2Y2LA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e06)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
489
structure length
472
Chain Sequence
ISEITYSDGTVIASIESRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 162
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2lA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2lA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2lA02
2EX6A 5TGFA 1XPBA 3IF5A 2WYXA 2J8YA 5EVIC 2H10A 1PWGA 3BEBA 3S4XA 3ZFZA 4JF5A 1FQGA 5CEDA 1RGYA 3IWOA 4OOLA 5HL1A 3WWXA 1CK3A 5FQKA 4E3MA 4PM9A 2WKEA 3I7JA 1ES2A 1KE0A 2HP5A 3IHAA 2A49A 3PBRA 4FCFA 4QD4A 3FWLA 3UN7A 4N1HA 1CI9A 5CGXA 3HLDA 2QZ6A 4S2LA 3C7UA 1ERMA 3V3RA 1ES5A 2PBYA 5GHZA 5BOHA 2HPBA 4BJPA 4EUZA 2G2UA 3FKVA 3VMAA 1XX2A 3UPNA 4WEJA 5E43A 2Q9MA 2DNSA 5E2GA 3VP1A 1IELA 2WKHA 2FFYA 1E3UA 1BSGA 5KMWA 4JXGA 1HTZA 4S2JA 4OP8A 3WS0A 3Q1FA 2XF3A 4N9LA 1AXBA 1O7EA 1K54C 3PBNA 4S2MA 3WRZA 5F1FA 5DTSA 1MWUA 1ESUA 1YLYA 4ZJ1A 1MWRA 4QJGA 2XFSA 1FCMA 3Q7VB 3UE3A 5IHVA 3VFFA 4HESA 5EVIB 2WGWA 1JVJA 1K25A 5EOEA 2OSUA 4RX2A 2H0YA 1G68A 1JTDA 3PBTA 2Y2IA 3ZG7B 3NBLA 2VGJA 2B5RA 1LL5A 4H8RA 4WBGA 1NRFA 4WYYA 1K57A 2V20A 3G31A 3QNBA 1L2SA 3LEZA 1N9BA 2XDMA 1BLSA 1GA0A 1GHIA 2XGNA 2ZM8A 5DF9A 5FSRA 1XGIA 2Y2MA 2Y2HA 3O86A 5HAPA 1DJCA 1Z6FA 4R1GA 3HUMA 4OQGA 3IXBA 3UDXA 5FI6A 4DE0A 1Y54A 1YQSA 4OLDA 2EX2A 4C6YA 5EECA 5FQQA 1KE3A 5CGWA 1J9MA 2ZM2A 1EROA 2HP6A 1W8QA 3CMZA 2XD1A 2Z2MB 2C5WB 3AGDA 4NK3A 1XGJA 3Q82A 4LV0A 2J9OA 4MBFA 5EVLA 1K6RA 3VP4A 5JYOA 4QY5A 4F94A 2H5SA 1BULA 5DVAA 1IKIA 3SH7A 4E3OA 5I94A 2JE5A 1SKFA 2J7VA 3OPLA 3IF6B 4KQRA 1W79A 4X53A 4KQOA 4DE1A 4OP5A 5FDHA 2Z2LB 2DCFA 3W4OA 4DKIA 4XUZA 5DF7A 4EV4A 1BTLA 2ZC6B 4MBHA 3HLFA 4GKUA 1YLTA 3EQUA 4RYEA 2P9VB 3UO9A 3SS3A 2Y2QA 1KDSA 2ZC5B 4IBXA 4PM8A 2ZQAA 3A3EA 5GHYA 4MBKA 3P98A 1YLZA 3GV9A 2WUQA 2WAEA 4EWFA 1K56A 1ZKJA 2Y4AA 4OQIA 1K55C 4JXVA 3W4QA 1OMEA 1KGEA 1BT5A 1L0GA 1KGFA 4MLLA 4R3JA 1MPLA 4QB8A 4LV2A 3TSGA 1PYYA 3UPOA 3BRMA 4KZ7A 2Y2KA 4BD1A 5HW3A 4FH4A 4QY6A 4XUXA 1JWVA 4ID4A 1H8ZA 3VP0A 1HZOA 1SDEA 4M3KA 3GQZA 4UA7A 1HVBA 2ZD8A 2WKIA 5CECA 4K91A 3TOIA 1IEMA 5CRFA 1H5XA 3QNCA 5FQMA 2X71A 5EPHA 3MFDA 2GDNA 4MEZA 1I2WA 2R9XA 1PWCA 3UPPA 4WZ5C 3ZGAB 1ESIA 4BL2A 4DDSA 4KG5A 1M40A 3S22A 2HDUA 1ZC2A 4KZ3A 5CHMA 1IKGA 3V3SA 3QHYA 4S2NC 3ZG8B 4WZ4A 5EE8A 3TG9A 1KE4A 3G34A 4LV1A 1KDWA 5GLAA 3OCNA 3LY4A 3N8SA 1PI5A 3PAGA 3V50A 1U60A 3AGFA 3DWKA 3D4FA 1JWPA 1K54A 4OPQA 1M6KA 3ZNYA 2ZQ9A 1XXMA 5HAIA 5FAQA 3HL9A 4P85A 4MNRA 1MBLA 2WAFA 4JBFA 4P87A 4IVKA 2P74A 3PBQA 4OKPA 1K4EA 1ONGA 1RGZA 1CI8A 1FR6A 4IBRA 4OPRA 2IWBA 3UY6A 3C4PA 4U3TA 2EFUA 4GZBA 5FATA 2QPNA 4OQHA 2WGIA 3P09A 3IWIA 5KSCA 4WMCA 3IXGA 2XQZA 4KG6A 4R23A 5GL9A 2WZXA 5HAQA 2JCHA 1YM1A 4N1XA 1NZOA 4B4ZA 4Y0UA 4PPRA 3ISGA 4DXCA 2H0TA 2IWCA 3HLWA 3FZCA 3IF6C 3VSKA 3C7VA 2JBFA 3PAEA 1LLBA 3HUOA 3BECA 4LENA 1XP4A 4OONA 3NI9A 3MXSA 3NY4A 3BLSA 4O7DA 2QMIA 3BFDA 3WS2A 2HDSA 3OZHA 1K56D 1LI0A 3HVFA 2HP9A 3HLEA 4PM7A 1FSYA 5FA7A 3VOZA 4Y7PA 2IWDA 3CG5A 4KZ9A 1RP5A 3HLCA 5A91A 4C3QA 2XK1A 1K38A 3RJUA 5M18A 3MXRA 5FQ9A 4KZAA 4Y0TA 3WS1A 5FASA 3MKEA 4E3NA 1WYBA 4KZ8A 2JC7A 3A3DA 3IXDA 2Y2PA 3MZEA 4P0MA 5CEBA 1SHVA 2I72A 4E3LA 3SS4A 4A5RA 1PIOA 4HBUA 2Y2JA 3C5AA 2ZQ7A 4UAAA 4EBNA 1HD8A 1E25A 3JYIA 3SH8A 2ZM0A 5FI2A 1K55A 4C75A 4IEDA 5HFOA 5DTKA 1RCJA 2ZMAA 5G18A 1PW1A 4OLGA 3NIAA 1I2SA 2PU2A 4JF4A 4LV3A 5DTTA 2XD5A 3IHBA 4QU3A 4WM9A 5EUAA 4KZBA 1DJAA 3ZG5A 4JF6A 4EBPA 1L0EA 1TVFA 1BLHA 3O3VA 3FV7A 4X55A 1ERQA 3DTMA 3IH9A 3W4PA 1BZAA 4K0WA 4YFMA 2VGKA 3ZVWA 3Q7VA 4B4XA 4GOGA 3HBRA 3SOIA 1NJ4A 4WEKA 4E3JA 5EVIA 3VFHA 1ZG6A 2ZJ9A 4N92A 3NDEA 2Y2NA 2ZLYA 1TEMA 3PBOA 3SS5A 2EXBA 4BLMA 2E8IA 2ZC4B 4DDYA 4S2NA 5U47A 1O07A 1E3UD 1FCOA 1S6RA 5GHXA 4K0XA 1SDNA 2PU4A 2XEPA 4RVAA 4BD0A 3LY3A 2DRWA 3E2KA 1YT4A 3OPPA 1TDLA 1EWZA 2C6WB 3ITAA 1LHYA 3SH9A 1WYCA 4IVIA 2OV5A 4GDBA 4B88A 1JWZA 1ONHA 3MZFA 5GLCA 1G6AA 3RXXA 1W8YA 4R4RA 3IWQA 2RL3A 5M1AA 3AGEA 3UDFA 4QHCA 1Q2QA 3GSGA 2EX9A 5FQJA 4U0TA 1PI4A 4UA6A 1S0WA 2G2WA 4NETA 4S2OA 1L0FA 2ZC3B 3G2ZA 5CTMA 4EQIA 3CJMA 4UHUA 2WGWB 3C4OA 1QMEA 2WGVA 3IXHA 3M6HA 1K4FA 3N4IA 1MKIA 3N8RA 4PM6A 2OLVA 4JXSA 4L0LA 3GVBA 4GD6A 1MY8A 3OPHA 5CERA 4CJNA 1SCWA 3IF6A 4YINA 4LCMA 4X6TA 3G35A 3MKFA 3Q07A 5FI7A 4GD8A 1XA1A 2WZZA 4R4SA 3GRJA 3M2JA 5F82A 1YMXA 2EXAA 1JTGA 1IYOA 2P9VA 4KZ5A 3ZCZA 2Y91A 3VP2A 3UE0A 3A3FA 4CPKA 5CGSA 5L2FA 3G4PA 4XXRA 2V2FF 4KQQA 3LCEA 3Q81A 1DJBA 1KVLA 2XLNA 3N7WA 1C3BA 1BLCA 1PZPA 3FKWA 3UNWA 2R9WA 3ZG9B 4E3KA 4GNUA 3WS5A 3LO7A 1ES3A 3V5MA 2CC1A 4N9KA 2ZC7A 5EOOA 4S2PA 3EQVA 1YLJA 4JKTA 2XFTA 1FR1A 5FAOA 4X56A 5F83A 1VM1A 2Y59A 4FSFA 5AQ9A 1NZUA 3HREA 1CEFA 1YLWA 3Q7ZA 4X69A 1ES4A 3OCLA 3M6BA 4Z9QA 4FH2A 3UDIA 1GCEA 3IH8A 1GHPA 5AQAA 3A3IA 2Y2LA 5GLDA 4BL3A 3GR2A 3N8LA 5TR7A 4BENA 5EVID 1LL9A 4ZDXA 3HUNA 5M19A 1NXYA 4FD8A 5E2EA 4ZJ3A 4Q8IA 2OLUA 2Q9NA 1W5DA 2WK0A 3ITBA 4E6WA 5HX9A 3BFCA 1PZOA 3ZNTA 2V1ZA 3O88A 4OOMA 5A93A 3N6IA 1LI9A 1FOFA 4R3BA 3ZVTA 1YMSA 1QMFA 4U0XA 4S2IA 2XH9A 1K6SA 1BUEA 3ZHHA 3DWZA 1FCNA 3BFFA 4DE3A 5F1GA 5A92A 5TFQA 2ZQ8A 3G2YA 1EI5A 1NYMA 4OPYA 4DE2A 3NCKA 4DRTA 1MWTA 3O87A 1CEGA 3BYDA 3PTEA 2A3UA 1PWDA 2ZQCA 4GN2A 4RA7A 4ZAMA 2BLSA 3G32A 1I5QA 1W7FA 2WADA 2J9PA 1GA9A 5E2FA 4OQ0A 1H8YA 4OOYA 3V39A 5KSHA 1NY0A 4ZJ2A 3VOYA 5KZHA 1E4DA 3GTCA 4OH0A 3BLMA 1K57C 1YLPA 1VQQA 1IYPA 2X02A 1MXOA 3OPRA 5FQIA 2XR0A 4D2OA 3B3XA 1L0DA 1Q2PA 2Y55A 4R0QA 3PBSA 3CZDA 4Y0OA 4OPZA 3HLGA 5A90A 3WRTA 1BLPA 1WE4A 3BFEA 2X01A 3G30A 3IT9A 4WZ5A 4DF6A 2HDRA 1ZG4A 1ALQA 3A3JA 1FSWA 3ZG0A 2FFFB 4KZ4A 5DF8A 4E3IA 4DXBA 4RX3A 5AQBA 4WMCD 4EBLA 3BM6A 3GMWA 2ZQDA 3IQAA 4GDNA 5D3OA 4HEFA 4GB7A 4WELA 2UWXA 4JLFA 5AQ7A 5CHJA 3ZDJA 5GLBA 3VP3A 3UE1A 4E6XA 1XA7A 4P6BA 3BFGA 4JXWA 4JPMA 3W8KA 1PW8A 3E2LA 5HARA 3HLBA 1KVMA 4KZ6A 4KENB 3NDGA 5JYPA 5CTNA 5CXWA 1DY6A 4ZTKA 3RXWA 2Y2OA 4PMAA 2EFXA 2BG1A 1TDGA 3MBZA 3NC8A 1IYQA 4KG2A 3MZDA 1MWSA 1IYSA 1GHMA 4UA9A 2HDQA 1XKZA 3WS4A 1KGGA 3DW0A 3S1YA 4LCLA 4X68A 4OVDA 2Y2GA 3OC2A 4BQMA 3VSLA 4ZBEA 2EX8A 4S2KA 5CHUA 3FYZA 5E2HA 4PM5A 1N4OA 1NYYA 2RCXA 4HBTA 5J8XA 5FAPA 3M2KA
chains in the Genus database with same CATH superfamily
1A7WA 3X1SB 4EETB 2WKRA 2F8NG 1P3FB 5L07A 2J8YA 2B02A 5EVIC 3VE3A 3S4XA 4EEUA 1YU4A 4IJFA 1P9WA 3LIFA 1RGYA 5HL1A 4EQ1A 3H7WA 3QP8A 2CV5A 2V8FA 4WU9B 5B33D 4KGCB 3LZ0C 2O0YA 3OBFA 1H3OB 3MVDC 3X1VB 4S2LA 3AZMA 5GHZA 1OGBA 1D7EA 3LICA 3AV2A 3C1BB 3VMAA 3CLOA 5AV5B 3MS6A 5E43A 4KUDC 4I39A 2NUPC 1IELA 4ETZA 5B0ZC 2FFYA 5HZHA 3WAAD 4KHAA 3W98B 3C1CB 5DKKA 5B24D 1O7EA 4ZRRA 5F1FA 4WUJA 5DTSA 5AVBC 3FPVA 2GX5A 3T4OA 3LIBA 2WGWA 2OSUA 1F1EA 3W99A 4RX2A 4D60A 2Y2IA 4H6JA 3ZG7B 1QO6A 5FL3A 1P3AB 4WBGA 1NRFA 4WYYA 2VV7A 3AZJC 3X1UD 1L2SA 1KX3C 1BH8B 3LJAC 5DF9A 1E6PA 4Q0JA 2W3HA 4J8VB 3A1IA 3KWQC 1Y54A 2BTFP 4YS3D 1M1AB 2HP6A 2IO5C 2Y8HA 3Q82A 5G49A 5DNNB 1E8BA 3UTBD 3VOLA 2H5SA 3MGQA 5C5KA 1BULA 1S4SA 4YM6A 1IKIA 4E3OA 2CV5D 3OPLA 1M18A 3AZKB 1W79A 1P3LA 1N1JA 2NZDA 5FDHA 2Z2LB 2DCFA 4XUZA 1SKOA 4YOFA 4RYEA 3HLFA 4GKUA 5BO0B 4HMDA 4J8UB 1JNUA 3SS3A 1J7MA 4PM8A 5E5AB 5B33C 3L25A 2V0UA 4MBKA 3P98A 1YLZA 1WWSA 2LY8A 3MQOA 2HF6A 1ZKJA 3FC7A 3AZGA 1S4RA 4JXVA 1L0GA 4H9OA 1KGFA 5GXQB 4R3JA 1MPLA 2PBDP 3JVUA 1IOUA 4E44A 3UPOA 4MN5A 4QY6A 3S7OA 1HZOA 4H9PB 1OGGA 5GT0A 1Q9CA 5HWWA 1IEMA 3WKJB 3EGXC 3NQJB 2IA2A 1H5XA 5FQMA 3NOTC 3MFDA 3B47A 4I3IA 3B6FA 4HP4A 5B24C 1PWCA 4EERA 3W99D 