OJ6 A;  5ITU A;  3KSJ A;  3FRH A;  3RE8 A;  4X65 M;  4NC6 A;  7CAT A;  4QNM A;  2Z7J A;  4R71 A;  4REZ A;  3WD4 A;  2Z4S A;  3KOW E;  1MN3 A;  4IBD A;  4G4R A;  1E6Z A;  4W5W A;  1WHC A;  4JI5 M;  2BJV A;  1XC8 A;  4QNL A;  1MX0 A;  3QYE A;  3C3D A;  4PT5 A;  2DNA A;  4IJF A;  4AKG A;  3A98 B;  2YNM D;  4D82 A;  1JR3 D;  4OX9 M;  4FWD A;  3D8B A;  4JI7 M;  3KOY E;  1JQJ C;  2CHG A;  4P16 A;  3GLG B;  2CRU A;  3UMM A;  4Q7J A;  1D0K A;  1TGU A;  1E6R A;  2Y2H A;  3FRI A;  1NV8 A;  2QNJ A;  4DV5 M;  1OAI A;  1KFV A;  1WXQ A;  1VDD A;  1C7Y A;  4XGI A;  3U60 B;  4DR3 M;  4LJA A;  3AJI B;  3LCV B;  4NZ1 A;  1V33 A;  2LVO C;  2W82 A;  3M0E A;  2DWZ B;  1J09 A;  4AQY M;  1PM5 A;  3LQR A;  3GLH B;  1YUB A;  2HKJ A;  5JI3 E;  1W1T A;  2C98 A;  2Y2N A;  1PJI A;  3HU1 A;  3CTW B;  2HCB A;  1IBL M;  1NNU C;  2KZS A;  2WZJ A;  3PXG A;  3DOA A;  1N32 M;  2F5Q A;  4M9Z A;  1LV7 A;  4NRV A;  2R65 A;  1QDT A;  3N3F A;  5DFL A;  3WD2 A;  1GVN A;  3T15 A;  2F4V M;  3NBI A;  2BG1 A;  2QEN A;  5EP2 A;  1E9R A;  3K92 A;  1BVS A;  2JWS A;  2F5O A;  3WHL A;  3VKH A;  1DGG A;  4IBB A;  1OFH A;  3PFI A;  2V5O A;  1AIW A;  3U60 A;  3L25 A;  1ZMU A;  1UFZ A;  2X49 A;  3DFZ A;  3GRU A;  3Q8X A;  3GPP A;  3KVW A;  1L2D A;  1HNW M;  1W1P A;  1T6O A;  1E94 E;  1SXJ C;  1ZMW A;  4MB7 A;  1NY6 A;  2EUC A;  5EJC A;  5C18 A;  2QP9 X;  5L8R F;  2C5R A;  2QSF X;  2CE7 A;  2XFS A;  1CK7 A;  3QYB A;  4P17 A;  4MB5 A;  3TQS A;  1NSF A;  4YHH M;  3KOZ E;  2Y2M A;  2L4E A;  2Y2J A;  2YFQ A;  4JXJ A;  2R0I A;  1GLN A;  1TH4 A;  1L6J A;  2O25 A;  2G3Q A;  3A46 A;  1UR9 A;  3U6M A;  1QYR A;  2P5T A;  2RGH A;  1X37 A;  2V6Z M;  2XD1 A;  1R2Y A;  3FUX A;  2XSZ A;  4LZJ A;  2M60 A;  2JCH A;  5IT9 S;  1GOI A;  4Z2L A;  3U6Q A;  3I51 A;  1NVM A;  1FNN A;  1Q3C A;  3M6A A;  5H37 D;  3TL4 X;  3QWL A;  3C58 A;  3GQ5 A;  4FCW A;  2ZBK B;  3GP1 A;  4RF1 A;  1IM2 A;  4B08 A;  1S3S A;  1VEJ A;  1Z5B A;  1DGH B;  1XHB A;  4KO8 A;  3T1Y M;  2E5L M;  1RU3 A;  3E4R A;  1SXJ B;  3FYD A;  4LRT A;  1H6U A;  2DKL A;  3FUW A;  1HJP A;  4NSR A;  3TPZ A;  5EXP A;  2UXB M;  2WSF F;  2Y2Q A;  1DGB A;  2D7E A;  3K8Z A;  3UZU A;  1J7M A;  2J5Y A;  2R62 A;  2ZAM A;  3HHY A;  2BJW A;  3B7Q A;  4II7 A; 
