4IBDA

Ebola virus vp35 bound to small molecule
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity.
pubmed doi rcsb
source organism Ebola virus
molecule tags Transcription/transcription inhibitor
molecule keywords Polymerase cofactor VP35
total genus 44
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ibdA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ibdA02
4IBEA 4IBKA 4IBJA 5BPVA 3FKEA 3KS4A 3KS8A 4LG2A 3L29A 4IBIA 3L2AA 4IBGA 4IJFA 4IBFA 3L25A 4GH9A 4IJEA 3L27A 4IBDA 4GHLA 4IBBA 4GHAA 3L28A 3L26A 4IBCA
chains in the Genus database with same CATH superfamily
3U6PA 1D0MA 5L8RF 4IBKA 4IBJA 1QANA 1CUKA 2CEAA 4KLNA 1K3WA 2DZNB 4M9SA 1QVRA 3ZQJA 2RGOA 4B7HA 2ZANA 2M5ZA 1V92A 1UR8A 4HMEA 1MX0A 1UM8A 4AKIA 3M6AA 1SXJD 4LG2A 2C98A 5DFLA 1IM2A 4IBIA 3GLGB 2LWXA 3J27B 8CATA 1L8QA 4LF9M 4FW9A 3GPPA 3WD3A 3CTWB 1NY5A 2CHGA 2MH8A 2BWBA 2CFOA 2VF8A 3PXGA 3VFDA 4X62M 2C5RA 4LGYA 1OGBA 3D8LA 1W1PA 3MMPA 3J81S 4B7GA 2JXNA 2F5PA 4GHLA 5KQDA 2R6FA 4I8OA 1NY6A 5DNYA 1Q3BA 1ZAEA 2QPAA 3WHKA 4HEOA 1XB2B 3L28A 3GRYA 4FWHA 3SFZA 4NRVA 4JI6M 1E8BA 2HWJA 4X66M 3LCUA 3Q8XA 2V1UA 2L6OA 3GRVA 7CATA 4LZJA 1JB0F 1TH2A 3LVVA 3TL4X 3T38A 2XSZD 2L4FA 4AG5A 1S3SA 2XFSA 3GO8A 5JI3E 1MJGM 2BWEA 4REZA 3T1YM 3HHWA 2QENA 3TWKA 3GLFA 3I51A 1E6ZA 3C58A 2XD5A 1GVNA 1HNZM 1QDTA 4OJOA 3HONA 3PNYA 2R4EA 2ZBKB 2XZFA 1JR3A 1GKIA 4G6ZA 4M9XA 4MGKE 4Y28F 4G4NA 3FTDA 3U6MA 2XF3A 2Y2LA 5EXPA 1T43A 2KNAA 3IHPA 3EIEA 3FUVA 4Z8XA 1WXQA 1IN4A 2J7NA 4IJEA 4JN6A 1Y8GA 4PD2A 4DV4M 3UZUA 2HL7A 4LGMA 4MM3B 4ANRA 4D81A 3B9PA 4L8RC 3QYBA 4MB5A 1WGLA 5BR8M 2Z8YM 4FCTA 5E26A 3Q8GA 3C3DA 1T6OA 2L09A 3PNVA 2CV1A 3W0LB 1OAIA 5C1BA 2X8AA 3GLIA 2OPFA 3KSJA 2D49A 1JQJC 3K9PA 2KXEA 2UUBM 1KSFX 3GP1A 3E21A 2HHHM 1J7KA 4NZ3A 3SARA 3AOEC 3GLHE 1R7RA 5IZ7D 2UWXA 4NXMM 2RTSA 2L4EA 2Y2OA 1G41A 3U5ZA 4NYUA 2DZOB 3VLFB 3RFWA 1LTMA 1NNJA 4JI4M 4B3RM 1Z5BA 5LMUM 1XNQM 4NSRA 3HJ8A 3B7ZA 4PDIA 2J5YA 5ITRA 1IFYA 4FWDA 3KOYE 1OAOC 1G4AE 4PDGA 1D0LA 2EUCA 4A3VB 4FWGA 3JR4A 1E9SA 4LF6M 1Z5CA 2WZJA 5IT9S 1ZQ9A 1HNWM 3I01M 1QYRA 2XLJA 2LXEA 3LQQA 5EQTA 2G8LA 2Y2NA 3SASA 4QOSA 2R45A 2MROB 5KQ8A 1R4GA 3KS4A 1L1TA 2O5RA 1SXJE 3LCVB 3H4JA 5EJCA 2JZ1A 3WD0A 1OTRA 2KA6B 3HKPA 1IY1A 2V6ZM 2Y0QA 4JI5M 4HMCA 1AIWA 2B3TA 4K0KM 4Z2HA 1NHGC 3SAVA 1XXHA 1WR1B 3KW6A 3AFHA 3GPXA 3FYDA 4L16A 3GLHB 2NQ8C 3RGSA 2ERCA 2R62A 3MJ5A 2F5NA 2FH0A 4WURA 1JR3D 3TWMA 4OVZB 5ITTA 2HAKA 1Z6TA 2G5GX 2LVOC 3ZH9B 4MB4A 3KOWE 4LFAM 1XMOM 1TGUA 2X49A 4Z2KA 3U6QA 5LMNM 1IXSB 1GL6A 1DO0A 3I4YA 1IBMM 1J5EM 2L2DA 2EKKA 2R46A 2FS1A 3GRRA 4IJFA 5A2QS 3FUWA 3UGJA 4NRWA 1K82A 2YR0A 4XBOA 3BXWA 4Z2LA 3DFZA 1DGHB 1XC8A 4KODA 1YU1A 4IIWA 3GQ4A 2WSCF 2Y20A 2A5YB 1QUSA 3I04M 1Q02A 3BBZA 1TH3A 2LTUA 2YFQA 4JI1M 1GPFA 4MGIE 3C9PA 4RF1A 1AUAA 2YNMD 3W0FA 2R0IA 1NJGA 3FYCA 4AKGA 1OJLA 1O6IA 1IN8A 2ZTCA 3A46A 4M0WA 1Z59A 2QSFX 1CXWA 4JI8M 1DGBA 2F4VM 3KP1E 5FLXS 1YU3A 2JY7A 3CF0A 2QCUA 4OU7A 1TTEA 1MN3A 3B7NA 4DR7M 2RKOA 4JI7M 3QAUA 1V33A 3VDPA 3L25A 2QBYB 4LF5M 5KO3A 1IXZA 1XWIA 4Z6YA 4GMQA 5F3WA 1LV7A 1L6JA 4NZ5A 3SYLA 2DAKA 1IY2A 2UXDM 1W1TA 2KNZA 2EA0A 1YU4A 1WHCA 4PT5A 2Q2EB 3HZJA 4OJ5A 3SAUA 2WSFF 3L26A 4IBCA 1KYIA 2Y21A 3VDUA 2CE7A 3E4RA 3W67A 1E6RA 2FE8A 3SMPA 1E88A 2Y2PA 2K6BA 3HY5A 2OO9A 2Z3XA 1E94E 3U6EA 1QAOA 2C96A 4NC6A 3L2AA 2IOUA 2EKFA 2F5OA 2H5XA 2N35A 4LJ7A 3T6PA 3FTFA 1EE8A 4AQYM 1IXSA 2K9DA 4R3DA 2BJWA 2V5OA 4MGZE 3L27A 2BNKA 3RE8A 4G4RA 1QAQA 4QNMA 3GLFE 2CUZA 3LW5F 2DWMA 4HMDA 3JAMS 3CGWA 1R2YA 2KDLA 1UR9A 5DYGA 5H37D 2ZM6M 4JI0M 4CGYB 2EO2A 1PJTA 1W5SA 1XHBA 2C99A 1EFUB 2JZ0A 2P5TA 4XGIA 3KDSE 5EXTA 1GL7A 4M9ZA 1DGHA 2JWSA 5EP1A 2VQFM 4GC9A 4DUZM 1DV0A 3D8BA 1YSYA 4I4LA 3WX7A 2CWBA 4KHPM 3L29A 4LF8M 1YLAA 4GIPA 1PJIA 1NV8A 2JP7A 1YE9A 2OOBA 4S12A 2DENA 1QAMA 1N75A 2UXBM 1ZMWA 2XGNA 4R7GA 1H8PA 4KT0F 1TR8A 1OGGA 