2PAVP 1P97A 2ZBBA 1IKGA 4LD9A 4RQ9A 4S2NC 2YFVA 1NLYA 4LV1A 3OCNA 3N8SA 1PI5A 3EPKA 3V50A 2HIOB 3AGFA 3D4FA 1JWPA 3ZNYA 3UB9A 5I5LA 1X0OA 3X1UC 3LGOA 3O62B 2NQBA 1P3PD 2WAFA 4OKPA 2PRFA 2XROA 1ONGA 1RGZA 1VEUA 3MGPD 3B6GB 4EEPA 3C4PA 4Z2MG 4OQHA 2D49A 2P08A 3SW1A 4YS3C 2JCHA 3DTKA 3S7PA 4AWLC 4YM6D 3F1NB 3HLWA 1M18D 2V1BA 1P3LD 4I5SA 2NZDD 3UTBC 1DP6A 4LENA 4J8WB 2W3DA 5B0YA 5B2JB 2Z6DA 2CV5C 5DFYA 2QMIA 5FUGB 4GLQA 3WS2A 4XUJA 3X1SA 1P3FA 4HGAC 1E6ZA 2HP9A 1F5MA 3HVFA 3AZGD 3AZHB 3BW6A 2F8NB 4KZ9A 1RP5A 3HLCA 2XK1A 3RJUA 3MXRA 3E0YA 3T4QA 5FQ9A 4WU9A 4E3NA 4KGCA 1WYBA 4R38A 2HZ5A 2JC7A 2Y2PA 1H3OA 3KUYD 3X1VA 3AZFB 3LR4A 4WL9A 3C30A 4R8PD 3B6FD 3W96B 3C1BA 2J80A 2ZM0A 3AYWB 1K55A 1KX4D 4IEDA 3QP4A 1Y4OA 5AV5A 2F8NH 1ZLAB 4LD9D 1I2SA 2PU2A 4JF4A 4LV3A 2XD5A 1W63Q 3IHBA 3W99C 3NQUB 2QKPA 3TE8A 3W98A 3C1CA 1TVFA 3NOPC 3O3VA 3D9YA 4II7A 4X55A 5B31G 1OTBA 2KX6A 4K0WA 4NG2A 2NQBD 2FH5A 2VGKA 5AV9B 3QP2A 3VFHA 4N92A 3AFAD 2FN2A 3SS5A 1TEMA 1P3PC 2E8IA 2ZC4B 1P3AA 3MGPC 4GCZA 2PU4A 1V9ZA 1BH8A 3WD3A 3P01A 5DFXA 3E2KA 2HUEB 1EWZA 2C6WB 1LHYA 1WYCA 4IVIA 4J8VA 4B88A 1L3LA 5GLCA 3M7PA 4WJ3C 1W8YA 5B0YD 4YM6C 3UDFA 4QHCA 1M1AA 4IBIA 2EX9A 1E88A 2HGVA 4X1LA 2NZDC 3CJMA 1P3FD 4NXFA 5DNNA 3WX7A 3IXHA 3N8RA 2DQNC 4I3JA 4PM6A 1XFNA 3L7HA 3QP6A 5TBMB 5B40B 3H9WA 4MB5A 4OUIA 3DBAA 3AZKA 4X6TA 4WU9D 3AZGC 3F1OB 4R4SA 3GRJA 3M2JA 1YMXA 3AL0C 5CP6B 1TS6A 5BO0A 1JTGA 4QPRA 4J8UA 2Y91A 3TJZC 3A3FA 4GS9B 5G4ZA 5E5AA 5L2FA 1GSWA 3C1BD 2XLNA 1C3BA 1BLCA 3FKWA 3KUYC 3C8CA 2R9WA 4E3KA 5AV5D 1KOUA 1TF1A 3LO7A 5GXQA 1PDCA 1ES3A 3V5MA 4R8PC 3B6FC 2O99A 4Z66D 3CPTB 3IX8A 1FR1A 5FAOA 5F83A 4FSFA 1KX4C 3W98D 3Q7ZA 4H9PA 4LD9C 2HV1A 4X69A 1T1AA 3WKJA 1GCEA 3NQJA 4WZSB 5AQAA 4DJ3A 4WU8D 3A3IA 2QYBA 1OPXA 3LELD 4BL3A 1F66B 4ZDXA 3A6NB 2NQBC 4NE3A 3UB8A 2WK0A 3MXQA 4E6WA 1P3AD 5CPJD 4OOMA 3KS8A 3N6IA 1LI9A 3AFAC 1FOFA 1QMFA 4F3LB 2HIOA 3BFFA 1UR8A 3QP1A 5J3WA 4DE3A 5A92A 3O62A 4DRTA 1MWTA 1CEGA 4EU0A 4CLCC 3B6GA 3AZLD 1GA9A 4X23B 5KSHA 5DNND 4LGWA 1E4DA 4IBEA 4UPKA 3GTCA 4IUHA 4OH0A 1YLPA 4DQYB 4LFUA 1N9LA 4WF0A 3F1NA 4D2OA 4OJPA 2XRNA 1P3FC 3AZKD 4Y2FA 1Q2PA 5A90A 2P7JA 3HLGA 1XJ6A 2AVXA 1P3KD 3BJNA 4J8WA 3AZMB 3IT9A 4KUOA 1ZG4A 5B2JA 1ALQA 4IBKA 3A3JA 4QWOA 4H9RB 4J8UD 3T1RA 2IOUA 2K2NA 3L26A 4RX3A 4WU9C 5E5AD 3MQQA 5FUGA 3IQAA 4Z2MH 3V67A 5JA4A 4GB7A 4WELA 5EVEA 1W1YA 5AQ7A 3EEHA 3AZHA 5GLBA 5HDDA 3BQAA 5GXQD 2F8NA 4Z2JA 1XA7A 3C1BC 3BFGA 3W8KA 3HLBA 1S32B 5CTNA 5CXWA 5BS7C 1DY6A 5AV5C 3NC8A 3PHYA 3WKJD 4Z66C 3AZFA 1XKZA 3WS4A 3DW0A 3W98C 1TS8A 3W96A 3C38A 5CHUA 3FYZA 3AYWA 4L9GA 4PM5A 4WU8C 3MGRD 1ZLAA 3LELC 4PHTA 5TGFA 4GH9A 1P3OD 2H10A 3NQUA 3ZFZA 5GT3D 3REJC 3IWOA 2HIOD 1CK3A 4E3MA 1P3AC 2EWVA 5CPJC 3O62D 5IS1A 1KE0A 2HP5A 5AV9A 3PBRA 3IP4C 5B31B 3JPUA 4QD4A 3FWLA 3UN7A 1H0MA 5CGXA 3HLDA 2QZ6A 4E45A 3V3RA 1ES5A 5BOHA 1LSVA 3EOIA 4EUZA 3V9RB 4HQAA 3HONA 2G2UA 3FKVA 1XX2A 3AZLC 4G3KA 1N9NA 2O9BA 5CX7A 5K5BA 3CHWP 1HQ3C 1E3UA 5DNNC 4JXGA 1E6RA 4G92B 3B0DB 3WS0A 1AXBA 3VH5A 4J8WD 4EUVA 1MWRA 5B2JD 2XFSA 3LYXA 3AZKC 3VFFA 1P3KC 1T3UA 4I38A 1K25A 2H0YA 1JTDA 3PBTA 4Z2HA 5DJTA 4J8UC 2VGJA 3AZHD 1CJFA 2EWWA 2YKHA 2F8ND 5IU1A 5TBMA 2V20A 5B40A 2L1MA 4O8GA 3IBJA 3LEZA 2CWEA 1N9BA 4FTXA 4BMWA 1GA0A 2ZM8A 2XGNA 1E15A 1AWIA 5FSRA 3F1OA 2RVQD 5GXQC 1J3WA 1DJCA 1Z6FA 5CP6A 3HUMA 4DE0A 5FI6A 3AZFD 2EX2A 4GS9A 1KE3A 4LRYC 3W96D 1EROA 3AYWD 3CMZA 1ACFA 2Z2MB 3AGDA 1ZLAD 4LV0A 3S7QA 3CPTA 3L27A 4QY5A 1NWZA 4P6ZM 3LIEA 3MGRC 5DVAA 3SH7A 2VLGA 2JE5A 3IF6B 2G5HC 2PR5A 1P3OC 2ZOHA 5AV9D 3LIAA 1VHMA 5GT3C 3W4OA 2D01A 4DKIA 2ZC6B 2HIOC 1F66A 1YLTA 3UO9A 1KX5B 2Y2QA 4G91C 2ZC5B 3A6NA 3O62C 3A3EA 5GHYA 4KQDA 4M4XA 1CQAA 1GPFA 4EWFA 3MNND 5B1MC 3W4QA 1B67A 1BT5A 1OT6A 2A2LA 3EG5B 4F3LA 4QB8A 3BRMA 4NE5A 4FH4A 4XUXA 3VP0A 4J8XD 4ID4A 1S1YA 2ZD8A 1VETB 3KSFA 4K91A 3TOIA 3WA9B 2O9AA 3RFBA 2I9VA 4XUJB 5DJUA 3UPPA 4J8WC 4DDSA 1ESIA 4BL2A 4X23A 4H9SA 5B2JC 1M40A 5EFWA 5CHMA 1HTAA 3QHYA 4XT2B 4WZ4A 3VH6A 3ZG8B 5EE8A 5CPKB 1WA9A 3LY4A 5AV8B 3AZHC 1MKMA 1K54A 4OPQA 2VX8A 1W1TA 4NZ5A 1EQZB 2ZQ9A 5FDSA 1XXMA 2ZY4A 4H9RA 3R45B 4JBFA 2P74A 3PBQA 3LI9A 4OPRA 1FR6A 2IWBA 2RVQC 5CPID 3UY6A 2EFUA 5FATA 3AZFC 2FJ7B 2WGIA 3IWIA 4WMCA 3IXGA 4KG6A 5GL9A 3W96C 2ZM5A 1YM1A 4HJ4A 3AYWC 1S32A 5HDCA 4B4ZA 3B0BA 1ZLAC 4PPRA 4DXCA 2H0TA 3H0LC 1D1JA 3PAEA 1LLBA 3HUOA 2DF4C 3KSIA 1F66D 4GW9A 3A0RA 4PKYG 3NY4A 3AZNB 3BLSA 4O7DA 2V0WA 1ZTUA 1BFMA 3MMHA 5AV9C 4MB3A 2HDSA 5A8BA 3OZHA 4NZ3A 3UT9B 1LL8A 3HLEA 2PYOB 4PM7A 3AZEB 2IWDA 4IBCA 3O5YA 5M18A 5A91A 5JRGB 3REKD 4KZAA 3MNNC 5FASA 3NECA 2L5AA 1U35B 5B31A 2HUEC 1SHVA 5HWVA 2I72A 4E3LA 5DNMB 4JGPA 4J8XC 2ZQ7A 1HD8A 2Q0OA 3V9RA 4X23D 5HFOA 2A24B 5BNVB 3W97B 4QU3A 4WM9A 4KZBA 1DJAA 1V9YA 4EBPA 1L0EA 3MQLA 1BLHA 4NXBA 1P3IB 3KFUG 1ERQA 3AZMD 4MN7A 3W4PA 1P3BB 3AV2D 3CAXA 3SOIA 3HBRA 1W1VA 5HSQA 1O07A 1YU1A 1FCOA 4K0XA 1SDNA 5CPIC 3LY3A 1S32D 3WTPE 3E4OA 1TDLA 4NE6A 2W3FA 2VA0A 2OV5A 5EM0A 3WAAC 1JWZA 1ONHA 2W8SA 3MFXA 2M7UA 3KXBB 4UA6A 1PI4A 4NETA 5CTMA 1L0FA 3G2ZA 3C2WA 3LZ1B 3RELB 1QMEA 3KSYA 1F66C 4HI4A 1K4FA 3N4IA 1MKIA 5AJGA 4GD6A 1PFLA 4Z1WA 4CJNA 3T4KA 3IF6A 4YINA 4LCMA 5FI7A 1F2KA 5F82A 2DMWA 3REKC 3L29A 1KX5A 3DTEA 3VP2A 4Z2IA 3H0RC 5AVCB 1DP8A 4XXRA 3MGSB 4HNBA 3LCEA 1DJBA 3UB7A 3S7NA 3MGQD 3UNWA 3ZG9B 4GNUA 3TU4B 3B42A 5EOOA 2ZC7A 3EQVA 1YLJA 1WWIA 4X23C 2XFTA 3RH8B 5FEGA 4H9SC 1UWNX 2WKPA 3HREA 3IBRA 1ES4A 1VETA 4Z9QA 3UDIA 3WA9A 3ZYTA 3IH8A 3WD4A 3REHB 5JA4B 4IBBA 1M19B 3GR2A 2B95A 4BENA 3AZMC 5B2IB 1NXYA 4ZJ3A 4Q8IA 2Q9NA 3A0SA 3MJQA 3AV2C 3BFCA 2ZMVA 3ZNTA 4XT2A 5A93A 5KDMB 1PZRA 5AY8B 5CPKA 1T1BA 1YMSA 5GT0D 3GDIA 3BQ8A 4HH3A 4S2IA 5AV8A 1K6SA 4MDZA 4EESA 1BUEA 1STZA 3DWZA 5BT1D 1EQZA 5F1GA 5TFQA 3G2YA 1S32C 4OPYA 4NKPA 3R45A 4CSRB 1O6IA 5HPIA 2OWHA 3R7WB 1PWDA 5LBRA 2ZQCA 4GN2A 2F2AC 1CF0A 5EV0A 2VV6A 2BLSA 2W1RA 3G32A 4Y3IA 2FJ7A 4LG2A 2W27A 5J4EA 2J9PA 4OQ0A 3V39A 4H9NB 4ZJ2A 4KUDB 4EO5C 3OPRA 3WD2A 5FQIA 3UB5P 2Y55A 3PBSA 3CZDA 4OPZA 1BLPA 4DF6A 5AVBB 4WZ5A 3EWKA 4IJGA 1KX5D 1FSWA 2FFFB 5DF8A 3AZNA 4E3IA 3IS2B 4ETXA 1OJGA 3UT9A 2PYOA 3VP3A 5B1LB 3REIB 3AZEA 3KO6A 5JRGA 1KVMA 3MGQC 2JKTM 2ZL1B 3NDGA 5HD3A 4NYYA 4LRZE 2Y2OA 2R78A 1U35A 1OTAA 1M18C 1IYQA 3WA9D 1P3LC 3KWQB 2NUTC 5DNMA 2ZOIA 4XUJD 3X1SD 4G92C 4NEED 1E6NA 3OC2A 4BQMA 3VSLA 2EX8A 4S2KA 5J8XA 5E2HA 1NYYA 4HBTA 2A24A 1GSXA 3M2KA 2EX6A 1XPBA 4PAUA 2WYXA 5BNVA 5CPKD 4KGCD 3W97A 1PWGA 4JF5A 2E8JA 5CEDA 2GZAA 3WWXA 1P3IA 5FQKA 4HY8A 3X1VD 4PM9A 2WKEA 1EQZD 3I7JA 2FZ0A 3IHAA 2P04A 4HOIA 1P3BA 5GT0C 4Y17A 1CI9A 5BT1C 1ERMA 2PBYA 4IBJA 1TS0A 4NZ4A 2HPBA 4BJPA 1BH9B 3C1CD 2KLIA 3UPNA 5E2GA 4JGOA 4HMEA 2WKHA 4NZ1A 1BSGA 4Q0HA 2ZY3A 4S2JA 3Q1FA 1TZYB 4N9LA 3WRZA 5HD5A 4ARZB 1S67L 1ESUA 1YLYA 4ZJ1A 2ZY5A 1FCMA 3KXBA 2PYRA 5IHVA 5B24B 3LZ1A 4HESA 4GHIB 4IBDA 3RELA 1G68A 1KX5C 2PYOD 3NBLA 4IUKA 3ICYA 1LL5A 4H8RA 1K57A 3G31A 4J8VD 5JRGD 3G6OA 5F99B 2HJEA 1GHIA 4XZQB 3T1QB 3AN2B 1YU0A 1MC0A 1M1AD 4DMZA 2ACGA 4R1GA 3UDXA 3IXBA 2VKSA 2OAP1 5DNMD 5AVCA 4OLDA 3EGDC 5B0YC 5EECA 4C6YA 5CGWA 3MGSA 4GHLA 1J9MA 1W63M 2ZM2A 3WA9C 1LT0A 1W8QA 4ME4A 3WD1A 4NK3A 3T4SA 3TU4A 4BWIA 4XUJC 3X1SC 2J9OA 3F6TA 4YS3B 2XA7M 1LSXA 4MBFA 3VP4A 4O0PA 5JYOA 5AV6B 5I94A 1SKFA 2J7VA 1BYWA 1XFQA 3UTBB 4KGCC 2PD8A 4OP5A 1TAFB 4EV4A 3REHA 5DF7A 1M19A 4HMCA 2P9VB 3X1VC 1KDSA 4AFIA 1OJ5A 4P6ZS 5B2IA 1EQZC 3A0VA 2ZQAA 1Z2CB 5MC7A 2WUQA 2WAEA 2Y4AA 4OQIA 5KDMA 1K55C 5AY8A 