#chains in the Genus database with same CATH homology
 3VK8 A;  5LMN M;  3A42 A;  1XWI A;  4MGZ E;  1IQP A;  2HHH M;  4M0D A;  4PCZ A;  4LFB M;  2UU9 M;  2UWX A;  2XSZ D;  3JR4 A;  2XH9 A;  5ITR A;  3W0L B;  2QZ4 A;  3EIH A;  2R18 A;  3CF2 A;  3GQ3 A;  4L15 A;  1GL6 A;  4GRI A;  3RGS A;  4OUI A;  3VK7 A;  3EIE A;  4A3V B;  1D2N A;  2QCU A;  4LF7 M;  1IN8 A;  2UXC M;  3SC3 A;  3KXE C;  5GKN A;  3J2P B;  1GL7 A;  1IXR C;  2DVW B;  2H1R A;  2KW0 A;  3U6C A;  2XF3 A;  3VKG A;  2KA6 B;  1YU4 A;  2ZAN A;  4LRS A;  4B3T M;  1YUE A;  1NHG C;  3KW6 A;  2ZM6 M;  4DV1 M;  5F3W A;  1GKI A;  1OJL A;  5A2Q S;  1MU5 A;  4MGY E;  3U6D A;  4S12 A;  1IN7 A;  3SYK A;  5KO3 A;  1IBK M;  2Y2G A;  3SAS A;  1N33 M;  4JN6 A;  3FD9 A;  5LMU M;  4LCB A;  1EE8 A;  5IWA M;  2C9C A;  3NWL A;  5EP4 A;  5EP3 A;  3LMM A;  4DV4 M;  4DV6 M;  2CHQ A;  1K3W A;  3U6S A;  4DR7 M;  2OPF A;  3D8L A;  3T1H M;  3U6P A;  5ITX E;  3AKZ A;  1ORY B;  1HNZ M;  3KOX E;  1XXH A;  3KP1 E;  3U6O A;  1IN5 A;  3T38 A;  3WHK A;  3I4V A;  1YU0 A;  4AZF A;  3AOE C;  4GC5 A;  3AV0 A;  4NXM M;  2A5Y B;  2BNK A;  3TE6 A;  3KS8 A;  4CIS A;  2AHM A;  4IBJ A;  5FTL A;  4AG6 A;  4GHA A;  4L8R C;  4LZZ A;  5FLX S;  3M7G A;  4AI6 A;  1YU2 A;  4WW0 A;  2Y2O A;  4LF6 M;  3HJS A;  4AKI A;  5FTM A;  2X4A A;  3U5Z B;  1HT2 E;  3GLF B;  2EA0 A;  4JI6 M;  3H4M A;  3LVW A;  2FNA A;  3RGP A;  3A45 A;  2EO2 A;  4B3S M;  3VDP A;  2CV2 A;  2F5P A;  4OW0 A;  4QHS A;  2XD5 A;  1XNQ M;  2LWX A;  4LFA M;  3L2A A;  4KLN A;  1IY1 A;  1QAQ A;  4DV3 M;  1J5E M;  3K1J A;  4LF8 M;  2XZF A;  3GRR A;  4XBO A;  4IBI A;  5KPR A;  4LF4 M;  4LGM A;  2DZN B;  2I7N A;  5FTJ A;  4GIT