4DV0M 3GLHA 1TDHA 4G3OA 4GH9A 4LRTA 1L2BA 4NY2A 4JI3M 2DAMA 2H1RA 4ZPXA 1G71A 1NNUC 1I4WA 3E46A 4DV6M 4DR5M 1HT2E 2DKLA 1AIPC 1BVSA 2XH9A 4IBBA 4OVZA 3T15A 5ITQA 4AKHA 3VKHA 1QO6A 4NSOB 2Y2GA 4LZZA 1Q3CA 4RNAA 5EP3A 3DA1A 2HKJA 4OJPA 4Z2IA 2Z4SA 1XMQM 4L4UA 3J80S 1KFVA 4GKKM 3FTCA 3KSXA 4M0DA 2R18A 3RGPA 4JI2M 2R44A 1YUEA 4NYYA 1N78A 4RF0A 1ED7A 2DI0A 4LCBA 2AHMA 3SMSA 4OUIA 2UXCM 1R2ZA 1L2DA 2F5QA 2D7GA 3U61A 1G3IA 2MJ5B 3IG5A 4QNRA 3GQ5A 4I81A 4DR1M 2CV0A 1IQPA 2HCBA 3AJIB 3K2LA 4NL4H 4IBFA 3GQ3A 3T1HM 3TE6A 1N77A 2KRUA 2LVAA 4LJ5A 1SXJA 1EIJA 4DV7M 1W1YA 2LNHC 1TF0B 3U6CA 4LFCM 3LMMA 4X65M 3DOAA 2Y2MA 1QQWA 4LFBM 4GHAA 4WW0A 1PJJA 3HX3A 1PJQA 1IBKM 2JY5A 1NSFA 4D80A 4CHTB 5KPZA 5BPVA 3U6OA 3H4MA 4G4QA 4D82A 1C7YA 2D7EA 4GKJM 1E6PA 2Z4RA 4YHHM 1GLNA 2X4AA 3NBXX 2D7HA 2UUCM 3AKZA 5FSWA 4LRSA 5FTNA 4DUYM 4Z2JA 5EXSA 4X64M 1PRBA 2DAIA 3SHFA 2C9OA 1J7MA 3HU2A 2Z7JA 2KNVA 2OOAA 3B89A 3A45A 4I5SA 1RU3A 1VEKA 3U6SA 5ITXA 2JA2A 2LHCA 3GLGE 3U60B 3GPYA 3C3EA 1QZMA 3CF2A 3QWLA 3GRUA 2VQEM 2BJVA 1D2NA 2KW0A 3U6LA 4DV2M 3ILKA 2L7HA 2XFTA 1QDRA 2LH0A 2VDBB 4JXJA 3VK8A 1E15A 2FFFB 3JR5A 1NJFA 1P3QQ 4R71A 2MR9A 5ITXE 3GLGA 4LJ9A 4L6V6 4GEWA 4FCVA 4GC5A 5FTLA 3ZC7B 2XZUA 2I7NA 2M60A 1DGFA 3KS8A 1GJTA 1QUTA 1VQ1A 1VEGA 4II7A 1H0IA 1CK7A 4FCWA 4LJ4A 3HHZA 3A98B 1E6NA 4IBGA 2EJSA 3NWLA 4LF4M 2LBCA 3FD9A 1QZEA 4LF7M 3FTEA 3B7QA 1H0GA 3VK7A 1DGGA 4RKUF 1GJSA 3KP0E 3R9XB 5FTKA 4LY6A 1XNRM 1HQCA 4TUWA 4IBDA 1GABA 3VKGA 5IWAM 2Y2IA 2JCHA 1VG5A 2LVPC 2XEPA 4F2LA 3SBJA 2DVWB 3TPZA 3I4VA 3HHXA 4UN2B 2KZUA 3E9SA 4BB9A 1ORYB 1IXRC 2CHVA 3FKEA 2FNAA 1F4IA 5GKNA 1EAKA 3U6DA 1Z5AA 2QP9X 4MB3A 1VDLA 4B3SM 1R5LA 2RGHA 2F5SA 1N32M 1PDCA 1W5TA 4OJ6A 3KOXE 3TQSA 5KPRA 1WIVA 3KXEC 4MH0E 3MHVC 1YU2A 2KHHA 3A42A 3UMMA 1KS0A 3K1JA 4AW4A 3UJNA 1N34M 1L2CA 2E5LM 4OX9M 1GOIA 1VDDA 1A5TA 1H6UA 3PVSA 2DHYA 2JNHA 3SAWA 2CV2A 2ZTDA 3V76A 3OTOM 2BG1A 3WD4A 2DWLA 1JR3E 1T3TA 3MQLA 4L78A 2CRUA 3LQRA 1V34A 1ZMVA 2ZAMA 2DAEA 3SC3A 4AZFA 1Q39A 1I94M 1X37A 3KFUG 1YU0A 2DWNA 2FOIC 3BOSA 1G59A 3UK6A 2JY8A 2R4JA 3FUUA 5C18A 2O25A 5ITYA 4DV1M 4GITA 3FE3A 1HJPA 1NV9A 4FVMA 4GRIA 4NXNM 3FRHA 4CIZA 1J09A 3GLIE 1N36M 2UUAM 2ZAOA 2JE5A 4DR2M 2Y2KA 2RRUA 1FNNA 3AOEA 4Q7JA 3WHLA 5DYIA 2G3QA 1IN7A 2LHGA 4QHTA 4AG6A 5ITUA 3K8ZA 3SATA 2KEBA 4EIWA 1ZV1A 2Y2JA 2W82A 5JI2E 2DAGA 2L7IA 4JYAM 3B74A 4DR3M 3J7BA 5EP2A 3HU1A 2JUJA 4FD2A 1OIPA 4BBAA 3FRIA 5E6JA 1VEJA 2C9CA 3J2PB 3R8FA 3QYEA 1R6BX 1SXJC 2VF7A 4ITQA 3WD1A 2KZSA 2FFJA 4LJ6A 1DO2A 2Y2HA 1NHWC 3HWSA 3IECA 3GLFB 4AI6A 1GXDA 3NBIA 4WP2A 1E9RA 2CP8A 1OFHA 4PCZA 4DV3M 1OFIA 3HJSA 4OW0A 4NZ4A 3AL0C 1OKSA 3KVWA 4JV5M 2JY6B 2DZLA 4TX8A 2DWZB 5EP4A 4QHSA 4P17A 1ZMUA 3ZCBB 1HNXM 2GNOA 4MGHA 4CISA 3PFIA 3CF6E 2QNJA 5FTJA 1IN6A 2LVNC 2I7PA 3SYKA 4LJAA 5KPTA 3GPUA 2WSEF 4IBEA 3SHGB 4CJ6A 4BLCA 1TDZA 1TH4A 2MGWA 1L1ZA 1NVMA 2VIIA 3FUXA 1N33M 3FUTA 1XXHE 3AOGA 3K9OA 3K92A 2O01F 1HT1E 2APLA 4L15A 4XK8F 4G4OA 4B3MM 2Y2QA 1D0KA 1NO1A 4MGYE 5FTMA 3U60A 3TWLA 2CHQA 4MB7A 3U5ZB 2QZ4A 2FN2A 3M7GA 4YY3M 2K47A 3HSHA 3KOZE 1G8PA 3M0EA 3WD2A 1K3XA 2J7OA 1WJ7A 2GQFA 2LVQD 3F92A 4Z2GA 1XXHB 2K0BX 3IG8A 2DXIA 4QNLA 3U61B 3THGA 1SG9A 2XD1A 3MK6A 1PM5A 3J7AS 2DNAA 3DZDA 1OQYA 2R65A 1IY0A 1SXJB 1OIZA 2V1CA 1PGYA 1PJSA 3EIHA 4P16A 4DV5M 3HJQA 1C1KA 4QOZC 2XSZA 2QBYA 1YUBA 2DHRA 1HR0M 4W5WA 1W1VA 4B7FA 3HGIA 4HLQA 5EXXA 2QHOB 2OQ4A 4F1IA 2QQ8A 2UU9M 1E32A 1MU5A 1WGNA 3W68A 4DR6M 3GLIB 2Y0TA 4NZ1A 3HHYA 1IBLM 4NOOB 4B3TM 4B08A 4DR4M 5IREB 4HL4A 2YQZA 3M7PA 2KRKA 4DBGB 1IN5A 3LVWA 4LJ8A 4OJLA 1UFZA 3N3FA 3HU3A 1FJGM 4KO8A 1GO5A 1HQYE 3AV0A
chains in the Genus database with same CATH topology