1OMEA 1KGEA 2JKFA 4LPZA 4LRXC 1H0IA 3JVVA 3OLOA 3EPJA 3VV4A 3TSGA 1PYYA 4KZ7A 2Y2KA 3FPWA 1JWVA 3X1TB 1P3GB 4MN6A 3C1CC 3GQZA 1HVBA 2WKIA 4CSRA 5CECA 4HJ3A 4O01A 3R7WA 2AROB 5DKLA 3QNCA 3CITA 2X71A 4HP9A 5EPHA 3H82B 2GDNA 3AZIB 3LZ1D 2R9XA 2G5IC 3ZGAB 3RELD 4WZ5C 4H9NA 2INWA 1N9OA 3S22A 5G4YA 2HDUA 1ZC2A 4KZ3A 3EPLA 4KUDA 1KDWA 5GLAA 3T4JA 2PYOC 2Y79A 1U60A 3DWKA 4OJOA 4Y15A 1M6KA 2ZY2A 5AVBA 1OTIA 3B6GD 4J8VC 5JRGC 4JJNB 4QLCB 4P87A 5EM1A 5AVCD 5AVEA 3DTIA 3IS2A 4R70A 4PKYA 3MGSD 1M1AC 3W2ZA 1XJ3A 4U3TA 4GZBA 1P3PB 1AOIB 3KX0X 3P09A 3RTYA 5DNMC 5B1LA 2XQZA 3REIA 3WD0A 3MGPB 2WZXA 4N1XA 2UV0E 2ZL1A 1NZOA 2IWCA 2K31A 5L10A 3FZCA 2H28A 2JBFA 3KSHA 4YNRA 3KWQA 3REHD 3NI9A 1OTDA 1M19D 3MXSA 4WNNB 1F9IA 5B32G 5E5AC 5F6AA 1LI0A 3HJKA 1UR9A 5AY8D 1UGUA 5FA7A 3KYZA 3VOZA 4Y7PA 3CG5A 5J7EA 1K38A 3L28A 2VK3A 3KSGA 4Y0TA 3WS1A 3MKEA 3FDDA 4UQIS 4KZ8A 1DRMA 3IXDA 4P0MA 2RTSA 3MZEA 4Q0IA 3WKJC 2JKTI 4HBUA 3D72A 2Y2JA 4EBNA 1P34B 4UEYA 5FI2A 3KUYB 1P3MB 4C75A 1BH9A 2ZMAA 1PW1A 4R8PB 3NIAA 3LZ1C 1ODVA 5DTTA 2W3EA 3RELC 3T50A 1KX4B 4JF6A 2GNXA 1TZYA 3FV7A 4OJ6A 4ARZA 4R6LA 1G6OA 1BZAA 4YFMA 4L9FA 4GOGA 2BYKB 1NJ4A 4KUKA 4FUWA 5B24A 4GHIA 1ZG6A 3VH6W 3UTAB 3B6GC 2M7VA 2Y2NA 2ZLYA 4BLMA 5L09A 1H0GA 5C3IB 5B1LD 5AVCC 4DDYA 4S2NA 3REID 5U47A 5HPFA 3LR5A 1E3UD 1S6RA 4HIAA 4RVAA 5F99A 2XEPA 5GHXA 4BD0A 3AFAB 2DRWA 3DAVA 1YT4A 2JHEA 4XZQA 3ITAA 3AN2A 2V5OA 3U2AA 4GDBA 2WKQA 3RXXA 2K7SA 4Z5TB 4R4RA 1MZUA 2RL3A 1AIWA 4CLCB 1YU3A 1Q2QA 3GSGA 5FQJA 1S0WA 4S2OA 5B40D 3VH5T 2MJ6A 3C4OA 1SZVA 3REHC 2WGVA 4YS3A 1M19C 1LSWA 2J3TD 3M6HA 2OLVA 4JXSA 5AV6A 4L0LA 3GVBA 4B93A 3OPHA 5CP6D 3MKFA 3GECA 5AY8C 3Q07A 3UTBA 1XA1A 1TAFA 2WZZA 2PR6A 1R4VA 2G7UA 2EXAA 2P9VA 3F1PB 3UE0A 3WTPB 5CGSA 3G4PA 2V2FF 4YWZA 3ULFA 4KQQA 3Q81A 5BPVA 3N7WA 1PZPA 2VV8A 2PDRA 3WS5A 1KU5A 2CC1A 4N9KA 4S2PA 2L4RA 3AV1B 2GJ3A 2V8CA 5AQ9A 3X1TA 1NZUA 1P3GA 4BBVA 1YLWA 5F69A 1TZYD 3OCLA 3M6BA 1PNEA 4FH2A 2AROA 1YUEA 4Z66B 4H9QB 3KYEA 3A6ND 3HJIA 1GHPA 5HL6A 4UQIM 3H82A 3AZIA 5TR7A 1LL9A 4B9OA 3K3CA 4FD8A 4WU8B 2OLUA 3LELB 5F68A 5CHLB 2KOIA 2VGLS 1PRQA 5F99D 3BWLA 3ZVTA 4R3BA 4DN0A 2QWSA 4U0XA 3REJB 4XZQD 3AN2D 3CWFA 5B1LC 3REIC 1FCNA 1TD5A 5CPJB 1EAKA 1EI5A 3KS4A 1NYMA 4JJNA 4R3AA 4DE2A 4QLCA 3BYDA 3PTEA 2A3UA 3D3OA 4RA7A 4ZAMA 1S1ZA 3HCYA 4ZUXB 1I5QA 2ZMFA 1P3PA 4DRAA 1AOIA 2JN7A 4CLCE 5E2FA 3VE4A 4OOYA 1JFIB 2VJWA 1GOIA 1NY0A 2PD7A 3MGPA 3VOYA 5L8MA 1P0ZA 2J8PA 5KZHA 3AZLB 5AV6D 4EW7A 5B40C 1IYPA 2X02A 1HQ3B 2XR0A 5TJJA 3B3XA 2J3TC 1CK7A 3VH6T 3BFEA 1YSPA 5CP6C 4WNNA 3ZG0A 4KZ4A 4DXBA 4IHQA 5AQBA 4WMCD 1P3KB 2ZQDA 5B32B 4GDNA 5D3OA 5CHJA 5HDSA 3UE1A 4E6XA 4JXWA 4G3WA 3P5JB 3E2LA 5JYPA 3X1TD 1P3GD 4ZTKA 3RXWA 4PMAA 2EFXA 4MB4A 1TDGA 3MBZA 4NYUA 2AROD 1MWSA 1OTEA 1IYSA 4UA9A 2HDQA 1KGGA 2YFWB 4LCLA 4OVDA 3AZID 1T19A 1TZYC 2Y2GA 4X1MA 4ZBEA 5KIZA 1P34A 1UWPX 2RCXA 3KUYA 3A6NC 1P3MA 5FAPA 1Z09A 4I3AA 4R8PA 1H8PA 3IF5A 4JGQA 3BY9A 3BEBA 2V9AA 1FQGA 1B6WA 5B31D 1KX4A 3MGRB 3LEQA 4OOLA 4CAYB 1YKDA 1P3OB 5F99C 1ES2A 2A49A 4JJND 3CI6A 4FCFA 4QLCD 5GT3B 4XZQC 2BYKA 1NRJA 4MMNA 3AN2C 4N1HA 4G91B 3C7UA 4GJ4A 3UTAA 1AOID 5B1MB 5FEFA 2D02A 4ZBJB 3AFAA 4WEJA 2Q9MA 2DNSA 3VP1A 1IFQA 2VGLM 4IBGA 3HSHA 5KMWA 1HTZA 4OP8A 2XF3A 3PBNA 4Z5TA 1K54C 4S2MA 5AV6C 1MWUA 4QJGA 4CLCA 4FOFA 1OT9A 2JSSA 5GSUB 1ID3B 3Q7VB 3UE3A 2JKRM 5EVIB 1JVJA 5EOEA 3E98A 2B5RA 1EW0A 2W3GA 3QNBA 4K08A 3LZ0B 2XDMA 1NLZA 1BLSA 3MVDB 1XGIA 2Y2MA 2Y2HA 3O86A 5HAPA 4OQGA 3UB6A 3F1PA 4Y13A 1YQSA 3WTPA 3X1TC 2BASA 5BNXB 1P3GC 4TX8A 1Y28A 5FQQA 1P34D 2AROC 1P3MD 2XD1A 2RIQA 2C5WB 1XGJA 5B0ZB 3AZIC 5EVLA 1K6RA 4Z2LA 2JKGA 3AV1A 4F94A 2OAQ1 2CMNA 5BS7A 4NY2A 1GXDA 4KQRA 4NFTA 4Z66A 4H9QA 4X53A 4KQOA 4DE1A 5B31C 2XA7S 3PXPA 1BTLA 4MBHA 3EQUA 3SZTA 1W1PA 4IBXA 3UTAD 4L9EA 2M1CA 3AZJB 4WU8A 4JJNC 1KX3B 4QLCC 3LELA 4HH2A 3GV9A 2VQRA 3LJAB 1K56A 4Y5FA 4MLLA 4BBTA 3REJA 1AOIC 4LV2A 3EPHA 4WLAA 3MNNB 5F5YA 2BYMB 5CPJA 2LB9A 2OOLA 4BD1A 5HW3A 1A0KA 1H8ZA 1HLUP 1SDEA 4M3KA 3B0DC 4UA7A 4Z5TD 3LI8A 4NXEA 1ED7A 4CLCD 5CRFA 2IO5B 4J8XB 4ZUXA 3MR0A 4MEZA 1I2WA 3CUEA 4IJEA 1JFIA 4WV4B 4KG5A 5AV8D 3V3SA 3AZLA 4DRBA 1T1CA 3TG9A 1KE4A 3G34A 1HQ3A 2B18A 3PAGA 1G5UA 2YKFA 3K3DA 3MSHA 4OJLA 1T18A 5B33B 5HAIA 4Z2GA 3FKEA 3HL9A 4MNRA 4P85A 1MBLA 5FAQA 2FJ7D 3WTPD 4IVKA 3NHQA 1K4EA 1P3KA 1CI8A 4IBRA 3NOUC 1S66L 5B32A 1YSQA 2QPNA 5KSCA 4R23A 5CPIB 5HAQA 3AV1D 1P34C 2PHYA 2KDKA 3T1XA 1P3MC 1GSVA 3UMEA 4Y0UA 1H3QA 3ISGA 3IF6C 4UUZB 3AZND 3C7VA 3WAAB 3VSKA 4IBFA 3B0CW 3MF0A 3BECA 3E4QA 2YFWA 1XP4A 4OONA 3UT9D 1YAXA 2PT7A 2W1TB 1H8MA 2EA9A 3BFDA 3AZED 2O9CA 4HJ6A 1K56D 1FSYA 3UTAC 1U35D 4C3QA 3MGRA 5C3IC 3X1UB 3REJD 1TS7A 4CAYA 3FG8A 1P9RA 1P3OA 3L2AA 2PYPA 3QP5A 5GT3A 3A3DA 3T12B 3REKB 5CEBA 4E04A 4WN5A 3SS4A 4A5RA 2OWJA 1PIOA 4ZUXD 3C5AA 4UAAA 4Z5TC 1E25A 3JYIA 3SH8A 2W0NA 3W97D 2L0WA 3U4LP 5B1MA 4AWLB 3LR0A 3B33A 1RCJA 5DTKA 5G18A 1P3ID 4OLGA 3N3FA 1HQ3D 5CPKC 5EUAA 3P7NA 1P3BD 3ZG5A 5AV8C 3H7WB 2CV5B 3DTMA 3IH9A 4GHAA 3ZVWA 5GSUA 1ID3A 3Q7VA 4B4XA 3NJAA 4HGAB 4JGRA 4WEKA 4E3JA 5EVIA 2ZJ9A 5B32D 3NDEA 3PBOA 2EXBA 3AV2B 2FJ7C 2J3WA 3WTPC 3T4LA 3LZ0A 5HWTA 3MVDA 3OPPA 3SH9A 3KXBD 4KHAB 3MZFA 1CXWA 1G6AA 3AV1C 3IWQA 5M1AA 5BNXA 2XSSA 3AGEA 1G28A 2QHKA 4U0TA 3AZNC 1L6JA 2G2WA 4BBUA 2ZC3B 4EQIA 3T4TA 4UHUA 1VB6A 2WGWB 3VH5W 3W99B 1ULYA 5B0ZA 3UT9C 1YU2A 4H6JB 2F8NK 4EO5B 3AZEC 2HJ9C 1MY8A 5CERA 2JKRI 3OOVA 1SCWA 3G35A 4GD8A 2V1AA 2Z6CA 1U35C 4KZ5A 1IYOA 3ZCZA 4DJ2A 2VEAA 4CPKA 3TU4D 3AZJA 1KX3A 1D06A 2QJ5A 1KVLA 5B1MD 3LJAA 3UMDA 3LR3A 4ZUXC 5G49B 3CUEC 3B0CT 4JKTA 1FILA 3W97C 3MNNA 4X56A 3MGQB 1VM1A 2BYMA 4Z2KA 2Y59A 3IX3A 4YM6B 1CEFA 1P3IC 1M18B 5B2ID 1P3LB 1N1JB 4CQHA 2NZDB 5GSUD 1ID3D 1P3BC 2Y2LA 4J8XA 5GLDA 1SKOB 4X25A 3N8LA 5EVID 5IT5A 3HUNA 5M19A 5E2EA 3R4KA 1W5DA 3ITBA 2QJ7A 4EXOA 5HX9A 1KS0A 1PZOA 3BY8A 2V1ZA 3O88A 3T1SA 3AZGB 4HHDA 4H9OB 5B32C 3LZ0D 3H0MC 1W2EA 3NULA 2XH9A 3MVDD 2VZWA 3ZQ5A 3ZHHA 5B33A 2ZQ8A 5GT0B 3E4PA 3NCKA 3O87A 3A1KA 1XJ4A 4QNLA 3KXBC 2LB5A 3PYPA 3B6FB 4KUDD 1W7FA 2WADA 1H8YA 5B0ZD 3IX4A 3K2NA 5CPIA 4LD9B 1FIKA 1ZHHB 3BLMA 1K57C 1VQQA 5AVBD 1MXOA 2YFVB 4MCWA 1YPRA 1L0DA 4UUZA 4R0QA 3WAAA 3LUQA 1F98A 4Y0OA 3WRTA 1WE4A 2X01A 3G30A 2HDRA 2NQBB 3TRCA 2W1TA 3LIDA 4EBLA 3AZJD 1VEUB 3BM6A 3GMWA 1KX3D 3MGSC 4ESPA 3LFVA 4HEFA 3LJAD 4G3VA 3MQ0A 3TW8A 2UWXA 4JLFA 3ZDJA 3TU4C 3PR6A 4P6BA 3X1UA 1XJ2A 4JPMA 1PW8A 5HARA 3KWQD 4KZ6A 4KENB 4M6BA 4ZBJC 2BG1A 4KG2A 1DP9A 3REKA 3MZDA 1GHMA 3KYQA 4NXGA 1K0KA 4X68A 5B0YB 3EEAA 3UE6A 5AVFA 4LLOB 5B2IC 4OJ5A 1N4OA 3L9KA 3S1YA 5GSUC 1ID3C
chains in the Genus database with same CATH topology