A;  3THG A;  4IBG A;  3UJN A;  3GPU A;  1TH3 A;  1Z59 A;  3PVS A;  2G5G X;  3HJQ A;  2XFT A;  2J7N A;  4YY3 M;  1N78 A;  3GLI A;  4AW4 A;  1NHW C;  4PDI A;  1IY0 A;  3HGI A;  2Y0Q A;  1IN4 A;  1NNJ A;  1HT1 E;  2YR0 A;  3B9P A;  5FTN A;  3GPX A;  2UUB M;  3DA1 A;  3PNY A;  2K47 A;  5DYI A;  3FUT A;  3JAM S;  3RFW A;  3KDS E;  4G6Z A;  3L29 A;  3TWK A;  1PJJ A;  2QBY B;  1JR3 A;  1QVR A;  4OVZ A;  4PD2 A;  2NQ8 C;  3QAU A;  3SAT A;  4OJO A;  5EP1 A;  4RF0 A;  4GH9 A;  4LG2 A;  1KSF X;  1SXJ D;  3U6L A;  2RKO A;  2KZU A;  3FYC A;  4FWG A;  3MHV C;  2VQF M;  5BPV A;  3LVV A;  4I4L A;  4LJ5 A;  4CHT B;  8CAT A;  3SBJ A;  4OVZ B;  2QBY A;  4FD2 A;  3U61 B;  2FOI C;  3J7B A;  3E9S A;  4ZPX A;  1K3X A;  2VII A;  2CFO A;  3GO8 A;  4HL4 A;  2OQ4 A;  3WX7 A;  3SMS A;  1J7K A;  4LJ8 A;  4B7H A;  4M9X A;  1HQY E;  1G4A E;  3IG5 A;  3SAV A;  3HON A;  1XMO M;  2Y2I A;  3J80 S;  3SAW A;  4GC9 A;  4FWH A;  2D7H A;  2Y0T A;  3GRY A;  2O5R A;  5E6J A;  2DHR A;  1R6B X;  1SXJ E;  4TUW A;  2I7P A;  1Z6T A;  3GPY A;  1QAN A;  3HKP A;  1IY2 A;  3HU2 A;  2L09 A;  5EXT A;  4OJ5 A;  1G59 A;  3J27 B;  3LQQ A;  1R2Z A;  2CEA A;  2DWL A;  3TWM A;  4R7G A;  2YQZ A;  3ZC7 B;  4NZ4 A;  4KOD A;  1DO2 A;  2V1C A;  3FUV A;  4R3D A;  2QPA A;  1L1T A;  5JI2 E;  4JI1 M;  5KQ8 A;  3SAU A;  2ZAO A;  2UUA M;  2CUZ A;  2Q2E B;  2L6O A;  4IBK A;  4D81 A;  4NY2 A;  3GLF A;  4LF9 M;  4NXN M;  2Y20 A;  2Y21 A;  4FW9 A;  4OJP A;  1QAO A;  3KS4 A;  4EIW A;  5KQD A;  5ITT A;  4G4N A;  4DR2 M;  1YE9 A;  4JI0 M;  3FTE A;  1HQC A;  2FFF B;  2DWM A;  1QZM A;  2JA2 A;  3GQ4 A;  3BOS A;  4QOS A;  1DGF A;  4MH0 E;  4QHT A;  3SHF A;  4JI3 M;  4GIP A;  2UUC M;  3HSH A;  3U61 A;  4GHL A;  4I81 A;  4RNA A;  3VDU A;  3ZH9 B;  3AFH A;  3SYL A;  3AL0 C;  2UXD M;  1IBM M;  1E32 A;  2XLJ A;  1XXH B;  3MJ5 A;  4BLC A;  2CV1 A;  1G41 A;  1N34 M;  4K0K M;  3KP0 E;  4DV2 M;  1YU1 A;  2DXI A;  4JV5 M;  1IN6 A;  1G8P A;  3J7A S;  