3U6PA 4IBKA 4IBJA 1QANA 4KLNA 2CEAA 1K3WA 2DZNB 4M9SA 1QVRA 4B7HA 2RGOA 2ZANA 2M5ZA 1MX0A 1UM8A 4AKIA 3M6AA 1SXJD 4LG2A 2C98A 1IM2A 4IBIA 3GLGB 2LWXA 3J27B 8CATA 1L8QA 4LF9M 4FW9A 3GPPA 3CTWB 1NY5A 2CHGA 3VFDA 2CFOA 3PXGA 4X62M 1YU4A 2C5RA 4LGYA 3D8LA 3J81S 4B7GA 2F5PA 4GHLA 5KQDA 4I8OA 1NY6A 5DNYA 1Q3BA 1ZAEA 2QPAA 3WHKA 3L28A 3GRYA 4FWHA 3SFZA 4NRVA 4JI6M 4X66M 3Q8XA 2V1UA 2L6OA 3GRVA 7CATA 4LZJA 1TH2A 3LVVA 3TL4X 4AG5A 3T38A 2XSZD 3GO8A 3U6EA 1S3SA 2XFSA 5JI3E 4REZA 3T1YM 3HHWA 2QENA 3TWKA 3GLFA 3I51A 3C58A 2XD5A 1GVNA 1HNZM 4OJOA 3HONA 3PNYA 2R4EA 2ZBKB 2XZFA 1JR3A 1GKIA 4G6ZA 4M9XA 4MGKE 4G4NA 3U6MA 3FTDA 2Y2LA 2XF3A 5EXPA 5EP3A 3EIEA 3FUVA 4Z8XA 1WXQA 1IN4A 2J7NA 4IJEA 4JN6A 4PD2A 5IT9S 4DV4M 3UZUA 2HL7A 4LGMA 4MM3B 4D81A 4L8RC 3B9PA 2XD1A 5BR8M 4FCTA 5E26A 3PNVA 2L09A 2CV1A 3W0LB 5C1BA 2X8AA 3GLIA 2OPFA 3KSJA 1JQJC 2UUBM 2KXEA 4NZ3A 1KSFX 3GP1A 2HHHM 1J7KA 3SARA 3AOEC 1R7RA 5IZ7D 2UWXA 4NXMM 2Y2OA 1G41A 3U5ZA 4NYUA 2DZOB 3VLFB 3RFWA 1NNJA 4JI4M 4B3RM 1Z5BA 5LMUM 1XNQM 4NSRA 3HJ8A 4PDIA 5ITRA 4FWDA 3KOYE 1G4AE 4PDGA 2EUCA 4A3VB 4FWGA 3JR4A 1E9SA 4LF6M 1Z5CA 1ZQ9A 1HNWM 1QYRA 2XLJA 2LXEA 3LQQA 5EQTA 2G8LA 2Y2NA 3SASA 4QOSA 2R45A 5KQ8A 1L1TA 3KS4A 2O5RA 1SXJE 5EJCA 2KA6B 3HKPA 1IY1A 2V6ZM 2Y0QA 4JI5M 4K0KM 1NHGC 3SAVA 1XXHA 3KW6A 3AFHA 3GPXA 3FYDA 4L16A 3GLHB 2NQ8C 3RGSA 3MJ5A 2ERCA 2R62A 2F5NA 4WURA 1JR3D 3TWMA 4OVZB 5ITTA 1Z6TA 2G5GX 3ZH9B 3KOWE 4LFAM 1XMOM 1TGUA 2X49A 3U6QA 5LMNM 1IXSB 1GL6A 1DO0A 3I4YA 1IBMM 1J5EM 2R46A 3GRRA 4IJFA 5A2QS 3FUWA 3UGJA 4NRWA 1K82A 2YR0A 4XBOA 3DFZA 1DGHB 1XC8A 4KODA 1YU1A 4IIWA 3GQ4A 2Y20A 2A5YB 1TH3A 2YFQA 4JI1M 4MGIE 4RF1A 2YNMD 3W0FA 3FYCA 1NJGA 4AKGA 1OJLA 1IN8A 3A46A 4M0WA 1Z59A 4JI8M 1DGBA 2F4VM 3KP1E 5FLXS 1YU3A 3CF0A 2QCUA 4OU7A 4DR7M 2RKOA 4JI7M 3QAUA 3VDPA 3L25A 2QBYB 4LF5M 5KO3A 1IXZA 1XWIA 4Z6YA 4GMQA 5F3WA 1LV7A 4NZ5A 3SYLA 2UXDM 1IY2A 2EA0A 4PT5A 2Q2EB 4OJ5A 3SAUA 3L26A 4IBCA 1KYIA 2Y21A 3VDUA 2CE7A 3E4RA 2FE8A 3SMPA 2Y2PA 2Z3XA 1E94E 1QAOA 2C96A 3L2AA 2IOUA 2F5OA 4LJ7A 3FTFA 1EE8A 4AQYM 4R3DA 2BJWA 4MGZE 3L27A 2BNKA 3RE8A 4G4RA 1QAQA 4QNMA 2DWMA 2CUZA 3JAMS 1R2YA 5DYGA 5H37D 2ZM6M 4JI0M 4CGYB 2EO2A 1W5SA 1XHBA 2C99A 2P5TA 4XGIA 5EXTA 3KDSE 1GL7A 4M9ZA 1DGHA 5EP1A 2VQFM 4GC9A 4DUZM 3D8BA 1YSYA 4I4LA 3WX7A 4KHPM 3L29A 4LF8M 4GIPA 1PJIA 1YE9A 4S12A 2UXBM 1QAMA 1N75A 2XGNA 4R7GA 4DV0M 3GLHA 1TDHA 4GH9A 4LRTA 1L2BA 4NY2A 4JI3M 2H1RA 4ZPXA 1NNUC 4DR5M 1I4WA 4DV6M 1HT2E 2XH9A 3T15A 4IBBA 4OVZA 2Y2GA 4AKHA 5ITQA 3VKHA 4NSOB 4LZZA 1Q3CA 4RNAA 3DA1A 2HKJA 4OJPA 2Z4SA 1XMQM 4L4UA 3J80S 1KFVA 4GKKM 3FTCA 3KSXA 4M0DA 2R18A 3RGPA 4JI2M 1YUEA 4NYYA 1N78A 4RF0A 4LCBA 2AHMA 3SMSA 4OUIA 2UXCM 1R2ZA 1L2DA 2F5QA 2D7GA 3U61A 1G3IA 3IG5A 4QNRA 3GQ5A 4DR1M 4I81A 2CV0A 1IQPA 2HCBA 3AJIB 3K2LA 4NL4H 4IBFA 3GQ3A 3T1HM 3TE6A 1N77A 2KRUA 4LJ5A 4AI6A 1SXJA 4DV7M 2LNHC 3U6CA 4LFCM 3LMMA 4X65M 3DOAA 2Y2MA 1QQWA 4LFBM 4GHAA 4WW0A 1PJJA 1IBKM 4D80A 1NSFA 3U6OA 4CHTB 5KPZA 5BPVA 3H4MA 4G4QA 4D82A 4GKJM 2D7EA 2Z4RA 4YHHM 1GLNA 2X4AA 2D7HA 2UUCM 3AKZA 5FSWA 4LRSA 5FTNA 4DUYM 5EXSA 4X64M 3SHFA 2C9OA 3HU2A 2Z7JA 4I5SA 3A45A 3U6SA 3U60B 5ITXA 2JA2A 3GPYA 1QZMA 3CF2A 3QWLA 3GRUA 2VQEM 2BJVA 1D2NA 2KW0A 3U6LA 4DV2M 3ILKA 2L7HA 2XFTA 2FFFB 2LH0A 4JXJA 3VK8A 3JR5A 1NJFA 5ITXE 3GLGA 4LJ9A 4FCVA 4GC5A 5FTLA 3ZC7B 2XZUA 2I7NA 2M60A 1DGFA 3KS8A 4II7A 4FCWA 4LJ4A 3HHZA 3A98B 4IBGA 3NWLA 4LF4M 3FD9A 4LF7M 3FTEA 3VK7A 1DGGA 3KP0E 3R9XB 5FTKA 4LY6A 1XNRM 1HQCA 4TUWA 4IBDA 3VKGA 5IWAM 2Y2IA 2JCHA 2XEPA 3SBJA 2DVWB 3TPZA 3I4VA 3HHXA 2KZUA 3E9SA 4BB9A 1ORYB 1IXRC 2CHVA 3FKEA 2FNAA 5GKNA 3U6DA 1Z5AA 2QP9X 4B3SM 2RGHA 2F5SA 1N32M 1W5TA 4OJ6A 3KOXE 3TQSA 5KPRA 3KXEC 4MH0E 3MHVC 1YU2A 3A42A 3UMMA 3K1JA 4AW4A 3UJNA 1N34M 1L2CA 2E5LM 4OX9M 1VDDA 1H6UA 3PVSA 3SAWA 2CV2A 3OTOM 2BG1A 2DWLA 1T3TA 4L78A 3LQRA 2ZAMA 3SC3A 4AZFA 1Q39A 1I94M 1X37A 3KFUG 2DWNA 2FOIC 3BOSA 1G59A 3UK6A 2R4JA 3FUUA 4DV1M 5C18A 5ITYA 4GITA 4GRIA 4NXNM 2JE5A 4FVMA 1N36M 2UUAM 1J09A 2ZAOA 2Y2KA 4DR2M 1FNNA 3AOEA 3WHLA 