1A7WA 3X1SB 2F8NG 1P3FB 2J8YA 5EVIC 3S4XA 1YU4A 4IJFA 1RGYA 5HL1A 2CV5A 4WU9B 5B33D 4KGCB 3LZ0C 1H3OB 3MVDC 3X1VB 4S2LA 3AZMA 5GHZA 3AV2A 3C1BB 3VMAA 5AV5B 5E43A 4KUDC 1IELA 5B0ZC 2FFYA 3WAAD 4KHAA 3W98B 3C1CB 5B24D 1O7EA 5F1FA 5DTSA 5AVBC 2WGWA 2OSUA 1F1EA 3W99A 4RX2A 2Y2IA 3ZG7B 1P3AB 4WBGA 1NRFA 4WYYA 3AZJC 3X1UD 1L2SA 1KX3C 1BH8B 3LJAC 5DF9A 4J8VB 3A1IA 3KWQC 1Y54A 4YS3D 1M1AB 2HP6A 2IO5C 3Q82A 5G49A 5DNNB 3UTBD 2H5SA 3MGQA 1BULA 4YM6A 1IKIA 4E3OA 2CV5D 3OPLA 1M18A 3AZKB 1W79A 1P3LA 1N1JA 2NZDA 5FDHA 2Z2LB 2DCFA 4XUZA 4RYEA 3HLFA 4GKUA 5BO0B 4J8UB 3SS3A 4PM8A 5E5AB 5B33C 3L25A 4MBKA 3P98A 1YLZA 1WWSA 2LY8A 1ZKJA 3AZGA 4JXVA 1L0GA 4H9OA 1KGFA 5GXQB 4R3JA 1MPLA 4E44A 3UPOA 4QY6A 1HZOA 4H9PB 5GT0A 1Q9CA 1IEMA 3WKJB 3NQJB 1H5XA 5FQMA 3MFDA 3B6FA 5B24C 1PWCA 3W99D 1IKGA 4LD9A 4S2NC 2YFVA 4LV1A 3OCNA 3N8SA 1PI5A 3EPKA 3V50A 2HIOB 3AGFA 3D4FA 1JWPA 3ZNYA 3X1UC 3O62B 2NQBA 1P3PD 2WAFA 4OKPA 1ONGA 1RGZA 3MGPD 3B6GB 3C4PA 4Z2MG 4OQHA 4YS3C 2JCHA 4AWLC 4YM6D 3HLWA 1M18D 1P3LD 2NZDD 3UTBC 4LENA 4J8WB 5B0YA 5B2JB 2CV5C 2QMIA 5FUGB 3WS2A 4XUJA 3X1SA 1P3FA 4HGAC 3HVFA 2HP9A 3AZGD 3AZHB 2F8NB 4KZ9A 1RP5A 3HLCA 2XK1A 3RJUA 3MXRA 5FQ9A 4WU9A 4E3NA 4KGCA 1WYBA 2JC7A 2Y2PA 1H3OA 3KUYD 3X1VA 3AZFB 4R8PD 3B6FD 3W96B 3C1BA 2ZM0A 3AYWB 1K55A 1KX4D 4IEDA 5AV5A 2F8NH 1ZLAB 4LD9D 1I2SA 2PU2A 4JF4A 4LV3A 2XD5A 3IHBA 3W99C 3NQUB 3W98A 3C1CA 1TVFA 3O3VA 4X55A 5B31G 4K0WA 2NQBD 2VGKA 5AV9B 3VFHA 4N92A 3AFAD 3SS5A 1TEMA 1P3PC 2E8IA 2ZC4B 1P3AA 3MGPC 2PU4A 1BH8A 3E2KA 2HUEB 1EWZA 2C6WB 1LHYA 1WYCA 4IVIA 4J8VA 4B88A 5GLCA 4WJ3C 1W8YA 5B0YD 4YM6C 3UDFA 4QHCA 1M1AA 4IBIA 2EX9A 2NZDC 3CJMA 1P3FD 5DNNA 3WX7A 3IXHA 3N8RA 2DQNC 4PM6A 5B40B 4OUIA 3AZKA 4X6TA 4WU9D 3AZGC 4R4SA 3GRJA 3M2JA 1YMXA 3AL0C 5CP6B 5BO0A 1JTGA 4J8UA 2Y91A 3A3FA 5E5AA 5L2FA 3C1BD 2XLNA 1C3BA 1BLCA 3FKWA 3KUYC 2R9WA 4E3KA 5AV5D 3LO7A 5GXQA 1ES3A 3V5MA 4R8PC 3B6FC 4Z66D 1FR1A 5FAOA 5F83A 4FSFA 1KX4C 3W98D 3Q7ZA 4H9PA 4LD9C 4X69A 3WKJA 1GCEA 3NQJA 4WZSB 5AQAA 4WU8D 3A3IA 3LELD 4BL3A 1F66B 4ZDXA 3A6NB 2NQBC 4NE3A 2WK0A 4E6WA 1P3AD 5CPJD 4OOMA 3KS8A 3N6IA 1LI9A 3AFAC 1FOFA 1QMFA 2HIOA 3BFFA 4DE3A 5A92A 3O62A 4DRTA 1MWTA 1CEGA 3B6GA 3AZLD 1GA9A 4X23B 5KSHA 5DNND 1E4DA 4IBEA 4UPKA 3GTCA 4OH0A 1YLPA 4DQYB 4D2OA 4OJPA 1P3FC 3AZKD 1Q2PA 5A90A 3HLGA 1P3KD 4J8WA 3AZMB 3IT9A 1ZG4A 5B2JA 1ALQA 4IBKA 3A3JA 4H9RB 4J8UD 2IOUA 4RX3A 3L26A 4WU9C 5E5AD 5FUGA 3IQAA 4Z2MH 5JA4A 4GB7A 4WELA 5AQ7A 3AZHA 5GLBA 5GXQD 2F8NA 1XA7A 3C1BC 3BFGA 3W8KA 3HLBA 1S32B 5CTNA 5CXWA 5BS7C 1DY6A 5AV5C 3NC8A 3WKJD 4Z66C 3AZFA 1XKZA 3WS4A 3DW0A 3W98C 3W96A 5CHUA 3FYZA 3AYWA 4PM5A 4WU8C 3MGRD 1ZLAA 3LELC 5TGFA 4GH9A 1P3OD 2H10A 3NQUA 3ZFZA 5GT3D 3REJC 3IWOA 2HIOD 1CK3A 4E3MA 1P3AC 5CPJC 3O62D 1KE0A 2HP5A 5AV9A 3PBRA 3IP4C 5B31B 4QD4A 3FWLA 3UN7A 5CGXA 3HLDA 2QZ6A 4E45A 3V3RA 1ES5A 5BOHA 4EUZA 3V9RB 3HONA 2G2UA 3FKVA 1XX2A 3AZLC 1HQ3C 1E3UA 5DNNC 4JXGA 4G92B 3B0DB 3WS0A 1AXBA 3VH5A 4J8WD 1MWRA 5B2JD 2XFSA 3AZKC 3VFFA 1P3KC 1T3UA 1K25A 2H0YA 1JTDA 3PBTA 4J8UC 2VGJA 3AZHD 2F8ND 2V20A 5B40A 3LEZA 2CWEA 1N9BA 1GA0A 2ZM8A 2XGNA 5FSRA 2RVQD 5GXQC 1DJCA 1Z6FA 5CP6A 3HUMA 4DE0A 5FI6A 3AZFD 2EX2A 1KE3A 3W96D 1EROA 3AYWD 3CMZA 2Z2MB 3AGDA 1ZLAD 4LV0A 3L27A 4QY5A 3MGRC 5DVAA 3SH7A 2JE5A 3IF6B 2G5HC 1P3OC 5AV9D 5GT3C 3W4OA 4DKIA 2ZC6B 2HIOC 1F66A 1YLTA 3UO9A 1KX5B 2Y2QA 4G91C 2ZC5B 3A6NA 3O62C 3A3EA 5GHYA 4EWFA 3MNND 5B1MC 3W4QA 1B67A 1BT5A 3EG5B 4QB8A 3BRMA 4NE5A 4FH4A 4XUXA 3VP0A 4J8XD 4ID4A 2ZD8A 4K91A 3TOIA 3WA9B 4XUJB 3UPPA 4J8WC 4DDSA 1ESIA 4BL2A 4X23A 4H9SA 5B2JC 1M40A 5CHMA 1HTAA 3QHYA 3ZG8B 4WZ4A 3VH6A 5EE8A 5CPKB 3LY4A 5AV8B 3AZHC 4OPQA 1K54A 4NZ5A 1EQZB 2ZQ9A 1XXMA 2ZY4A 4H9RA 3R45B 4JBFA 2P74A 3PBQA 4OPRA 1FR6A 2IWBA 2RVQC 5CPID 3UY6A 2EFUA 5FATA 3AZFC 2FJ7B 2WGIA 3IWIA 4WMCA 3IXGA 4KG6A 5GL9A 3W96C 2ZM5A 1YM1A 3AYWC 1S32A 4B4ZA 3B0BA 1ZLAC 4PPRA 4DXCA 2H0TA 3H0LC 3PAEA 1LLBA 3HUOA 2DF4C 1F66D 3NY4A 3AZNB 3BLSA 4O7DA 1BFMA 5AV9C 2HDSA 3OZHA 4NZ3A 3UT9B 3HLEA 2PYOB 4PM7A 3AZEB 2IWDA 4IBCA 5M18A 5A91A 5JRGB 3REKD 4KZAA 3MNNC 5FASA 2L5AA 1U35B 5B31A 2HUEC 1SHVA 2I72A 4E3LA 5DNMB 4J8XC 2ZQ7A 1HD8A 3V9RA 4X23D 5HFOA 5BNVB 3W97B 4QU3A 4WM9A 4KZBA 1DJAA 4EBPA 1L0EA 1BLHA 1P3IB 3KFUG 1ERQA 3AZMD 3W4PA 1P3BB 3AV2D 3SOIA 3HBRA 1O07A 1YU1A 1FCOA 4K0XA 1SDNA 5CPIC 3LY3A 1S32D 3WTPE 1TDLA 4NE6A 2OV5A 3WAAC 1JWZA 1ONHA 2W8SA 3KXBB 4UA6A 1PI4A 4NETA 5CTMA 1L0FA 3G2ZA 3LZ1B 3RELB 3KSYA 1F66C 1QMEA 1K4FA 3N4IA 1MKIA 4GD6A 4CJNA 3IF6A 4YINA 4LCMA 5FI7A 5F82A 3REKC 3L29A 1KX5A 3VP2A 3H0RC 5AVCB 4XXRA 3MGSB 3LCEA 1DJBA 3MGQD 3UNWA 3ZG9B 4GNUA 3TU4B 5EOOA 2ZC7A 3EQVA 1YLJA 2XFTA 1WWIA 4X23C 4H9SC 3HREA 1ES4A 4Z9QA 3UDIA 3WA9A 3IH8A 3REHB 5JA4B 4IBBA 1M19B 3GR2A 4BENA 3AZMC 5B2IB 1NXYA 4ZJ3A 4Q8IA 2Q9NA 3AV2C 3BFCA 3ZNTA 5A93A 5KDMB 1PZRA 5AY8B 5CPKA 1YMSA 5GT0D 4S2IA 5AV8A 1K6SA 1BUEA 3DWZA 5BT1D 1EQZA 5F1GA 5TFQA 3G2YA 1S32C 4OPYA 3R45A 4CSRB 1PWDA 2ZQCA 4GN2A 2F2AC 2BLSA 3G32A 2FJ7A 4LG2A 2J9PA 4OQ0A 3V39A 4H9NB 4ZJ2A 4KUDB 4EO5C 3OPRA 5FQIA 2Y55A 3PBSA 3CZDA 4OPZA 1BLPA 4DF6A 5AVBB 4WZ5A 1KX5D 1FSWA 2FFFB 5DF8A 3AZNA 4E3IA 3UT9A 2PYOA 3VP3A 5B1LB 3REIB 3AZEA 5JRGA 1KVMA 3MGQC 3NDGA 4NYYA 2Y2OA 1U35A 1M18C 1IYQA 3WA9D 1P3LC 3KWQB 5DNMA 4XUJD 3X1SD 4G92C 3OC2A 4BQMA 3VSLA 2EX8A 4S2KA 5J8XA 5E2HA 1NYYA 4HBTA 3M2KA 2EX6A 1XPBA 2WYXA 5BNVA 5CPKD 4KGCD 3W97A 1PWGA 4JF5A 5CEDA 3WWXA 1P3IA 5FQKA 3X1VD 4PM9A 2WKEA 1EQZD 3I7JA 3IHAA 1P3BA 5GT0C 1CI9A 5BT1C 1ERMA 2PBYA 4IBJA 4NZ4A 2HPBA 4BJPA 1BH9B 3C1CD 3UPNA 5E2GA 2WKHA 4NZ1A 1BSGA 2ZY3A 4S2JA 3Q1FA 1TZYB 4N9LA 3WRZA 1YLYA 1ESUA 4ZJ1A 2ZY5A 1FCMA 3KXBA 5IHVA 5B24B 3LZ1A 4HESA 4IBDA 3RELA 1G68A 1KX5C 2PYOD 3NBLA 1LL5A 4H8RA 1K57A 3G31A 4J8VD 5JRGD 5F99B 1GHIA 4XZQB 3AN2B 1YU0A 1M1AD 4R1GA 3UDXA 3IXBA 5DNMD 5AVCA 4OLDA 4C6YA 5B0YC 5EECA 5CGWA 3MGSA 4GHLA 1J9MA 2ZM2A 3WA9C 1W8QA 4NK3A 3TU4A 4XUJC 3X1SC 2J9OA 3F6TA 4YS3B 4MBFA 3VP4A 5JYOA 5AV6B 5I94A 1SKFA 2J7VA 3UTBB 4KGCC 4OP5A 1TAFB 4EV4A 3REHA 5DF7A 1M19A 2P9VB 3X1VC 1KDSA 5B2IA 1EQZC 2ZQAA 1Z2CB 2WUQA 2WAEA 2Y4AA 4OQIA 5KDMA 1K55C 5AY8A 1OMEA 1KGEA 3EPJA 3TSGA 1PYYA 4KZ7A 2Y2KA 1JWVA 3X1TB 1P3GB 3C1CC 3GQZA 1HVBA 2WKIA 4CSRA 5CECA 2AROB 3QNCA 2X71A 5EPHA 2GDNA 3AZIB 3LZ1D 2R9XA 2G5IC 3ZGAB 3RELD 4WZ5C 4H9NA 3S22A 2HDUA 1ZC2A 4KZ3A 3EPLA 4KUDA 1KDWA 5GLAA 2PYOC 1U60A 3DWKA 4OJOA 1M6KA 2ZY2A 5AVBA 3B6GD 4J8VC 5JRGC 4JJNB 4QLCB 4P87A 5AVCD 3MGSD 1M1AC 4U3TA 4GZBA 1P3PB 1AOIB 3P09A 5DNMC 5B1LA 2XQZA 3REIA 3MGPB 2WZXA 4N1XA 1NZOA 2IWCA 3FZCA 2JBFA 3KWQA 3REHD 3NI9A 1M19D 3MXSA 4WNNB 5B32G 5E5AC 1LI0A 5AY8D 5FA7A 3VOZA 4Y7PA 3CG5A 1K38A 3L28A 4Y0TA 3WS1A 3MKEA 3FDDA 4KZ8A 3IXDA 4P0MA 3MZEA 3WKJC 4HBUA 2Y2JA 4EBNA 1P34B 5FI2A 3KUYB 1P3MB 4C75A 1BH9A 2ZMAA 1PW1A 4R8PB 3NIAA 3LZ1C 5DTTA 3RELC 1KX4B 4JF6A 1TZYA 3FV7A 4OJ6A 1BZAA 4YFMA 4GOGA 2BYKB 1NJ4A 5B24A 1ZG6A 3VH6W 3UTAB 3B6GC 2Y2NA 2ZLYA 4BLMA 5C3IB 5B1LD 5AVCC 4DDYA 4S2NA 3REID 5U47A 1E3UD 1S6RA 5GHXA 4RVAA 5F99A 2XEPA 4BD0A 3AFAB 2DRWA 1YT4A 4XZQA 3ITAA 3AN2A 4GDBA 3RXXA 4Z5TB 4R4RA 2RL3A 1YU3A 1Q2QA 3GSGA 5FQJA 1S0WA 4S2OA 5B40D 3VH5T 3C4OA 3REHC 2WGVA 4YS3A 1M19C 3M6HA 2OLVA 4JXSA 5AV6A 4L0LA 3GVBA 3OPHA 5CP6D 3MKFA 5AY8C 3Q07A 3UTBA 1XA1A 1TAFA 2WZZA 1R4VA 2EXAA 2P9VA 3UE0A 3WTPB 5CGSA 3G4PA 2V2FF 4KQQA 3Q81A 5BPVA 3N7WA 1PZPA 3WS5A 1KU5A 2CC1A 4N9KA 4S2PA 3AV1B 5AQ9A 3X1TA 1NZUA 1P3GA 1YLWA 1TZYD 3OCLA 3M6BA 4FH2A 2AROA 1YUEA 4Z66B 4H9QB 3A6ND 1GHPA 3AZIA 5TR7A 1LL9A 4FD8A 4WU8B 2OLUA 3LELB 5CHLB 5F99D 3ZVTA 4R3BA 4U0XA 3REJB 4XZQD 3AN2D 5B1LC 3REIC 1FCNA 5CPJB 1EI5A 3KS4A 1NYMA 4JJNA 4DE2A 4QLCA 3BYDA 3PTEA 2A3UA 4RA7A 4ZAMA 4ZUXB 1I5QA 1P3PA 4DRAA 1AOIA 5E2FA 4OOYA 1JFIB 1NY0A 3MGPA 3VOYA 2J8PA 5KZHA 3AZLB 5AV6D 5B40C 1IYPA 2X02A 1HQ3B 2XR0A 3B3XA 3VH6T 3BFEA 5CP6C 4WNNA 3ZG0A 4KZ4A 4DXBA 5AQBA 4WMCD 1P3KB 2ZQDA 5B32B 4GDNA 5D3OA 5CHJA 3UE1A 4E6XA 4JXWA 3P5JB 3E2LA 5JYPA 3X1TD 1P3GD 4ZTKA 3RXWA 4PMAA 2EFXA 1TDGA 3MBZA 4NYUA 2AROD 1MWSA 1IYSA 4UA9A 2HDQA 1KGGA 2YFWB 4LCLA 4OVDA 3AZID 1TZYC 2Y2GA 4ZBEA 1P34A 2RCXA 3KUYA 3A6NC 1P3MA 5FAPA 4R8PA 3IF5A 3BEBA 1FQGA 1B6WA 5B31D 1KX4A 3MGRB 4OOLA 4CAYB 1P3OB 5F99C 1ES2A 2A49A 4JJND 4FCFA 4QLCD 5GT3B 4XZQC 2BYKA 4N1HA 3AN2C 4G91B 3C7UA 3UTAA 1AOID 5B1MB 4ZBJB 