4AKH A;  3KFU G;  2LXE A;  2CHV A;  2Y2L A;  4PDG A;  3GRV A;  4DUY M;  1N75 A;  3GLI B;  2L7H A;  2L7I A;  2FFJ A;  4IIW A;  2Y2P A;  2LNH C;  3SFZ A;  2CV0 A;  4DUZ M;  1YU3 A;  2FE8 A;  1L1Z A;  2JE5 A;  1UM8 A;  2R4J A;  4LJ7 A;  4LGY A;  5C1B A;  4B7F A;  3ILK A;  5IRE B;  2F5S A;  1IXS B;  3FTD A;  1NY5 A;  1W5T A;  5EXS A;  4L16 A;  4OU7 A;  4NZ5 A;  4D80 A;  1ZQ9 A;  3UGJ A;  3AOE A;  1L8Q A;  5FSW A;  3HHX A;  2Z3X A;  3W0F A;  4LY6 A;  5EXX A;  4QOZ C;  2R46 A;  4LF5 M;  5KPT A;  1W5S A;  1Q3B A;  2KEB A;  4OJL A;  4IJE A;  3U5Z A;  4DR1 M;  4JI8 M;  5IZ7 D;  4DR6 M;  4JI2 M;  3CF0 A;  3MK6 A;  4NYY A;  4GMQ A;  5EQT A;  4B7G A;  3SAR A;  3FTF A;  1XMQ M;  1L2C A;  4M9S A;  4QNR A;  4X62 M;  4BBA A;  1K82 A;  2R4E A;  4DR4 M;  3DZD A;  2LH0 A;  1KYI A;  1I94 M;  1Z5C A;  3HHW A;  3L27 A;  2V1U A;  4I5S A;  5FTK A;  3UK6 A;  1N77 A;  1NJG A;  3HJ8 A;  4LJ6 A;  2XGN A;  1DGH A;  4BB9 A;  4NYU A;  4G4O A;  5DNY A;  4NL4 H;  2D7G A;  4DV7 M;  2HL7 A;  1OFI A;  2DWN A;  1QAM A;  4Z8X A;  5E26 A;  4MGH A;  3KSX A;  4FCV A;  1HNX M;  4NRW A;  1DO0 A;  4HLQ A;  2G8L A;  2C99 A;  3PNV A;  1HR0 M;  4X66 M;  1XNR M;  3ZCB B;  3SHG B;  1T3T A;  1R7R A;  2J7O A;  2C9O A;  4MM3 B;  1YSY A;  4FCT A;  4JYA M;  5BR8 M;  1I4W A;  3JR5 A;  4GKK M;  3L26 A;  4M0W A;  2Y2K A;  4GKJ M;  4NZ3 A;  2DZO B;  1C1K A;  2IOU A;  4B3M M;  2R45 A;  3CF6 E;  4DR5 M;  1N36 M;  1Q39 A;  3U6E A;  4L78 A;  4ITQ A;  1NJF A;  3OTO M;  4LJ9 A;  2RGO A;  4IBE A;  4MGI E;  3SMP A;  4AG5 A;  4G4Q A;  3K2L A;  2X8A A;  1E9S A;  3AOG A;  5ITX A;  1TDH A;  4Z6Y A;  3L28 A;  4WUR A;  2XZU A;  1TDZ A;  2KXE A;  4NOO B;  2XEP A;  1ZAE A;  3FKE A;  3TWL A;  4I8O A;  1G3I A;  4MGK E;  3GLH A;  4IBF A;  1FJG M;  4NSO B;  3FTC A;  5DYG A;  1L2B A;  3IG8 A;  5ITY A;  4L4U A;  4X64 M;  2KRU A;  3HHZ A;  4B3R M;  3VFD A;  3VLF B;  3R9X B;  3HU3 A;  5KPZ A;  2VQE M;  3GLG A;  5ITQ A;  4DV0 M;  2C96 A;  1QQW