5DYIA 1IN7A 5ITUA 4QHTA 4AG6A 3K8ZA 3SATA 2KEBA 4EIWA 2Y2JA 2W82A 5JI2E 2L7IA 4JYAM 4DR3M 3J7BA 5EP2A 3HU1A 4FD2A 4BBAA 5E6JA 2C9CA 3J2PB 3R8FA 1R6BX 1SXJC 4ITQA 2KZSA 2FFJA 4LJ6A 1DO2A 2Y2HA 1NHWC 3HWSA 3GLFB 1YU0A 3NBIA 1E9RA 1OFHA 4PCZA 4DV3M 1OFIA 3HJSA 4OW0A 4NZ4A 3AL0C 3KVWA 4JV5M 2DWZB 5EP4A 4QHSA 3ZCBB 1HNXM 4MGHA 4CISA 3PFIA 3CF6E 5FTJA 1IN6A 3SYKA 2I7PA 4LJAA 5KPTA 3GPUA 4IBEA 3SHGB 4BLCA 1TDZA 1TH4A 1L1ZA 1NVMA 2VIIA 3FUXA 1N33M 3FUTA 3AOGA 3K92A 1HT1E 4L15A 4G4OA 4B3MM 2Y2QA 5FTMA 4MGYE 3U60A 3TWLA 2CHQA 4MB7A 3U5ZB 2QZ4A 3M7GA 4YY3M 2K47A 3HSHA 3KOZE 1G8PA 3M0EA 1K3XA 2J7OA 1XXHB 3IG8A 2DXIA 4QNLA 3U61B 3THGA 3MK6A 1PM5A 3J7AS 3DZDA 2R65A 1IY0A 1SXJB 2V1CA 3EIHA 4P16A 4DV5M 3HJQA 1C1KA 4QOZC 2XSZA 2QBYA 1YUBA 2DHRA 1HR0M 4W5WA 4B7FA 3HGIA 4HLQA 5EXXA 2OQ4A 2UU9M 1E32A 1MU5A 4DR6M 3GLIB 2Y0TA 4NZ1A 3HHYA 1IBLM 4NOOB 4B3TM 4B08A 4DR4M 5IREB 4HL4A 2YQZA 2KRKA 1IN5A 3LVWA 4LJ8A 4OJLA 3N3FA 3HU3A 1FJGM 4KO8A 1HQYE 3AV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBE A;  4IBK A;  4IBJ A;  5BPV A;  3FKE A;  3KS4 A;  3KS8 A;  4LG2 A;  3L29 A;  4IBI A;  3L2A A;  4IBG A;  4IJF A;  4IBF A;  3L25 A;  4GH9 A;  4IJE A;  3L27 A;  4IBD A;  4GHL A;  4IBB A;  4GHA A;  3L28 A;  3L26 A;  4IBC A; 
#chains in the Genus database with same CATH topology
 3U6P A;  1D0M A;  5L8R F;  4IBK A;  4IBJ A;  1QAN A;  1CUK A;  2CEA A;  4KLN A;  1K3W A;  2DZN B;  4M9S A;  1QVR A;  3ZQJ A;  2RGO A;  4B7H A;  2ZAN A;  2M5Z A;  1V92 A;  1UR8 A;  4HME A;  1MX0 A;  1UM8 A;  4AKI A;  3M6A A;  1SXJ D;  4LG2 A;  2C98 A;  5DFL A;  1IM2 A;  4IBI A;  3GLG B;  2LWX A;  3J27 B;  8CAT A;  1L8Q A;  4LF9 M;  4FW9 A;  3GPP A;  3WD3 A;  3CTW B;  1NY5 A;  2CHG A;  2MH8 A;  2BWB A;  2CFO A;  2VF8 A;  3PXG A;  3VFD A;  4X62 M;  2C5R A;  4LGY A;  1OGB A;  3D8L A;  1W1P A;  3MMP A;  3J81 S;  4B7G A;  2JXN A;  2F5P A;  4GHL A;  5KQD A;  2R6F A;  4I8O A;  1NY6 A;  5DNY A;  1Q3B A;  1ZAE A;  2QPA A;  3WHK A;  4HEO A;  1XB2 B;  3L28 A;  3GRY A;  4FWH A;  3SFZ A;  4NRV A;  4JI6 M;  1E8B A;  2HWJ A;  4X66 M;  3LCU A;  3Q8X A;  2V1U A;  2L6O A;  3GRV A;  7CAT A;  4LZJ A;  1JB0 F;  1TH2 A;  3LVV A;  3TL4 X;  3T38 A;  2XSZ D;  2L4F A;  4AG5 A;  1S3S A;  2XFS A;  3GO8 A;  5JI3 E;  1MJG M;  2BWE A;  4REZ A;  3T1Y M;  3HHW A;  2QEN A;  3TWK A;  3GLF A;  3I51 A;  1E6Z A;  3C58 A;  2XD5 A;  1GVN A;  1HNZ M;  1QDT A;  4OJO A;  3HON A;  3PNY A;  2R4E A;  2ZBK B;  2XZF A;  1JR3 A;  1GKI A;  4G6Z A;  4M9X A;  4MGK E;  4Y28 F;  4G4N A;  3FTD A;  3U6M A;  2XF3 A;  2Y2L A;  5EXP A;  1T43 A;  2KNA A;  3IHP A;  3EIE A;  3FUV A;  4Z8X A;  1WXQ A;  1IN4 A;  2J7N A;  4IJE A;  4JN6 A;  1Y8G A;  4PD2 A;  4DV4 M;  3UZU A;  2HL7 A;  4LGM A;  4MM3 B;  4ANR A;  4D81 A;  3B9P A;  4L8R C;  3QYB A;  4MB5 A;  1WGL A;  5BR8 M;  2Z8Y M;  4FCT A;  5E26 A;  3Q8G A;  3C3D A;  1T6O A;  2L09 A;  3PNV A;  2CV1 A;  3W0L B;  1OAI A;  5C1B A;  2X8A A;  3GLI A;  2OPF A;  3KSJ A;  2D49 A;  1JQJ C;  3K9P A;  2KXE A;  2UUB M;  1KSF X;  3GP1 A;  3E21 A;  2HHH M;  1J7K A;  4NZ3 A;  3SAR A;  3AOE C;  3GLH E;  1R7R A;  5IZ7 D;  2UWX A;  4NXM M;  2RTS A;  2L4E A;  2Y2O A;  1G41 A;  3U5Z A;  4NYU A;  2DZO B;  3VLF B;  3RFW A;  1LTM A;  1NNJ A;  4JI4 M;  4B3R M;  1Z5B A;  5LMU M;  1XNQ M;  4NSR A;  3HJ8 A;  3B7Z A;  4PDI A;  2J5Y A;  5ITR A;  1IFY A;  4FWD A;  3KOY E;  1OAO C;  1G4A E;  4PDG A;  1D0L A;  2EUC A;  4A3V B;  4FWG A;  3JR4 A;  1E9S A;  4LF6 M;  1Z5C A;  2WZJ A;  5IT9 S;  1ZQ9 A;  1HNW M;  3I01 M;  1QYR A;  2XLJ A;  2LXE A;  3LQQ A;  5EQT A;  2G8L A;  2Y2N A;  3SAS A;  4QOS A;  2R45 A;  2MRO B;  5KQ8 A;  1R4G A;  3KS4 A;  1L1T A;  2O5R A;  1SXJ E;  3LCV B;  3H4J A;  5EJC A;  2JZ1 A;  3WD0 A;  1OTR A;  2KA6 B;  3HKP A;  1IY1 A;  2V6Z M;  2Y0Q A;  4JI5 M;  4HMC A;  1AIW A;  2B3T A;  4K0K M;  4Z2H