3AFAA 4WEJA 2Q9MA 2DNSA 3VP1A 4IBGA 3HSHA 5KMWA 1HTZA 4OP8A 2XF3A 3PBNA 4Z5TA 1K54C 4S2MA 5AV6C 1MWUA 4QJGA 2JSSA 5GSUB 1ID3B 3Q7VB 3UE3A 5EVIB 1JVJA 5EOEA 2B5RA 3QNBA 3LZ0B 2XDMA 1BLSA 3MVDB 1XGIA 2Y2MA 2Y2HA 3O86A 5HAPA 4OQGA 1YQSA 3WTPA 3X1TC 5BNXB 1P3GC 5FQQA 1P34D 2AROC 1P3MD 2XD1A 2RIQA 2C5WB 1XGJA 5B0ZB 3AZIC 5EVLA 1K6RA 3AV1A 4F94A 5BS7A 4NY2A 4KQRA 4NFTA 4Z66A 4H9QA 4X53A 4KQOA 4DE1A 5B31C 1BTLA 4MBHA 3EQUA 4IBXA 3UTAD 3AZJB 4WU8A 4JJNC 1KX3B 4QLCC 3LELA 3GV9A 2VQRA 3LJAB 1K56A 4MLLA 3REJA 1AOIC 4LV2A 3EPHA 3MNNB 5HW3A 2BYMB 5CPJA 4BD1A 1H8ZA 1SDEA 4M3KA 3B0DC 4UA7A 4Z5TD 5CRFA 2IO5B 4J8XB 4ZUXA 4MEZA 1I2WA 4IJEA 1JFIA 4WV4B 4KG5A 5AV8D 3V3SA 3AZLA 4DRBA 3TG9A 1KE4A 3G34A 1HQ3A 3PAGA 4OJLA 5B33B 5HAIA 5FAQA 3FKEA 3HL9A 4MNRA 4P85A 1MBLA 2FJ7D 3WTPD 4IVKA 1K4EA 1P3KA 1CI8A 4IBRA 5B32A 2QPNA 5KSCA 4R23A 5CPIB 5HAQA 3AV1D 1P34C 1P3MC 4Y0UA 3ISGA 3IF6C 4UUZB 3AZND 3C7VA 3WAAB 3VSKA 4IBFA 3B0CW 3BECA 2YFWA 1XP4A 4OONA 3UT9D 3BFDA 3AZED 1K56D 1FSYA 3UTAC 1U35D 4C3QA 3MGRA 5C3IC 3X1UB 3REJD 4CAYA 1P3OA 3L2AA 5GT3A 3A3DA 3REKB 5CEBA 3SS4A 4A5RA 1PIOA 4ZUXD 3C5AA 4UAAA 4Z5TC 1E25A 3JYIA 3SH8A 3W97D 5B1MA 4AWLB 5DTKA 1RCJA 5G18A 1P3ID 4OLGA 3N3FA 1HQ3D 5CPKC 5EUAA 1P3BD 3ZG5A 5AV8C 2CV5B 3DTMA 3IH9A 4GHAA 3ZVWA 5GSUA 1ID3A 3Q7VA 4B4XA 4HGAB 4WEKA 4E3JA 5EVIA 2ZJ9A 5B32D 3NDEA 3PBOA 2EXBA 3AV2B 2FJ7C 3WTPC 3LZ0A 3MVDA 3OPPA 3SH9A 3KXBD 4KHAB 3MZFA 1G6AA 3AV1C 3IWQA 5M1AA 5BNXA 3AGEA 4U0TA 3AZNC 2G2WA 2ZC3B 4EQIA 4UHUA 2WGWB 3VH5W 3W99B 1ULYA 5B0ZA 3UT9C 1YU2A 2F8NK 4EO5B 3AZEC 1MY8A 5CERA 1SCWA 3G35A 4GD8A 1U35C 4KZ5A 1IYOA 3ZCZA 4CPKA 3TU4D 3AZJA 1KX3A 1KVLA 5B1MD 3LJAA 4ZUXC 5G49B 3B0CT 4JKTA 3W97C 3MNNA 4X56A 3MGQB 2BYMA 1VM1A 2Y59A 4YM6B 1CEFA 1P3IC 1M18B 5B2ID 1P3LB 1N1JB 2NZDB 5GSUD 1ID3D 1P3BC 2Y2LA 4J8XA 5GLDA 3N8LA 5EVID 3HUNA 5M19A 5E2EA 1W5DA 3ITBA 5HX9A 1PZOA 2V1ZA 3O88A 3AZGB 4H9OB 5B32C 3LZ0D 3H0MC 1W2EA 2XH9A 3MVDD 3ZHHA 5B33A 2ZQ8A 5GT0B 3NCKA 3O87A 3A1KA 4QNLA 3KXBC 3B6FB 4KUDD 1W7FA 2WADA 1H8YA 5B0ZD 5CPIA 4LD9B 3BLMA 1K57C 1VQQA 5AVBD 1MXOA 2YFVB 1L0DA 4UUZA 4R0QA 3WAAA 4Y0OA 3WRTA 1WE4A 2X01A 3G30A 2HDRA 2NQBB 4EBLA 3AZJD 3BM6A 3GMWA 1KX3D 3MGSC 4HEFA 3LJAD 2UWXA 4JLFA 3ZDJA 3TU4C 4P6BA 3X1UA 4JPMA 1PW8A 5HARA 3KWQD 4KZ6A 4KENB 4M6BA 4ZBJC 2BG1A 4KG2A 3REKA 3MZDA 1GHMA 4X68A 5B0YB 5B2IC 4OJ5A 1N4OA 3S1YA 5GSUC 1ID3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX6 A;  5TGF A;  1XPB A;  3IF5 A;  2WYX A;  2J8Y A;  5EVI C;  2H10 A;  1PWG A;  3BEB A;  3S4X A;  3ZFZ A;  4JF5 A;  1FQG A;  5CED A;  1RGY A;  3IWO A;  4OOL A;  5HL1 A;  3WWX A;  1CK3 A;  5FQK A;  4E3M A;  4PM9 A;  2WKE A;  3I7J A;  1ES2 A;  1KE0 A;  2HP5 A;  3IHA A;  2A49 A;  3PBR A;  4FCF A;  4QD4 A;  3FWL A;  3UN7 A;  4N1H A;  1CI9 A;  5CGX A;  3HLD A;  2QZ6 A;  4S2L A;  3C7U A;  1ERM A;  3V3R A;  1ES5 A;  2PBY A;  5GHZ A;  5BOH A;  2HPB A;  4BJP A;  4EUZ A;  2G2U A;  3FKV A;  3VMA A;  1XX2 A;  3UPN A;  4WEJ A;  5E43 A;  2Q9M A;  2DNS A;  5E2G A;  3VP1 A;  1IEL A;  2WKH A;  2FFY A;  1E3U A;  1BSG A;  5KMW A;  4JXG A;  1HTZ A;  4S2J A;  4OP8 A;  3WS0 A;  3Q1F A;  2XF3 A;  4N9L A;  1AXB A;  1O7E A;  1K54 C;  3PBN A;  4S2M A;  3WRZ A;  5F1F A;  5DTS A;  1MWU A;  1ESU A;  1YLY A;  4ZJ1 A;  1MWR A;  4QJG A;  2XFS A;  1FCM A;  3Q7V B;  3UE3 A;  5IHV A;  3VFF A;  4HES A;  5EVI B;  2WGW A;  1JVJ A;  1K25 A;  5EOE A;  2OSU A;  4RX2 A;  2H0Y A;  1G68 A;  1JTD A;  3PBT A;  2Y2I A;  3ZG7 B;  3NBL A;  2VGJ A;  2B5R A;  1LL5 A;  4H8R A;  4WBG A;  1NRF A;  4WYY A;  1K57 A;  2V20 A;  3G31 A;  3QNB A;  1L2S A;  3LEZ A;  1N9B A;  2XDM A;  1BLS A;  1GA0 A;  1GHI A;  2XGN A;  2ZM8 A;  5DF9 A;  5FSR A;  1XGI A;  2Y2M A;  2Y2H A;  3O86 A;  5HAP A;  1DJC A;  1Z6F A;  4R1G A;  3HUM A;  4OQG A;  3IXB A;  3UDX A;  5FI6 A;  4DE0 A;  1Y54 A;  1YQS A;  4OLD A;  2EX2 A;  4C6Y A;  5EEC A;  5FQQ A;  1KE3 A;  5CGW A;  1J9M A;  2ZM2 A;  1ERO A;  2HP6 A;  1W8Q A;  3CMZ A;  2XD1 A;  2Z2M B;  2C5W B;  3AGD A;  4NK3 A;  1XGJ A;  3Q82 A;  4LV0 A;  2J9O A;  4MBF A;  5EVL A;  1K6R A;  3VP4 A;  5JYO A;  4QY5 A;  4F94 A;  2H5S A;  1BUL A;  5DVA A;  1IKI A;  3SH7 A;  4E3O A;  5I94 A;  2JE5 A;  1SKF A;  2J7V A;  3OPL A;  3IF6 B;  4KQR A;  1W79 A;  4X53 A;  4KQO A;  4DE1 A;  4OP5 A;  5FDH A;  2Z2L B;  2DCF A;  3W4O A;  4DKI A;  4XUZ A;  5DF7 A;  4EV4 A;  1BTL A;  2ZC6 B;  4MBH A;  3HLF A;  4GKU A;  1YLT A;  3EQU A;  4RYE A;  2P9V B;  3UO9 A;  3SS3 A;  2Y2Q A;  1KDS A;  2ZC5 B;  4IBX A;  4PM8 A;  2ZQA A;  3A3E A;  5GHY A;  4MBK A;  3P98 A;  1YLZ A;  3GV9 A;  2WUQ A;  2WAE A;  4EWF A;  1K56 A;  1ZKJ A;  2Y4A A;  4OQI A;  1K55 C;  4JXV A;  3W4Q A;  1OME A;  1KGE A;  1BT5 A;  1L0G A;  1KGF A;  4MLL A;  4R3J A;  1MPL A;  4QB8 A;  4LV2 A;  3TSG A;  1PYY A;  3UPO A;  3BRM A;  4KZ7 A;  2Y2K A;  4BD1 A;  5HW3 A;  4FH4 A;  4QY6 A;  4XUX A;  1JWV A;  4ID4 A;  1H8Z A;  3VP0 A;  1HZO A;  1SDE A;  4M3K A;  3GQZ A;  4UA7 A;  1HVB A;  2ZD8 A;  2WKI A;  5CEC A;  4K91 A;  3TOI A;  1IEM A;  5CRF A;  1H5X A;  3QNC A;  5FQM A;  2X71 A;  5EPH A;  3MFD A;  2GDN A;  4MEZ A;  1I2W A;  2R9X A;  1PWC A;  3UPP A;  4WZ5 C;  3ZGA B;  1ESI A;  4BL2 A;  4DDS A;  4KG5 A;  1M40 A;  3S22 A;  2HDU A;  1ZC2 A;  4KZ3 A;  5CHM A;  1IKG A;  3V3S A;  3QHY A;  4S2N C;  3ZG8 B;  4WZ4 A;  5EE8 A;  3TG9 A;  1KE4 A;  3G34 A;  4LV1 A;  1KDW A;  5GLA A;  3OCN A;  3LY4 A;  3N8S A;  1PI5 A;  3PAG A;  3V50 A;  1U60 A;  3AGF A;  3DWK A;  3D4F A;  1JWP A;  1K54 A;  4OPQ A;  1M6K A;  3ZNY A;  2ZQ9 A;  1XXM A;  5HAI A;  5FAQ A;  3HL9 A;  4P85 A;  4MNR A;  1MBL A;  2WAF A;  4JBF A;  4P87 A;  4IVK A;  2P74 A;  3PBQ A;  4OKP A;  1K4E A;  1ONG A;  1RGZ A;  1CI8 A;  1FR6 A;  4IBR A;  4OPR A;  2IWB A;  3UY6 A;  3C4P A;  4U3T A;  2EFU A;  4GZB A;  5FAT A;  2QPN A;  4OQH A;  2WGI A;  3P09 A;  3IWI A;  5KSC A;  4WMC A;  3IXG A;  2XQZ A;  4KG6 A;  4R23 A;  5GL9 A;  2WZX A;  5HAQ A;  2JCH A;  1YM1 A;  4N1X A;  1NZO A;  4B4Z A;  4Y0U A;  4PPR A;  3ISG A;  4DXC A;  2H0T A;  2IWC A;  3HLW A;  3FZC A;  3IF6 C;  3VSK A;  3C7V A;  2JBF A;  3PAE A;  1LLB A;  3HUO A;  3BEC A;  4LEN A;  1XP4 A;  4OON A;  3NI9 A;  3MXS A;  3NY4 A;  3BLS A;  4O7D A;  2QMI A;  3BFD A;  3WS2 A;  2HDS A;  3OZH A;  1K56 D;  1LI0 A;  3HVF A;  2HP9 A;  3HLE A;  4PM7 A;  1FSY A;  5FA7 A;  3VOZ A;  4Y7P A;  2IWD A;  3CG5 A;  4KZ9 A;  1RP5 A;  3HLC A;  5A91 A;  4C3Q A;  2XK1 A;  1K38 A;  3RJU A;  5M18 A;  3MXR A;  5FQ9 A;  4KZA A;  4Y0T A;  3WS1 A;  5FAS A;  3MKE A;  4E3N A;  1WYB A;  4KZ8 A;  2JC7 A;  3A3D A;  3IXD A;  2Y2P A;  3MZE A;  4P0M A;  5CEB A;  1SHV A;  2I72 A;  4E3L A;  3SS4 A;  4A5R A;  1PIO A;  4HBU A;  2Y2J A;  3C5A A;  2ZQ7 A;  4UAA A;  4EBN A;  1HD8 A;  1E25 A;  3JYI A;  3SH8 A;  2ZM0 A;  5FI2 A;  1K55 A;  4C75 A;  4IED A;  5HFO A;  5DTK A;  1RCJ A;  2ZMA A;  5G18 A;  1PW1 A;  4OLG A;  3NIA A;  1I2S A;  2PU2 A;  4JF4 A;  4LV3 A;  5DTT A;  2XD5 A;  3IHB A;  4QU3 A;  4WM9 A;  5EUA A;  4KZB A;  1DJA A;  3ZG5 A;  4JF6 A;  4EBP A;  1L0E A;  1TVF A;  1BLH A;  3O3V A;  3FV7 A;  4X55 A;  1ERQ A;  3DTM A;  3IH9 A;  3W4P A;  1BZA A;  4K0W A;  4YFM A;  2VGK A;  3ZVW A;  3Q7V A;  4B4X A;  4GOG A;  3HBR A;  3SOI A;  1NJ4 A;  4WEK A;  4E3J A;  5EVI A;  3VFH A;  1ZG6 A;  2ZJ9 A;  4N92 A;  3NDE A;  2Y2N A;  2ZLY A;  1TEM A;  3PBO A;  3SS5 A;  2EXB A;  4BLM A;  2E8I A;  2ZC4 B;  4DDY A;  4S2N A;  5U47 A;  1O07 A;  1E3U