A;  1SXJ A;  4FVM A;  4JI4 M;  2F5N A;  4LJ4 A;  2KRK A;  2Z4R A;  3J81 S;  1Z5A A;  3FUU A;  4CGY B;  3HWS A;  4LFC M;  1IXZ A;  2ERC A;  3I4Y A;  4KHP M;  1TH2 A;  4IBC A;  2M5Z A;  3R8F A;  4OJ6 A;  5ITU A;  3KSJ A;  3RE8 A;  4X65 M;  7CAT A;  4QNM A;  2Z7J A;  4REZ A;  2Z4S A;  3KOW E;  4IBD A;  4G4R A;  4W5W A;  4JI5 M;  2BJV A;  1XC8 A;  4QNL A;  1MX0 A;  4PT5 A;  4IJF A;  4AKG A;  3A98 B;  2YNM D;  4D82 A;  1JR3 D;  4OX9 M;  4FWD A;  3D8B A;  4JI7 M;  3KOY E;  1JQJ C;  2CHG A;  4P16 A;  3GLG B;  3UMM A;  2Y2H A;  1TGU A;  4DV5 M;  1KFV A;  1WXQ A;  1VDD A;  4XGI A;  3U60 B;  4DR3 M;  4LJA A;  3AJI B;  4NZ1 A;  2W82 A;  3M0E A;  2DWZ B;  1J09 A;  4AQY M;  1PM5 A;  3LQR A;  3GLH B;  1YUB A;  2HKJ A;  5JI3 E;  2C98 A;  2Y2N A;  1PJI A;  3HU1 A;  3CTW B;  2HCB A;  1IBL M;  1NNU C;  2KZS A;  3PXG A;  3DOA A;  1N32 M;  2F5Q A;  4M9Z A;  1LV7 A;  4NRV A;  2R65 A;  3N3F A;  1GVN A;  3T15 A;  2F4V M;  3NBI A;  2BG1 A;  2QEN A;  5EP2 A;  1E9R A;  3K92 A;  2F5O A;  3WHL A;  3VKH A;  1DGG A;  4IBB A;  1OFH A;  3PFI A;  3U60 A;  3L25 A;  3DFZ A;  2X49 A;  3Q8X A;  3GPP A;  3GRU A;  1L2D A;  1HNW M;  3KVW A;  1E94 E;  1SXJ C;  4MB7 A;  1NY6 A;  2EUC A;  5EJC A;  5C18 A;  2QP9 X;  2C5R A;  2CE7 A;  2XFS A;  3TQS A;  1NSF A;  4YHH M;  3KOZ E;  2Y2M A;  2Y2J A;  2YFQ A;  4JXJ A;  1GLN A;  1TH4 A;  3A46 A;  3U6M A;  1QYR A;  2P5T A;  2RGH A;  1X37 A;  2V6Z M;  2XD1 A;  1R2Y A;  3FUX A;  2XSZ A;  4LZJ A;  2M60 A;  2JCH A;  5IT9 S;  3U6Q A;  1NVM A;  1FNN A;  1Q3C A;  3M6A A;  5H37 D;  3TL4 X;  3QWL A;  3C58 A;  3GQ5 A;  4FCW A;  2ZBK B;  3GP1 A;  4RF1 A;  1IM2 A;  4B08 A;  1S3S A;  1Z5B A;  1DGH B;  1XHB A;  4KO8 A;  3T1Y M;  2E5L M;  3E4R A;  1SXJ B;  3FYD A;  4LRT A;  1H6U A;  3FUW A;  4NSR A;  3TPZ A;  2UXB M;  5EXP A;  2Y2Q A;  3K8Z A;  1DGB A;  2D7E A;  3UZU A;  2R62 A;  2ZAM A;  3HHY A;  2BJW A;  3I51 A;  4II7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...