A;  1NHG C;  3SAV A;  1XXH A;  1WR1 B;  3KW6 A;  3AFH A;  3GPX A;  3FYD A;  4L16 A;  3GLH B;  2NQ8 C;  3RGS A;  2ERC A;  2R62 A;  3MJ5 A;  2F5N A;  2FH0 A;  4WUR A;  1JR3 D;  3TWM A;  4OVZ B;  5ITT A;  2HAK A;  1Z6T A;  2G5G X;  2LVO C;  3ZH9 B;  4MB4 A;  3KOW E;  4LFA M;  1XMO M;  1TGU A;  2X49 A;  4Z2K A;  3U6Q A;  5LMN M;  1IXS B;  1GL6 A;  1DO0 A;  3I4Y A;  1IBM M;  1J5E M;  2L2D A;  2EKK A;  2R46 A;  2FS1 A;  3GRR A;  4IJF A;  5A2Q S;  3FUW A;  3UGJ A;  4NRW A;  1K82 A;  2YR0 A;  4XBO A;  3BXW A;  4Z2L A;  3DFZ A;  1DGH B;  1XC8 A;  4KOD A;  1YU1 A;  4IIW A;  3GQ4 A;  2WSC F;  2Y20 A;  2A5Y B;  1QUS A;  3I04 M;  1Q02 A;  3BBZ A;  1TH3 A;  2LTU A;  2YFQ A;  4JI1 M;  1GPF A;  4MGI E;  3C9P A;  4RF1 A;  1AUA A;  2YNM D;  3W0F A;  2R0I A;  1NJG A;  3FYC A;  4AKG A;  1OJL A;  1O6I A;  1IN8 A;  2ZTC A;  3A46 A;  4M0W A;  1Z59 A;  2QSF X;  1CXW A;  4JI8 M;  1DGB A;  2F4V M;  3KP1 E;  5FLX S;  1YU3 A;  2JY7 A;  3CF0 A;  2QCU A;  4OU7 A;  1TTE A;  1MN3 A;  3B7N A;  4DR7 M;  2RKO A;  4JI7 M;  3QAU A;  1V33 A;  3VDP A;  3L25 A;  2QBY B;  4LF5 M;  5KO3 A;  1IXZ A;  1XWI A;  4Z6Y A;  4GMQ A;  5F3W A;  1LV7 A;  1L6J A;  4NZ5 A;  3SYL A;  2DAK A;  1IY2 A;  2UXD M;  1W1T A;  2KNZ A;  2EA0 A;  1YU4 A;  1WHC A;  4PT5 A;  2Q2E B;  3HZJ A;  4OJ5 A;  3SAU A;  2WSF F;  3L26 A;  4IBC A;  1KYI A;  2Y21 A;  3VDU A;  2CE7 A;  3E4R A;  3W67 A;  1E6R A;  2FE8 A;  3SMP A;  1E88 A;  2Y2P A;  2K6B A;  3HY5 A;  2OO9 A;  2Z3X A;  1E94 E;  3U6E A;  1QAO A;  2C96 A;  4NC6 A;  3L2A A;  2IOU A;  2EKF A;  2F5O A;  2H5X A;  2N35 A;  4LJ7 A;  3T6P A;  3FTF A;  1EE8 A;  4AQY M;  1IXS A;  2K9D A;  4R3D A;  2BJW A;  2V5O A;  4MGZ E;  3L27 A;  2BNK A;  3RE8 A;  4G4R A;  1QAQ A;  4QNM A;  3GLF E;  2CUZ A;  3LW5 F;  2DWM A;  4HMD A;  3JAM S;  3CGW A;  1R2Y A;  2KDL A;  1UR9 A;  5DYG A;  5H37 D;  2ZM6 M;  4JI0 M;  4CGY B;  2EO2 A;  1PJT A;  1W5S A;  1XHB A;  2C99 A;  1EFU B;  2JZ0 A;  2P5T A;  4XGI A;  3KDS E;  5EXT A;  1GL7 A;  4M9Z A;  1DGH A;  2JWS A;  5EP1 A;  2VQF M;  4GC9 A;  4DUZ M;  1DV0 A;  3D8B A;  1YSY A;  4I4L A;  3WX7 A;  2CWB A;  4KHP M;  3L29 A;  4LF8 M;  1YLA A;  4GIP A;  1PJI A;  1NV8 A;  2JP7 A;  1YE9 A;  2OOB A;  4S12 A;  2DEN A;  1QAM A;  1N75 A;  2UXB M;  1ZMW A;  2XGN A;  4R7G A;  1H8P A;  4KT0 F;  1TR8 A;  1OGG A;  4DV0 M;  3GLH A;  1TDH A;  4G3O A;  4GH9 A;  4LRT A;  1L2B A;  4NY2 A;  4JI3 M;  2DAM A;  2H1R A;  4ZPX A;  1G71 A;  1NNU C;  1I4W A;  3E46 A;  4DV6 M;  4DR5 M;  1HT2 E;  2DKL A;  1AIP C;  1BVS A;  2XH9 A;  4IBB A;  4OVZ A;  3T15 A;  5ITQ A;  4AKH A;  3VKH A;  1QO6 A;  4NSO B;  2Y2G A;  4LZZ A;  1Q3C A;  4RNA A;  5EP3 A;  3DA1 A;  2HKJ A;  4OJP A;  4Z2I A;  2Z4S A;  1XMQ M;  4L4U A;  3J80 S;  1KFV A;  4GKK M;  3FTC A;  3KSX A;  4M0D A;  2R18 A;  3RGP A;  4JI2 M;  2R44 A;  1YUE A;  4NYY A;  1N78 A;  4RF0 A;  1ED7 A;  2DI0 A;  4LCB A;  2AHM A;  3SMS A;  4OUI A;  2UXC M;  1R2Z A;  1L2D A;  2F5Q A;  2D7G A;  3U61 A;  1G3I A;  2MJ5 B;  3IG5 A;  4QNR A;  3GQ5 A;  4I81 A;  4DR1 M;  2CV0 A;  1IQP A;  2HCB A;  3AJI B;  3K2L A;  4NL4 H;  4IBF A;  3GQ3 A;  3T1H M;  3TE6 A;  1N77 A;  2KRU A;  2LVA A;  4LJ5 A;  1SXJ A;  1EIJ A;  4DV7 M;  1W1Y A;  2LNH C;  1TF0 B;  3U6C A;  4LFC M;  3LMM A;  4X65 M;  3DOA A;  2Y2M A;  1QQW A;  4LFB M;  4GHA A;  4WW0 A;  1PJJ A;  3HX3 A;  1PJQ A;  1IBK M;  2JY5 A;  1NSF A;  4D80 A;  4CHT B;  5KPZ A;  5BPV A;  3U6O A;  3H4M A;  4G4Q A;  4D82 A;  1C7Y A;  2D7E A;  4GKJ M;  1E6P A;  2Z4R A;  4YHH M;  1GLN A;  2X4A A;  3NBX X;  2D7H A;  2UUC M;  3AKZ A;  5FSW A;  4LRS A;  5FTN A;  4DUY M;  4Z2J A;  5EXS A;  4X64 M;  1PRB A;  2DAI A;  3SHF A;  2C9O A;  1J7M A;  3HU2 A;  2Z7J A;  2KNV A;  2OOA A;  3B89 A;  3A45 A;  4I5S A;  1RU3 A;  1VEK A;  3U6S A;  5ITX A;  2JA2 A;  2LHC A;  3GLG E;  3U60 B;  3GPY A;  