D;  1FCO A;  1S6R A;  5GHX A;  4K0X A;  1SDN A;  2PU4 A;  2XEP A;  4RVA A;  4BD0 A;  3LY3 A;  2DRW A;  3E2K A;  1YT4 A;  3OPP A;  1TDL A;  1EWZ A;  2C6W B;  3ITA A;  1LHY A;  3SH9 A;  1WYC A;  4IVI A;  2OV5 A;  4GDB A;  4B88 A;  1JWZ A;  1ONH A;  3MZF A;  5GLC A;  1G6A A;  3RXX A;  1W8Y A;  4R4R A;  3IWQ A;  2RL3 A;  5M1A A;  3AGE A;  3UDF A;  4QHC A;  1Q2Q A;  3GSG A;  2EX9 A;  5FQJ A;  4U0T A;  1PI4 A;  4UA6 A;  1S0W A;  2G2W A;  4NET A;  4S2O A;  1L0F A;  2ZC3 B;  3G2Z A;  5CTM A;  4EQI A;  3CJM A;  4UHU A;  2WGW B;  3C4O A;  1QME A;  2WGV A;  3IXH A;  3M6H A;  1K4F A;  3N4I A;  1MKI A;  3N8R A;  4PM6 A;  2OLV A;  4JXS A;  4L0L A;  3GVB A;  4GD6 A;  1MY8 A;  3OPH A;  5CER A;  4CJN A;  1SCW A;  3IF6 A;  4YIN A;  4LCM A;  4X6T A;  3G35 A;  3MKF A;  3Q07 A;  5FI7 A;  4GD8 A;  1XA1 A;  2WZZ A;  4R4S A;  3GRJ A;  3M2J A;  5F82 A;  1YMX A;  2EXA A;  1JTG A;  1IYO A;  2P9V A;  4KZ5 A;  3ZCZ A;  2Y91 A;  3VP2 A;  3UE0 A;  3A3F A;  4CPK A;  5CGS A;  5L2F A;  3G4P A;  4XXR A;  2V2F F;  4KQQ A;  3LCE A;  3Q81 A;  1DJB A;  1KVL A;  2XLN A;  3N7W A;  1C3B A;  1BLC A;  1PZP A;  3FKW A;  3UNW A;  2R9W A;  3ZG9 B;  4E3K A;  4GNU A;  3WS5 A;  3LO7 A;  1ES3 A;  3V5M A;  2CC1 A;  4N9K A;  2ZC7 A;  5EOO A;  4S2P A;  3EQV A;  1YLJ A;  4JKT A;  2XFT A;  1FR1 A;  5FAO A;  4X56 A;  5F83 A;  1VM1 A;  2Y59 A;  4FSF A;  5AQ9 A;  1NZU A;  3HRE A;  1CEF A;  1YLW A;  3Q7Z A;  4X69 A;  1ES4 A;  3OCL A;  3M6B A;  4Z9Q A;  4FH2 A;  3UDI A;  1GCE A;  3IH8 A;  1GHP A;  5AQA A;  3A3I A;  2Y2L A;  5GLD A;  4BL3 A;  3GR2 A;  3N8L A;  5TR7 A;  4BEN A;  5EVI D;  1LL9 A;  4ZDX A;  3HUN A;  5M19 A;  1NXY A;  4FD8 A;  5E2E A;  4ZJ3 A;  4Q8I A;  2OLU A;  2Q9N A;  1W5D A;  2WK0 A;  3ITB A;  4E6W A;  5HX9 A;  3BFC A;  1PZO A;  3ZNT A;  2V1Z A;  3O88 A;  4OOM A;  5A93 A;  3N6I A;  1LI9 A;  1FOF A;  4R3B A;  3ZVT A;  1YMS A;  1QMF A;  4U0X A;  4S2I A;  2XH9 A;  1K6S A;  1BUE A;  3ZHH A;  3DWZ A;  1FCN A;  3BFF A;  4DE3 A;  5F1G A;  5A92 A;  5TFQ A;  2ZQ8 A;  3G2Y A;  1EI5 A;  1NYM A;  4OPY A;  4DE2 A;  3NCK A;  4DRT A;  1MWT A;  3O87 A;  1CEG A;  3BYD A;  3PTE A;  2A3U A;  1PWD A;  2ZQC A;  4GN2 A;  4RA7 A;  4ZAM A;  2BLS A;  3G32 A;  1I5Q A;  1W7F A;  2WAD A;  2J9P A;  1GA9 A;  5E2F A;  4OQ0 A;  1H8Y A;  4OOY A;  3V39 A;  5KSH A;  1NY0 A;  4ZJ2 A;  3VOY A;  5KZH A;  1E4D A;  3GTC A;  4OH0 A;  3BLM A;  1K57 C;  1YLP A;  1VQQ A;  1IYP A;  2X02 A;  1MXO A;  3OPR A;  5FQI A;  2XR0 A;  4D2O A;  3B3X A;  1L0D A;  1Q2P A;  2Y55 A;  4R0Q A;  3PBS A;  3CZD A;  4Y0O A;  4OPZ A;  3HLG A;  5A90 A;  3WRT A;  1BLP A;  1WE4 A;  3BFE A;  2X01 A;  3G30 A;  3IT9 A;  4WZ5 A;  4DF6 A;  2HDR A;  1ZG4 A;  1ALQ A;  3A3J A;  1FSW A;  3ZG0 A;  2FFF B;  4KZ4 A;  5DF8 A;  4E3I A;  4DXB A;  4RX3 A;  5AQB A;  4WMC D;  4EBL A;  3BM6 A;  3GMW A;  2ZQD A;  3IQA A;  4GDN A;  5D3O A;  4HEF A;  4GB7 A;  4WEL A;  2UWX A;  4JLF A;  5AQ7 A;  5CHJ A;  3ZDJ A;  5GLB A;  3VP3 A;  3UE1 A;  4E6X A;  1XA7 A;  4P6B A;  3BFG A;  4JXW A;  4JPM A;  3W8K A;  1PW8 A;  3E2L A;  5HAR A;  3HLB A;  1KVM A;  4KZ6 A;  4KEN B;  3NDG A;  5JYP A;  5CTN A;  5CXW A;  1DY6 A;  4ZTK A;  3RXW A;  2Y2O A;  4PMA A;  2EFX A;  2BG1 A;  1TDG A;  3MBZ A;  3NC8 A;  1IYQ A;  4KG2 A;  3MZD A;  1MWS A;  1IYS A;  1GHM A;  4UA9 A;  2HDQ A;  1XKZ A;  3WS4 A;  1KGG A;  3DW0 A;  3S1Y A;  4LCL A;  4X68 A;  4OVD A;  2Y2G A;  3OC2 A;  4BQM A;  3VSL A;  4ZBE A;  2EX8 A;  4S2K A;  5CHU A;  3FYZ A;  5E2H A;  4PM5 A;  1N4O A;  1NYY A;  2RCX A;  4HBT A;  5J8X A;  5FAP A;  3M2K A; 
#chains in the Genus database with same CATH topology
 1A7W A;  3X1S B;  4EET B;  2WKR A;  2F8N G;  1P3F B;  5L07 A;  2J8Y A;  2B02 A;  5EVI C;  3VE3 A;  3S4X A;  4EEU A;  1YU4 A;  4IJF A;  1P9W A;  3LIF A;  1RGY A;  5HL1 A;  4EQ1 A;  3H7W A;  3QP8 A;  2CV5 A;  2V8F A;  4WU9 B;  5B33 D;  4KGC B;  3LZ0 C;  2O0Y A;  3OBF A;  1H3O B;  3MVD C;  3X1V B;  4S2L A;  3AZM A;  5GHZ A;  1OGB A;  1D7E A;  3LIC A;  3AV2 A;  3C1B B;  3VMA A;  3CLO A;  5AV5 B;  3MS6 A;  5E43 A;  4KUD C;  4I39 A;  2NUP C;  1IEL A;  4ETZ A;  5B0Z C;  2FFY A;  5HZH A;  3WAA D;  4KHA A;  3W98 B;  3C1C B;  5DKK A;  5B24 D;  1O7E A;  4ZRR A;  5F1F A;  4WUJ A;  5DTS A;  5AVB C;  3FPV A;  2GX5 A;  3T4O A;  3LIB A;  2WGW A;  2OSU A;  1F1E A;  3W99 A;  4RX2 A;  4D60 A;  2Y2I A;  4H6J A;  3ZG7 B;  1QO6 A;  5FL3 A;  1P3A B;  4WBG A;  1NRF A;  4WYY A;  2VV7 A;  3AZJ C;  3X1U D;  1L2S A;  1KX3 C;  1BH8 B;  3LJA C;  5DF9 A;  1E6P A;  4Q0J A;  2W3H A;  4J8V B;  3A1I A;  3KWQ C;  1Y54 A;  2BTF P;  4YS3 D;  1M1A B;  2HP6 A;  2IO5 C;  2Y8H A;  3Q82 A;  5G49 A;  5DNN B;  1E8B A;  3UTB D;  3VOL A;  2H5S A;  3MGQ A;  5C5K A;  1BUL A;  1S4S A;  4YM6 A;  1IKI A;  4E3O A;  2CV5 D;  3OPL A;  1M18 A;  3AZK B;  1W79 A;  1P3L A;  1N1J A;  2NZD A;  5FDH A;  2Z2L B;  2DCF A;  4XUZ A;  1SKO A;  4YOF A;  4RYE A;  3HLF A;  4GKU A;  5BO0 B;  4HMD A;  4J8U B;  1JNU A;  3SS3 A;  1J7M A;  4PM8 A;  5E5A B;  5B33 C;  3L25 A;  2V0U A;  4MBK A;  3P98 A;  1YLZ A;  1WWS A;  2LY8 A;  3MQO A;  2HF6 A;  1ZKJ A;  3FC7 A;  3AZG A;  1S4R A;  4JXV A;  1L0G A;  4H9O A;  1KGF A;  5GXQ B;  4R3J A;  1MPL A;  2PBD P;  3JVU A;  1IOU A;  4E44 A;  3UPO A;  4MN5 A;  4QY6 A;  3S7O A;  1HZO A;  4H9P B;  1OGG A;  5GT0 A;  1Q9C A;  5HWW A;  1IEM A;  3WKJ B;  3EGX C;  3NQJ B;  2IA2 A;  1H5X A;  5FQM A;  3NOT C;  3MFD A;  3B47 A;  4I3I A;  3B6F A;  4HP4 A;  5B24 C;  1PWC A;  4EER A;  3W99 D;  2PAV P;  1P97 A;  2ZBB A;  1IKG A;  4LD9 A;  4RQ9 A;  4S2N C;  2YFV A;  1NLY A;  4LV1 A;  3OCN A;  3N8S A;  1PI5 A;  3EPK A;  3V50 A;  2HIO B;  3AGF A;  3D4F A;  1JWP A;  3ZNY A;  3UB9 A;  5I5L A;  1X0O A;  3X1U C;  3LGO A;  3O62 B;  2NQB A;  1P3P D;  2WAF A;  4OKP A;  2PRF A;  2XRO A;  1ONG A;  1RGZ A;  1VEU A;  3MGP D;  3B6G B;  4EEP A;  3C4P A;  4Z2M G;  4OQH A;  2D49 A;  2P08 A;  3SW1 A;  4YS3 C;  2JCH A;  3DTK A;  3S7P A;  4AWL C;  4YM6 D;  3F1N B;  3HLW A;  1M18 D;  2V1B A;  1P3L D;  4I5S A;  2NZD D;  3UTB C;  1DP6 A;  4LEN A;  4J8W B;  2W3D A;  5B0Y A;  5B2J B;  2Z6D A;  2CV5 C;  5DFY A;  2QMI A;  5FUG B;  4GLQ A;  3WS2 A;  4XUJ A;  3X1S A;  1P3F A;  4HGA C;  1E6Z A;  2HP9 A;  1F5M A;  3HVF A;  3AZG D;  3AZH B;  3BW6 A;  2F8N B;  4KZ9 A;  1RP5 A;  3HLC A;  2XK1 A;  3RJU A;  3MXR A;  3E0Y A;  3T4Q A;  5FQ9 A;  4WU9 A;  4E3N A;  4KGC A;  1WYB A;  4R38 A;  2HZ5 A;  2JC7 A;  2Y2P A;  1H3O A;  3KUY D;  3X1V A;  3AZF B;  3LR4 A;  4WL9 A;  3C30 A;  4R8P D;  3B6F D;  3W96 B;  3C1B A;  2J80 A;  2ZM0 A;  3AYW B;  1K55 A;  1KX4 D;  4IED A;  3QP4 A;  1Y4O A;  5AV5 A;  2F8N H;  1ZLA B;  4LD9 D;  1I2S A;  2PU2 A;  4JF4 A;  4LV3 A;  2XD5 A;  1W63 Q;  3IHB A;  3W99 C;  3NQU B;  2QKP A;  3TE8 A;  3W98 A;  3C1C A;  1TVF A;  3NOP C;  3O3V A;  3D9Y A;  4II7 A;  4X55 A;  5B31 G;  1OTB A;  2KX6 A;  4K0W A;  4NG2 A;  2NQB D;  2FH5 A;  2VGK A;  5AV9 B;  3QP2 A;  3VFH A;  4N92 A;  3AFA D;  2FN2 A;  3SS5 A;  1TEM A;  1P3P C;  2E8I A;  2ZC4 B;  1P3A A;  3MGP C;  4GCZ A;  2PU4 A;  1V9Z A;  1BH8 A;  3WD3 A;  3P01 A;  5DFX A;  3E2K A;  2HUE B;  1EWZ A;  2C6W B;  1LHY A;  1WYC A;  4IVI A;  4J8V A;  4B88 A;  1L3L A;  5GLC A;  3M7P A;  4WJ3 C;  1W8Y A;  5B0Y D;  4YM6 C;  3UDF A;  4QHC A;  1M1A A;  4IBI A;  2EX9 A;  1E88 A;  2HGV A;  4X1L A;  2NZD C;  3CJM A;  1P3F D;  4NXF A;  5DNN A;  3WX7 A;  3IXH A;  3N8R A;  2DQN C;  4I3J A;  4PM6 A;  1XFN A;  