3C3E A;  1QZM A;  3CF2 A;  3QWL A;  3GRU A;  2VQE M;  2BJV A;  1D2N A;  2KW0 A;  3U6L A;  4DV2 M;  3ILK A;  2L7H A;  2XFT A;  1QDR A;  2LH0 A;  2VDB B;  4JXJ A;  3VK8 A;  1E15 A;  2FFF B;  3JR5 A;  1NJF A;  1P3Q Q;  4R71 A;  2MR9 A;  5ITX E;  3GLG A;  4LJ9 A;  4L6V 6;  4GEW A;  4FCV A;  4GC5 A;  5FTL A;  3ZC7 B;  2XZU A;  2I7N A;  2M60 A;  1DGF A;  3KS8 A;  1GJT A;  1QUT A;  1VQ1 A;  1VEG A;  4II7 A;  1H0I A;  1CK7 A;  4FCW A;  4LJ4 A;  3HHZ A;  3A98 B;  1E6N A;  4IBG A;  2EJS A;  3NWL A;  4LF4 M;  2LBC A;  3FD9 A;  1QZE A;  4LF7 M;  3FTE A;  3B7Q A;  1H0G A;  3VK7 A;  1DGG A;  4RKU F;  1GJS A;  3KP0 E;  3R9X B;  5FTK A;  4LY6 A;  1XNR M;  1HQC A;  4TUW A;  4IBD A;  1GAB A;  3VKG A;  5IWA M;  2Y2I A;  2JCH A;  1VG5 A;  2LVP C;  2XEP A;  4F2L A;  3SBJ A;  2DVW B;  3TPZ A;  3I4V A;  3HHX A;  4UN2 B;  2KZU A;  3E9S A;  4BB9 A;  1ORY B;  1IXR C;  2CHV A;  3FKE A;  2FNA A;  1F4I A;  5GKN A;  1EAK A;  3U6D A;  1Z5A A;  2QP9 X;  4MB3 A;  1VDL A;  4B3S M;  1R5L A;  2RGH A;  2F5S A;  1N32 M;  1PDC A;  1W5T A;  4OJ6 A;  3KOX E;  3TQS A;  5KPR A;  1WIV A;  3KXE C;  4MH0 E;  3MHV C;  1YU2 A;  2KHH A;  3A42 A;  3UMM A;  1KS0 A;  3K1J A;  4AW4 A;  3UJN A;  1N34 M;  1L2C A;  2E5L M;  4OX9 M;  1GOI A;  1VDD A;  1A5T A;  1H6U A;  3PVS A;  2DHY A;  2JNH A;  3SAW A;  2CV2 A;  2ZTD A;  3V76 A;  3OTO M;  2BG1 A;  3WD4 A;  2DWL A;  1JR3 E;  1T3T A;  3MQL A;  4L78 A;  2CRU A;  3LQR A;  1V34 A;  1ZMV A;  2ZAM A;  2DAE A;  3SC3 A;  4AZF A;  1Q39 A;  1I94 M;  1X37 A;  3KFU G;  1YU0 A;  2DWN A;  2FOI C;  3BOS A;  1G59 A;  3UK6 A;  2JY8 A;  2R4J A;  3FUU A;  5C18 A;  2O25 A;  5ITY A;  4DV1 M;  4GIT A;  3FE3 A;  1HJP A;  1NV9 A;  4FVM A;  4GRI A;  4NXN M;  3FRH A;  4CIZ A;  1J09 A;  3GLI E;  1N36 M;  2UUA M;  2ZAO A;  2JE5 A;  4DR2 M;  2Y2K A;  2RRU A;  1FNN A;  3AOE A;  4Q7J A;  3WHL A;  5DYI A;  2G3Q A;  1IN7 A;  2LHG A;  4QHT A;  4AG6 A;  5ITU A;  3K8Z A;  3SAT A;  2KEB A;  4EIW A;  1ZV1 A;  2Y2J A;  2W82 A;  5JI2 E;  2DAG A;  2L7I A;  4JYA M;  3B74 A;  4DR3 M;  3J7B A;  5EP2 A;  3HU1 A;  2JUJ A;  4FD2 A;  1OIP A;  4BBA A;  3FRI A;  5E6J A;  1VEJ A;  2C9C A;  3J2P B;  3R8F A;  3QYE A;  1R6B X;  1SXJ C;  2VF7 A;  4ITQ A;  3WD1 A;  2KZS A;  2FFJ A;  4LJ6 A;  1DO2 A;  2Y2H A;  1NHW C;  3HWS A;  3IEC A;  3GLF B;  4AI6 A;  1GXD A;  3NBI A;  4WP2 A;  1E9R A;  2CP8 A;  1OFH A;  4PCZ A;  4DV3 M;  1OFI A;  3HJS A;  4OW0 A;  4NZ4 A;  3AL0 C;  1OKS A;  3KVW A;  4JV5 M;  2JY6 B;  2DZL A;  4TX8 A;  2DWZ B;  5EP4 A;  4QHS A;  4P17 A;  1ZMU A;  3ZCB B;  1HNX M;  2GNO A;  4MGH A;  4CIS A;  3PFI A;  3CF6 E;  2QNJ A;  5FTJ A;  1IN6 A;  2LVN C;  2I7P A;  3SYK A;  4LJA A;  5KPT A;  3GPU A;  2WSE F;  4IBE A;  3SHG B;  4CJ6 A;  4BLC A;  1TDZ A;  1TH4 A;  2MGW A;  1L1Z A;  1NVM A;  2VII A;  3FUX A;  1N33 M;  3FUT A;  1XXH E;  3AOG A;  3K9O A;  3K92 A;  2O01 F;  1HT1 E;  2APL A;  4L15 A;  4XK8 F;  4G4O A;  4B3M M;  2Y2Q A;  1D0K A;  1NO1 A;  4MGY E;  5FTM A;  3U60 A;  3TWL A;  2CHQ A;  4MB7 A;  3U5Z B;  2QZ4 A;  2FN2 A;  3M7G A;  4YY3 M;  2K47 A;  3HSH A;  3KOZ E;  1G8P A;  3M0E A;  3WD2 A;  1K3X A;  2J7O A;  1WJ7 A;  2GQF A;  2LVQ D;  3F92 A;  4Z2G A;  1XXH B;  2K0B X;  3IG8 A;  2DXI A;  4QNL A;  3U61 B;  3THG A;  1SG9 A;  2XD1 A;  3MK6 A;  1PM5 A;  3J7A S;  2DNA A;  3DZD A;  1OQY A;  2R65 A;  1IY0 A;  1SXJ B;  1OIZ A;  2V1C A;  1PGY A;  1PJS A;  3EIH A;  4P16 A;  4DV5 M;  3HJQ A;  1C1K A;  4QOZ C;  2XSZ A;  2QBY A;  1YUB A;  2DHR A;  1HR0 M;  4W5W A;  1W1V A;  4B7F A;  3HGI A;  4HLQ A;  5EXX A;  2QHO B;  2OQ4 A;  4F1I A;  2QQ8 A;  2UU9 M;  1E32 A;  1MU5 A;  1WGN A;  3W68 A;  4DR6 M;  3GLI B;  2Y0T A;  4NZ1 A;  3HHY A;  1IBL M;  4NOO B;  4B3T M;  4B08 A;  4DR4 M;  5IRE B;  4HL4 A;  2YQZ A;  3M7P A;  2KRK A;  4DBG B;  1IN5 A;  3LVW A;  4LJ8 A;  4OJL A;  1UFZ A;  3N3F A;  3HU3 A;  1FJG M;  4KO8 A;  1GO5 A;  1HQY E;  3AV0 A; 