3L7H A;  3QP6 A;  5TBM B;  5B40 B;  3H9W A;  4MB5 A;  4OUI A;  3DBA A;  3AZK A;  4X6T A;  4WU9 D;  3AZG C;  3F1O B;  4R4S A;  3GRJ A;  3M2J A;  1YMX A;  3AL0 C;  5CP6 B;  1TS6 A;  5BO0 A;  1JTG A;  4QPR A;  4J8U A;  2Y91 A;  3TJZ C;  3A3F A;  4GS9 B;  5G4Z A;  5E5A A;  5L2F A;  1GSW A;  3C1B D;  2XLN A;  1C3B A;  1BLC A;  3FKW A;  3KUY C;  3C8C A;  2R9W A;  4E3K A;  5AV5 D;  1KOU A;  1TF1 A;  3LO7 A;  5GXQ A;  1PDC A;  1ES3 A;  3V5M A;  4R8P C;  3B6F C;  2O99 A;  4Z66 D;  3CPT B;  3IX8 A;  1FR1 A;  5FAO A;  5F83 A;  4FSF A;  1KX4 C;  3W98 D;  3Q7Z A;  4H9P A;  4LD9 C;  2HV1 A;  4X69 A;  1T1A A;  3WKJ A;  1GCE A;  3NQJ A;  4WZS B;  5AQA A;  4DJ3 A;  4WU8 D;  3A3I A;  2QYB A;  1OPX A;  3LEL D;  4BL3 A;  1F66 B;  4ZDX A;  3A6N B;  2NQB C;  4NE3 A;  3UB8 A;  2WK0 A;  3MXQ A;  4E6W A;  1P3A D;  5CPJ D;  4OOM A;  3KS8 A;  3N6I A;  1LI9 A;  3AFA C;  1FOF A;  1QMF A;  4F3L B;  2HIO A;  3BFF A;  1UR8 A;  3QP1 A;  5J3W A;  4DE3 A;  5A92 A;  3O62 A;  4DRT A;  1MWT A;  1CEG A;  4EU0 A;  4CLC C;  3B6G A;  3AZL D;  1GA9 A;  4X23 B;  5KSH A;  5DNN D;  4LGW A;  1E4D A;  4IBE A;  4UPK A;  3GTC A;  4IUH A;  4OH0 A;  1YLP A;  4DQY B;  4LFU A;  1N9L A;  4WF0 A;  3F1N A;  4D2O A;  4OJP A;  2XRN A;  1P3F C;  3AZK D;  4Y2F A;  1Q2P A;  5A90 A;  2P7J A;  3HLG A;  1XJ6 A;  2AVX A;  1P3K D;  3BJN A;  4J8W A;  3AZM B;  3IT9 A;  4KUO A;  1ZG4 A;  5B2J A;  1ALQ A;  4IBK A;  3A3J A;  4QWO A;  4H9R B;  4J8U D;  3T1R A;  2IOU A;  2K2N A;  3L26 A;  4RX3 A;  4WU9 C;  5E5A D;  3MQQ A;  5FUG A;  3IQA A;  4Z2M H;  3V67 A;  5JA4 A;  4GB7 A;  4WEL A;  5EVE A;  1W1Y A;  5AQ7 A;  3EEH A;  3AZH A;  5GLB A;  5HDD A;  3BQA A;  5GXQ D;  2F8N A;  4Z2J A;  1XA7 A;  3C1B C;  3BFG A;  3W8K A;  3HLB A;  1S32 B;  5CTN A;  5CXW A;  5BS7 C;  1DY6 A;  5AV5 C;  3NC8 A;  3PHY A;  3WKJ D;  4Z66 C;  3AZF A;  1XKZ A;  3WS4 A;  3DW0 A;  3W98 C;  1TS8 A;  3W96 A;  3C38 A;  5CHU A;  3FYZ A;  3AYW A;  4L9G A;  4PM5 A;  4WU8 C;  3MGR D;  1ZLA A;  3LEL C;  4PHT A;  5TGF A;  4GH9 A;  1P3O D;  2H10 A;  3NQU A;  3ZFZ A;  5GT3 D;  3REJ C;  3IWO A;  2HIO D;  1CK3 A;  4E3M A;  1P3A C;  2EWV A;  5CPJ C;  3O62 D;  5IS1 A;  1KE0 A;  2HP5 A;  5AV9 A;  3PBR A;  3IP4 C;  5B31 B;  3JPU A;  4QD4 A;  3FWL A;  3UN7 A;  1H0M A;  5CGX A;  3HLD A;  2QZ6 A;  4E45 A;  3V3R A;  1ES5 A;  5BOH A;  1LSV A;  3EOI A;  4EUZ A;  3V9R B;  4HQA A;  3HON A;  2G2U A;  3FKV A;  1XX2 A;  3AZL C;  4G3K A;  1N9N A;  2O9B A;  5CX7 A;  5K5B A;  3CHW P;  1HQ3 C;  1E3U A;  5DNN C;  4JXG A;  1E6R A;  4G92 B;  3B0D B;  3WS0 A;  1AXB A;  3VH5 A;  4J8W D;  4EUV A;  1MWR A;  5B2J D;  2XFS A;  3LYX A;  3AZK C;  3VFF A;  1P3K C;  1T3U A;  4I38 A;  1K25 A;  2H0Y A;  1JTD A;  3PBT A;  4Z2H A;  5DJT A;  4J8U C;  2VGJ A;  3AZH D;  1CJF A;  2EWW A;  2YKH A;  2F8N D;  5IU1 A;  5TBM A;  2V20 A;  5B40 A;  2L1M A;  4O8G A;  3IBJ A;  3LEZ A;  2CWE A;  1N9B A;  4FTX A;  4BMW A;  1GA0 A;  2ZM8 A;  2XGN A;  1E15 A;  1AWI A;  5FSR A;  3F1O A;  2RVQ D;  5GXQ C;  1J3W A;  1DJC A;  1Z6F A;  5CP6 A;  3HUM A;  4DE0 A;  5FI6 A;  3AZF D;  2EX2 A;  4GS9 A;  1KE3 A;  4LRY C;  3W96 D;  1ERO A;  3AYW D;  3CMZ A;  1ACF A;  2Z2M B;  3AGD A;  1ZLA D;  4LV0 A;  3S7Q A;  3CPT A;  3L27 A;  4QY5 A;  1NWZ A;  4P6Z M;  3LIE A;  3MGR C;  5DVA A;  3SH7 A;  2VLG A;  2JE5 A;  3IF6 B;  2G5H C;  2PR5 A;  1P3O C;  2ZOH A;  5AV9 D;  3LIA A;  1VHM A;  5GT3 C;  3W4O A;  2D01 A;  4DKI A;  2ZC6 B;  2HIO C;  1F66 A;  1YLT A;  3UO9 A;  1KX5 B;  2Y2Q A;  4G91 C;  2ZC5 B;  3A6N A;  3O62 C;  3A3E A;  5GHY A;  4KQD A;  4M4X A;  1CQA A;  1GPF A;  4EWF A;  3MNN D;  5B1M C;  3W4Q A;  1B67 A;  1BT5 A;  1OT6 A;  2A2L A;  3EG5 B;  4F3L A;  4QB8 A;  3BRM A;  4NE5 A;  4FH4 A;  4XUX A;  3VP0 A;  4J8X D;  4ID4 A;  1S1Y A;  2ZD8 A;  1VET B;  3KSF A;  4K91 A;  3TOI A;  3WA9 B;  2O9A A;  3RFB A;  2I9V A;  4XUJ B;  5DJU A;  3UPP A;  4J8W C;  4DDS A;  1ESI A;  4BL2 A;  4X23 A;  4H9S A;  5B2J C;  1M40 A;  5EFW A;  5CHM A;  1HTA A;  3QHY A;  4XT2 B;  4WZ4 A;  3VH6 A;  3ZG8 B;  5EE8 A;  5CPK B;  1WA9 A;  3LY4 A;  5AV8 B;  3AZH C;  1MKM A;  1K54 A;  4OPQ A;  2VX8 A;  1W1T A;  4NZ5 A;  1EQZ B;  2ZQ9 A;  5FDS A;  1XXM A;  2ZY4 A;  4H9R A;  3R45 B;  4JBF A;  2P74 A;  3PBQ A;  3LI9 A;  4OPR A;  1FR6 A;  2IWB A;  2RVQ C;  5CPI D;  3UY6 A;  2EFU A;  5FAT A;  3AZF C;  2FJ7 B;  2WGI A;  3IWI A;  4WMC A;  3IXG A;  4KG6 A;  5GL9 A;  3W96 C;  2ZM5 A;  1YM1 A;  4HJ4 A;  3AYW C;  1S32 A;  5HDC A;  4B4Z A;  3B0B A;  1ZLA C;  4PPR A;  4DXC A;  2H0T A;  3H0L C;  1D1J A;  3PAE A;  1LLB A;  3HUO A;  2DF4 C;  3KSI A;  1F66 D;  4GW9 A;  3A0R A;  4PKY G;  3NY4 A;  3AZN B;  3BLS A;  4O7D A;  2V0W A;  1ZTU A;  1BFM A;  3MMH A;  5AV9 C;  4MB3 A;  2HDS A;  5A8B A;  3OZH A;  4NZ3 A;  3UT9 B;  1LL8 A;  3HLE A;  2PYO B;  4PM7 A;  3AZE B;  2IWD A;  4IBC A;  3O5Y A;  5M18 A;  5A91 A;  5JRG B;  3REK D;  4KZA A;  3MNN C;  5FAS A;  3NEC A;  2L5A A;  1U35 B;  5B31 A;  2HUE C;  1SHV A;  5HWV A;  2I72 A;  4E3L A;  5DNM B;  4JGP A;  4J8X C;  2ZQ7 A;  1HD8 A;  2Q0O A;  3V9R A;  4X23 D;  5HFO A;  2A24 B;  5BNV B;  3W97 B;  4QU3 A;  4WM9 A;  4KZB A;  1DJA A;  1V9Y A;  4EBP A;  1L0E A;  3MQL A;  1BLH A;  4NXB A;  1P3I B;  3KFU G;  1ERQ A;  3AZM D;  4MN7 A;  3W4P A;  1P3B B;  3AV2 D;  3CAX A;  3SOI A;  3HBR A;  1W1V A;  5HSQ A;  1O07 A;  1YU1 A;  1FCO A;  4K0X A;  1SDN A;  5CPI C;  3LY3 A;  1S32 D;  3WTP E;  3E4O A;  1TDL A;  4NE6 A;  2W3F A;  2VA0 A;  2OV5 A;  5EM0 A;  3WAA C;  1JWZ A;  1ONH A;  2W8S A;  3MFX A;  2M7U A;  3KXB B;  4UA6 A;  1PI4 A;  4NET A;  5CTM A;  1L0F A;  3G2Z A;  3C2W A;  3LZ1 B;  3REL B;  1QME A;  3KSY A;  1F66 C;  4HI4 A;  1K4F A;  3N4I A;  1MKI A;  5AJG A;  4GD6 A;  1PFL A;  4Z1W A;  4CJN A;  3T4K A;  3IF6 A;  4YIN A;  4LCM A;  5FI7 A;  1F2K A;  5F82 A;  2DMW A;  3REK C;  3L29 A;  1KX5 A;  3DTE A;  3VP2 A;  4Z2I A;  3H0R C;  5AVC B;  1DP8 A;  4XXR A;  3MGS B;  4HNB A;  3LCE A;  1DJB A;  3UB7 A;  3S7N A;  3MGQ D;  3UNW A;  3ZG9 B;  4GNU A;  3TU4 B;  3B42 A;  5EOO A;  2ZC7 A;  3EQV A;  1YLJ A;  1WWI A;  4X23 C;  2XFT A;  3RH8 B;  5FEG A;  4H9S C;  1UWN X;  2WKP A;  3HRE A;  3IBR A;  1ES4 A;  1VET A;  4Z9Q A;  3UDI A;  3WA9 A;  3ZYT A;  3IH8 A;  3WD4 A;  3REH B;  5JA4 B;  4IBB A;  1M19 B;  3GR2 A;  2B95 A;  4BEN A;  3AZM C;  5B2I B;  1NXY A;  4ZJ3 A;  4Q8I A;  2Q9N A;  3A0S A;  3MJQ A;  3AV2 C;  3BFC A;  2ZMV A;  3ZNT A;  4XT2 A;  5A93 A;  5KDM B;  1PZR A;  5AY8 B;  5CPK A;  1T1B A;  1YMS A;  5GT0 D;  3GDI A;  3BQ8 A;  4HH3 A;  4S2I A;  5AV8 A;  1K6S A;  4MDZ A;  4EES A;  1BUE A;  1STZ A;  3DWZ A;  5BT1 D;  1EQZ A;  5F1G A;  5TFQ A;  3G2Y A;  1S32 C;  4OPY A;  4NKP A;  3R45 A;  4CSR B;  1O6I A;  5HPI A;  2OWH A;  3R7W B;  1PWD A;  5LBR A;  2ZQC A;  4GN2 A;  2F2A C;  1CF0 A;  5EV0 A;  2VV6 A;  2BLS A;  2W1R A;  3G32 A;  4Y3I A;  2FJ7 A;  4LG2 A;  2W27 A;  5J4E A;  2J9P A;  4OQ0 A;  3V39 A;  4H9N B;  4ZJ2 A;  4KUD B;  4EO5 C;  3OPR A;  3WD2 A;  5FQI A;  3UB5 P;  2Y55 A;  3PBS A;  3CZD A;  4OPZ A;  1BLP A;  4DF6 A;  5AVB B;  4WZ5 A;  3EWK A;  4IJG A;  1KX5 D;  1FSW A;  2FFF B;  5DF8 A;  3AZN A;  4E3I A;  3IS2 B;  4ETX A;  1OJG A;  3UT9 A;  2PYO A;  3VP3 A;  5B1L B;  3REI B;  3AZE A;  3KO6 A;  5JRG A;  1KVM A;  3MGQ C;  2JKT M;  2ZL1 B;  3NDG A;  5HD3 A;  4NYY A;  4LRZ E;  2Y2O A;  2R78 A;  1U35 A;  1OTA A;  1M18 C;  1IYQ A;  3WA9 D;  1P3L C;  3KWQ B;  2NUT C;  