#chains in the Genus database with same CATH homology
 3U6P A;  4IBK A;  4IBJ A;  1QAN A;  4KLN A;  2CEA A;  1K3W A;  2DZN B;  4M9S A;  1QVR A;  4B7H A;  2RGO A;  2ZAN A;  2M5Z A;  1MX0 A;  1UM8 A;  4AKI A;  3M6A A;  1SXJ D;  4LG2 A;  2C98 A;  1IM2 A;  4IBI A;  3GLG B;  2LWX A;  3J27 B;  8CAT A;  1L8Q A;  4LF9 M;  4FW9 A;  3GPP A;  3CTW B;  1NY5 A;  2CHG A;  3VFD A;  2CFO A;  3PXG A;  4X62 M;  1YU4 A;  2C5R A;  4LGY A;  3D8L A;  3J81 S;  4B7G A;  2F5P A;  4GHL A;  5KQD A;  4I8O A;  1NY6 A;  5DNY A;  1Q3B A;  1ZAE A;  2QPA A;  3WHK A;  3L28 A;  3GRY A;  4FWH A;  3SFZ A;  4NRV A;  4JI6 M;  4X66 M;  3Q8X A;  2V1U A;  2L6O A;  3GRV A;  7CAT A;  4LZJ A;  1TH2 A;  3LVV A;  3TL4 X;  4AG5 A;  3T38 A;  2XSZ D;  3GO8 A;  3U6E A;  1S3S A;  2XFS A;  5JI3 E;  4REZ A;  3T1Y M;  3HHW A;  2QEN A;  3TWK A;  3GLF A;  3I51 A;  3C58 A;  2XD5 A;  1GVN A;  1HNZ M;  4OJO A;  3HON A;  3PNY A;  2R4E A;  2ZBK B;  2XZF A;  1JR3 A;  1GKI A;  4G6Z A;  4M9X A;  4MGK E;  4G4N A;  3U6M A;  3FTD A;  2Y2L A;  2XF3 A;  5EXP A;  5EP3 A;  3EIE A;  3FUV A;  4Z8X A;  1WXQ A;  1IN4 A;  2J7N A;  4IJE A;  4JN6 A;  4PD2 A;  5IT9 S;  4DV4 M;  3UZU A;  2HL7 A;  4LGM A;  4MM3 B;  4D81 A;  4L8R C;  3B9P A;  2XD1 A;  5BR8 M;  4FCT A;  5E26 A;  3PNV A;  2L09 A;  2CV1 A;  3W0L B;  5C1B A;  2X8A A;  3GLI A;  2OPF A;  3KSJ A;  1JQJ C;  2UUB M;  2KXE A;  4NZ3 A;  1KSF X;  3GP1 A;  2HHH M;  1J7K A;  3SAR A;  3AOE C;  1R7R A;  5IZ7 D;  2UWX A;  4NXM M;  2Y2O A;  1G41 A;  3U5Z A;  4NYU A;  2DZO B;  3VLF B;  3RFW A;  1NNJ A;  4JI4 M;  4B3R M;  1Z5B A;  5LMU M;  1XNQ M;  4NSR A;  3HJ8 A;  4PDI A;  5ITR A;  4FWD A;  3KOY E;  1G4A E;  4PDG A;  2EUC A;  4A3V B;  4FWG A;  3JR4 A;  1E9S A;  4LF6 M;  1Z5C A;  1ZQ9 A;  1HNW M;  1QYR A;  2XLJ A;  2LXE A;  3LQQ A;  5EQT A;  2G8L A;  2Y2N A;  3SAS A;  4QOS A;  2R45 A;  5KQ8 A;  1L1T A;  3KS4 A;  2O5R A;  1SXJ E;  5EJC A;  2KA6 B;  3HKP A;  1IY1 A;  2V6Z M;  2Y0Q A;  4JI5 M;  4K0K M;  1NHG C;  3SAV A;  1XXH A;  3KW6 A;  3AFH A;  3GPX A;  3FYD A;  4L16 A;  3GLH B;  2NQ8 C;  3RGS A;  3MJ5 A;  2ERC A;  2R62 A;  2F5N A;  4WUR A;  1JR3 D;  3TWM A;  4OVZ B;  5ITT A;  1Z6T A;  2G5G X;  3ZH9 B;  3KOW E;  4LFA M;  1XMO M;  1TGU A;  2X49 A;  3U6Q A;  5LMN M;  1IXS B;  1GL6 A;  1DO0 A;  3I4Y A;  1IBM M;  1J5E M;  2R46 A;  3GRR A;  4IJF A;  5A2Q S;  3FUW A;  3UGJ A;  4NRW A;  1K82 A;  2YR0 A;  4XBO A;  3DFZ A;  1DGH B;  1XC8 A;  4KOD A;  1YU1 A;  4IIW A;  3GQ4 A;  2Y20 A;  2A5Y B;  1TH3 A;  2YFQ A;  4JI1 M;  4MGI E;  4RF1 A;  2YNM D;  3W0F A;  3FYC A;  1NJG A;  4AKG A;  1OJL A;  1IN8 A;  3A46 A;  4M0W A;  1Z59 A;  4JI8 M;  1DGB A;  2F4V M;  3KP1 E;  5FLX S;  1YU3 A;  3CF0 A;  2QCU A;  4OU7 A;  4DR7 M;  2RKO A;  4JI7 M;  3QAU A;  3VDP A;  3L25 A;  2QBY B;  4LF5 M;  5KO3 A;  1IXZ A;  1XWI A;  4Z6Y A;  4GMQ A;  5F3W A;  1LV7 A;  4NZ5 A;  3SYL A;  2UXD M;  1IY2 A;  2EA0 A;  4PT5 A;  2Q2E B;  4OJ5 A;  3SAU A;  3L26 A;  4IBC A;  1KYI A;  2Y21 A;  3VDU A;  2CE7 A;  3E4R A;  2FE8 A;  3SMP A;  2Y2P A;  2Z3X A;  1E94 E;  1QAO A;  2C96 A;  3L2A A;  2IOU A;  2F5O A;  4LJ7 A;  3FTF A;  1EE8 A;  4AQY M;  4R3D A;  2BJW A;  4MGZ E;  3L27 A;  2BNK A;  3RE8 A;  4G4R A;  1QAQ A;  4QNM A;  2DWM A;  2CUZ A;  3JAM S;  1R2Y A;  5DYG A;  5H37 D;  2ZM6 M;  4JI0 M;  4CGY B;  2EO2 A;  1W5S A;  1XHB A;  2C99 A;  2P5T A;  4XGI A;  5EXT A;  3KDS E;  1GL7 A;  4M9Z A;  1DGH A;  5EP1 A;  2VQF M;  4GC9 A;  4DUZ M;  3D8B A;  1YSY A;  4I4L A;  3WX7 A;  4KHP M;  3L29 A;  4LF8 M;  4GIP A;  1PJI A;  1YE9 A;  4S12 A;  2UXB M;  1QAM A;  1N75 A;  2XGN A;  4R7G A;  4DV0 M;  3GLH A;  1TDH A;  4GH9 A;  4LRT A;  1L2B A;  4NY2 A;  4JI3 M;  2H1R A;  4ZPX A;  1NNU C;  4DR5 M;  1I4W A;  4DV6 M;  1HT2 E;  2XH9 A;  3T15 A;  4IBB A;  4OVZ A;  2Y2G A;  4AKH A;  5ITQ A;  3VKH A;  4NSO B;  4LZZ A;  1Q3C A;  4RNA A;  3DA1 A;  2HKJ A;  4OJP A;  2Z4S A;  1XMQ M;  4L4U A;  3J80 S;  1KFV A;  4GKK M;  3FTC A;  3KSX A;  4M0D A;  2R18 A;  3RGP A;  4JI2 M;  1YUE A;  4NYY A;  1N78 A;  4RF0 A;  4LCB A;  2AHM A;  3SMS A;  4OUI A;  2UXC M;  1R2Z A;  1L2D A;  2F5Q A;  2D7G A;  3U61 A;  1G3I A;  3IG5 A;  4QNR A;  3GQ5 A;  4DR1 M;  4I81 A;  2CV0 A;  1IQP A;  2HCB A;  3AJI B;  3K2L A;  4NL4 H;  4IBF A;  3GQ3 A;  3T1H M;  3TE6 A;  1N77 A;  2KRU A;  4LJ5 A;  4AI6 A;  1SXJ A;  4DV7 M;  2LNH C;  3U6C A;  4LFC M;  3LMM A;  4X65 M;  3DOA A;  2Y2M A;  1QQW A;  4LFB M;  4GHA A;  4WW0 A;  1PJJ A;  1IBK M;  4D80 A;  1NSF A;  3U6O A;  4CHT B;  5KPZ A;  5BPV A;  3H4M A;  4G4Q A;  4D82 A;  4GKJ M;  2D7E A;  2Z4R A;  4YHH M;  1GLN A;  2X4A A;  2D7H A;  2UUC M;  3AKZ A;  5FSW A;  4LRS A;  5FTN A;  4DUY M;  5EXS A;  4X64 M;  3SHF A;  2C9O A;  3HU2 A;  2Z7J A;  4I5S A;  3A45 A;  3U6S A;  3U60 B;  5ITX A;  2JA2 A;  3GPY A;  1QZM A;  3CF2 A;  3QWL A;  3GRU A;  2VQE M;  2BJV A;  1D2N A;  2KW0 A;  3U6L A;  4DV2 M;  3ILK A;  2L7H A;  2XFT A;  2FFF B;  2LH0 A;  4JXJ A;  3VK8 A;  3JR5 A;  1NJF A;  5ITX E;  3GLG A;  4LJ9 A;  4FCV A;  4GC5 A;  5FTL A;  3ZC7 B;  2XZU A;  2I7N A;  2M60 A;  1DGF A;  3KS8 A;  4II7 A;  4FCW A;  4LJ4 A;  3HHZ A;  3A98 B;  4IBG A;  3NWL A;  4LF4 M;  3FD9 A;  4LF7 M;  3FTE A;  3VK7 A;  1DGG A;  3KP0 E;  3R9X B;  5FTK A;  4LY6 A;  1XNR M;  1HQC A;  4TUW A;  4IBD A;  3VKG A;  5IWA M;  2Y2I A;  2JCH A;  2XEP A;  3SBJ A;  2DVW B;  3TPZ A;  3I4V A;  3HHX A;  2KZU A;  3E9S A;  4BB9 A;  1ORY B;  1IXR C;  2CHV A;  3FKE A;  2FNA A;  5GKN A;  3U6D A;  1Z5A A;  2QP9 X;  4B3S M;  2RGH A;  2F5S A;  1N32 M;  1W5T A;  4OJ6 A;  3KOX E;  3TQS A;  5KPR A;  3KXE C;  4MH0 E;  3MHV C;  1YU2 A;  3A42 A;  3UMM A;  3K1J A;  4AW4 A;  3UJN A;  1N34 M;  1L2C A;  2E5L M;  4OX9 M;  1VDD A;  1H6U A;  3PVS A;  3SAW A;  2CV2 A;  3OTO M;  2BG1 A;  2DWL A;  1T3T A;  4L78 A;  3LQR A;  2ZAM A;  3SC3 A;  4AZF A;  1Q39 A;  1I94 M;  1X37 A;  3KFU G;  2DWN A;  2FOI C;  3BOS A;  1G59 A;  3UK6 A;  2R4J A;  3FUU A;  4DV1 M;  5C18 A;  5ITY A;  4GIT A;  4GRI A;  4NXN M;  2JE5 A;  4FVM A;  1N36 M;  2UUA M;  1J09 A;  2ZAO A;  2Y2K A;  4DR2 M;  1FNN A;  3AOE A;  3WHL A;  5DYI A;  1IN7 A;  5ITU A;  4QHT A;  4AG6 A;  3K8Z A;  3SAT A;  2KEB A;  4EIW A;  2Y2J A;  2W82 A;  5JI2 E;  2L7I A;  4JYA M;  4DR3 M;  3J7B A;  5EP2 A;  3HU1 A;  4FD2 A;  4BBA A;  5E6J A;  2C9C A;  3J2P B;  3R8F A;  1R6B X;  1SXJ C;  4ITQ A;  2KZS A;  2FFJ A;  4LJ6 A;  1DO2 A;  2Y2H A;  1NHW C;  3HWS A;  3GLF B;  1YU0 A;  3NBI A;  1E9R A;  1OFH A;  4PCZ A;  4DV3 M;  1OFI A;  3HJS A;  4OW0 A;  4NZ4 A;  3AL0 C;  3KVW A;  4JV5 M;  2DWZ B;  5EP4 A;  4QHS A;  3ZCB B;  1HNX M;  4MGH A;  4CIS A;  3PFI A;  3CF6 E;  5FTJ A;  1IN6 A;  3SYK A;  2I7P A;  4LJA A;  5KPT A;  3GPU A;  4IBE A;  3SHG B;  4BLC A;  1TDZ A;  1TH4 A;  1L1Z A;  1NVM A;  2VII A;  3FUX A;  1N33 M;  3FUT A;  3AOG A;  3K92 A;  1HT1 E;  4L15 A;  4G4O A;  4B3M M;  2Y2Q A;  5FTM A;  4MGY E;  3U60 A;  3TWL A;  2CHQ A;  4MB7 A;  3U5Z B;  2QZ4 A;  3M7G A;  4YY3 M;  2K47 A;  3HSH A;  3KOZ E;  1G8P A;  3M0E A;  1K3X A;  2J7O A;  1XXH B;  3IG8 A;  2DXI A;  4QNL A;  3U61 B;  3THG A;  3MK6 A;  1PM5 A;  3J7A S;  3DZD A;  2R65 A;  1IY0 A;  1SXJ B;  2V1C A;  3EIH A;  4P16 A;  4DV5 M;  3HJQ A;  1C1K A;  4QOZ C;  2XSZ A;  2QBY A;  1YUB A;  2DHR A;  1HR0 M;  4W5W A;  4B7F A;  3HGI A;  4HLQ A;  5EXX A;  2OQ4 A;  2UU9 M;  1E32 A;  1MU5 A;  4DR6 M;  3GLI B;  2Y0T A;  4NZ1 A;  3HHY A;  1IBL M;  4NOO B;  4B3T M;  4B08 A;  4DR4 M;  5IRE B;  4HL4 A;  2YQZ A;  2KRK A;  1IN5 A;  3LVW A;  4LJ8 A;  4OJL A;  3N3F A;  3HU3 A;  1FJG M;  4KO8 A;  1HQY E;  3AV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...