5DNM A;  2ZOI A;  4XUJ D;  3X1S D;  4G92 C;  4NEE D;  1E6N A;  3OC2 A;  4BQM A;  3VSL A;  2EX8 A;  4S2K A;  5J8X A;  5E2H A;  1NYY A;  4HBT A;  2A24 A;  1GSX A;  3M2K A;  2EX6 A;  1XPB A;  4PAU A;  2WYX A;  5BNV A;  5CPK D;  4KGC D;  3W97 A;  1PWG A;  4JF5 A;  2E8J A;  5CED A;  2GZA A;  3WWX A;  1P3I A;  5FQK A;  4HY8 A;  3X1V D;  4PM9 A;  2WKE A;  1EQZ D;  3I7J A;  2FZ0 A;  3IHA A;  2P04 A;  4HOI A;  1P3B A;  5GT0 C;  4Y17 A;  1CI9 A;  5BT1 C;  1ERM A;  2PBY A;  4IBJ A;  1TS0 A;  4NZ4 A;  2HPB A;  4BJP A;  1BH9 B;  3C1C D;  2KLI A;  3UPN A;  5E2G A;  4JGO A;  4HME A;  2WKH A;  4NZ1 A;  1BSG A;  4Q0H A;  2ZY3 A;  4S2J A;  3Q1F A;  1TZY B;  4N9L A;  3WRZ A;  5HD5 A;  4ARZ B;  1S67 L;  1ESU A;  1YLY A;  4ZJ1 A;  2ZY5 A;  1FCM A;  3KXB A;  2PYR A;  5IHV A;  5B24 B;  3LZ1 A;  4HES A;  4GHI B;  4IBD A;  3REL A;  1G68 A;  1KX5 C;  2PYO D;  3NBL A;  4IUK A;  3ICY A;  1LL5 A;  4H8R A;  1K57 A;  3G31 A;  4J8V D;  5JRG D;  3G6O A;  5F99 B;  2HJE A;  1GHI A;  4XZQ B;  3T1Q B;  3AN2 B;  1YU0 A;  1MC0 A;  1M1A D;  4DMZ A;  2ACG A;  4R1G A;  3UDX A;  3IXB A;  2VKS A;  2OAP 1;  5DNM D;  5AVC A;  4OLD A;  3EGD C;  5B0Y C;  5EEC A;  4C6Y A;  5CGW A;  3MGS A;  4GHL A;  1J9M A;  1W63 M;  2ZM2 A;  3WA9 C;  1LT0 A;  1W8Q A;  4ME4 A;  3WD1 A;  4NK3 A;  3T4S A;  3TU4 A;  4BWI A;  4XUJ C;  3X1S C;  2J9O A;  3F6T A;  4YS3 B;  2XA7 M;  1LSX A;  4MBF A;  3VP4 A;  4O0P A;  5JYO A;  5AV6 B;  5I94 A;  1SKF A;  2J7V A;  1BYW A;  1XFQ A;  3UTB B;  4KGC C;  2PD8 A;  4OP5 A;  1TAF B;  4EV4 A;  3REH A;  5DF7 A;  1M19 A;  4HMC A;  2P9V B;  3X1V C;  1KDS A;  4AFI A;  1OJ5 A;  4P6Z S;  5B2I A;  1EQZ C;  3A0V A;  2ZQA A;  1Z2C B;  5MC7 A;  2WUQ A;  2WAE A;  2Y4A A;  4OQI A;  5KDM A;  1K55 C;  5AY8 A;  1OME A;  1KGE A;  2JKF A;  4LPZ A;  4LRX C;  1H0I A;  3JVV A;  3OLO A;  3EPJ A;  3VV4 A;  3TSG A;  1PYY A;  4KZ7 A;  2Y2K A;  3FPW A;  1JWV A;  3X1T B;  1P3G B;  4MN6 A;  3C1C C;  3GQZ A;  1HVB A;  2WKI A;  4CSR A;  5CEC A;  4HJ3 A;  4O01 A;  3R7W A;  2ARO B;  5DKL A;  3QNC A;  3CIT A;  2X71 A;  4HP9 A;  5EPH A;  3H82 B;  2GDN A;  3AZI B;  3LZ1 D;  2R9X A;  2G5I C;  3ZGA B;  3REL D;  4WZ5 C;  4H9N A;  2INW A;  1N9O A;  3S22 A;  5G4Y A;  2HDU A;  1ZC2 A;  4KZ3 A;  3EPL A;  4KUD A;  1KDW A;  5GLA A;  3T4J A;  2PYO C;  2Y79 A;  1U60 A;  3DWK A;  4OJO A;  4Y15 A;  1M6K A;  2ZY2 A;  5AVB A;  1OTI A;  3B6G D;  4J8V C;  5JRG C;  4JJN B;  4QLC B;  4P87 A;  5EM1 A;  5AVC D;  5AVE A;  3DTI A;  3IS2 A;  4R70 A;  4PKY A;  3MGS D;  1M1A C;  3W2Z A;  1XJ3 A;  4U3T A;  4GZB A;  1P3P B;  1AOI B;  3KX0 X;  3P09 A;  3RTY A;  5DNM C;  5B1L A;  2XQZ A;  3REI A;  3WD0 A;  3MGP B;  2WZX A;  4N1X A;  2UV0 E;  2ZL1 A;  1NZO A;  2IWC A;  2K31 A;  5L10 A;  3FZC A;  2H28 A;  2JBF A;  3KSH A;  4YNR A;  3KWQ A;  3REH D;  3NI9 A;  1OTD A;  1M19 D;  3MXS A;  4WNN B;  1F9I A;  5B32 G;  5E5A C;  5F6A A;  1LI0 A;  3HJK A;  1UR9 A;  5AY8 D;  1UGU A;  5FA7 A;  3KYZ A;  3VOZ A;  4Y7P A;  3CG5 A;  5J7E A;  1K38 A;  3L28 A;  2VK3 A;  3KSG A;  4Y0T A;  3WS1 A;  3MKE A;  3FDD A;  4UQI S;  4KZ8 A;  1DRM A;  3IXD A;  4P0M A;  2RTS A;  3MZE A;  4Q0I A;  3WKJ C;  2JKT I;  4HBU A;  3D72 A;  2Y2J A;  4EBN A;  1P34 B;  4UEY A;  5FI2 A;  3KUY B;  1P3M B;  4C75 A;  1BH9 A;  2ZMA A;  1PW1 A;  4R8P B;  3NIA A;  3LZ1 C;  1ODV A;  5DTT A;  2W3E A;  3REL C;  3T50 A;  1KX4 B;  4JF6 A;  2GNX A;  1TZY A;  3FV7 A;  4OJ6 A;  4ARZ A;  4R6L A;  1G6O A;  1BZA A;  4YFM A;  4L9F A;  4GOG A;  2BYK B;  1NJ4 A;  4KUK A;  4FUW A;  5B24 A;  4GHI A;  1ZG6 A;  3VH6 W;  3UTA B;  3B6G C;  2M7V A;  2Y2N A;  2ZLY A;  4BLM A;  5L09 A;  1H0G A;  5C3I B;  5B1L D;  5AVC C;  4DDY A;  4S2N A;  3REI D;  5U47 A;  5HPF A;  3LR5 A;  1E3U D;  1S6R A;  4HIA A;  4RVA A;  5F99 A;  2XEP A;  5GHX A;  4BD0 A;  3AFA B;  2DRW A;  3DAV A;  1YT4 A;  2JHE A;  4XZQ A;  3ITA A;  3AN2 A;  2V5O A;  3U2A A;  4GDB A;  2WKQ A;  3RXX A;  2K7S A;  4Z5T B;  4R4R A;  1MZU A;  2RL3 A;  1AIW A;  4CLC B;  1YU3 A;  1Q2Q A;  3GSG A;  5FQJ A;  1S0W A;  4S2O A;  5B40 D;  3VH5 T;  2MJ6 A;  3C4O A;  1SZV A;  3REH C;  2WGV A;  4YS3 A;  1M19 C;  1LSW A;  2J3T D;  3M6H A;  2OLV A;  4JXS A;  5AV6 A;  4L0L A;  3GVB A;  4B93 A;  3OPH A;  5CP6 D;  3MKF A;  3GEC A;  5AY8 C;  3Q07 A;  3UTB A;  1XA1 A;  1TAF A;  2WZZ A;  2PR6 A;  1R4V A;  2G7U A;  2EXA A;  2P9V A;  3F1P B;  3UE0 A;  3WTP B;  5CGS A;  3G4P A;  2V2F F;  4YWZ A;  3ULF A;  4KQQ A;  3Q81 A;  5BPV A;  3N7W A;  1PZP A;  2VV8 A;  2PDR A;  3WS5 A;  1KU5 A;  2CC1 A;  4N9K A;  4S2P A;  2L4R A;  3AV1 B;  2GJ3 A;  2V8C A;  5AQ9 A;  3X1T A;  1NZU A;  1P3G A;  4BBV A;  1YLW A;  5F69 A;  1TZY D;  3OCL A;  3M6B A;  1PNE A;  4FH2 A;  2ARO A;  1YUE A;  4Z66 B;  4H9Q B;  3KYE A;  3A6N D;  3HJI A;  1GHP A;  5HL6 A;  4UQI M;  3H82 A;  3AZI A;  5TR7 A;  1LL9 A;  4B9O A;  3K3C A;  4FD8 A;  4WU8 B;  2OLU A;  3LEL B;  5F68 A;  5CHL B;  2KOI A;  2VGL S;  1PRQ A;  5F99 D;  3BWL A;  3ZVT A;  4R3B A;  4DN0 A;  2QWS A;  4U0X A;  3REJ B;  4XZQ D;  3AN2 D;  3CWF A;  5B1L C;  3REI C;  1FCN A;  1TD5 A;  5CPJ B;  1EAK A;  1EI5 A;  3KS4 A;  1NYM A;  4JJN A;  4R3A A;  4DE2 A;  4QLC A;  3BYD A;  3PTE A;  2A3U A;  3D3O A;  4RA7 A;  4ZAM A;  1S1Z A;  3HCY A;  4ZUX B;  1I5Q A;  2ZMF A;  1P3P A;  4DRA A;  1AOI A;  2JN7 A;  4CLC E;  5E2F A;  3VE4 A;  4OOY A;  1JFI B;  2VJW A;  1GOI A;  1NY0 A;  2PD7 A;  3MGP A;  3VOY A;  5L8M A;  1P0Z A;  2J8P A;  5KZH A;  3AZL B;  5AV6 D;  4EW7 A;  5B40 C;  1IYP A;  2X02 A;  1HQ3 B;  2XR0 A;  5TJJ A;  3B3X A;  2J3T C;  1CK7 A;  3VH6 T;  3BFE A;  1YSP A;  5CP6 C;  4WNN A;  3ZG0 A;  4KZ4 A;  4DXB A;  4IHQ A;  5AQB A;  4WMC D;  1P3K B;  2ZQD A;  5B32 B;  4GDN A;  5D3O A;  5CHJ A;  5HDS A;  3UE1 A;  4E6X A;  4JXW A;  4G3W A;  3P5J B;  3E2L A;  5JYP A;  3X1T D;  1P3G D;  4ZTK A;  3RXW A;  4PMA A;  2EFX A;  4MB4 A;  1TDG A;  3MBZ A;  4NYU A;  2ARO D;  1MWS A;  1OTE A;  1IYS A;  4UA9 A;  2HDQ A;  1KGG A;  2YFW B;  4LCL A;  4OVD A;  3AZI D;  1T19 A;  1TZY C;  2Y2G A;  4X1M A;  4ZBE A;  5KIZ A;  1P34 A;  1UWP X;  2RCX A;  3KUY A;  3A6N C;  1P3M A;  5FAP A;  1Z09 A;  4I3A A;  4R8P A;  1H8P A;  3IF5 A;  4JGQ A;  3BY9 A;  3BEB A;  2V9A A;  1FQG A;  1B6W A;  5B31 D;  1KX4 A;  3MGR B;  3LEQ A;  4OOL A;  4CAY B;  1YKD A;  1P3O B;  5F99 C;  1ES2 A;  2A49 A;  4JJN D;  3CI6 A;  4FCF A;  4QLC D;  5GT3 B;  4XZQ C;  2BYK A;  1NRJ A;  4MMN A;  3AN2 C;  4N1H A;  4G91 B;  3C7U A;  4GJ4 A;  3UTA A;  1AOI D;  5B1M B;  5FEF A;  2D02 A;  4ZBJ B;  3AFA A;  4WEJ A;  2Q9M A;  2DNS A;  3VP1 A;  1IFQ A;  2VGL M;  4IBG A;  3HSH A;  5KMW A;  1HTZ A;  4OP8 A;  2XF3 A;  3PBN A;  4Z5T A;  1K54 C;  4S2M A;  5AV6 C;  1MWU A;  4QJG A;  4CLC A;  4FOF A;  1OT9 A;  2JSS A;  5GSU B;  1ID3 B;  3Q7V B;  3UE3 A;  2JKR M;  5EVI B;  1JVJ A;  5EOE A;  3E98 A;  2B5R A;  1EW0 A;  2W3G A;  3QNB A;  4K08 A;  3LZ0 B;  2XDM A;  1NLZ A;  1BLS A;  3MVD B;  1XGI A;  2Y2M A;  2Y2H A;  3O86 A;  5HAP A;  4OQG A;  3UB6 A;  3F1P A;  4Y13 A;  1YQS A;  3WTP A;  3X1T C;  2BAS A;  5BNX B;  1P3G C;  4TX8 A;  1Y28 A;  5FQQ A;  1P34 D;  2ARO C;  1P3M D;  2XD1 A;  2RIQ A;  2C5W B;  1XGJ A;  5B0Z B;  3AZI C;  5EVL A;  1K6R A;  4Z2L A;  2JKG A;  3AV1 A;  4F94 A;  2OAQ 1;  2CMN A;  5BS7 A;  4NY2 A;  1GXD A;  4KQR A;  4NFT A;  4Z66 A;  4H9Q A;  4X53 A;  4KQO A;  4DE1 A;  5B31 C;  2XA7 S;  3PXP A;  1BTL A;  4MBH A;  3EQU A;  3SZT A;  1W1P A;  4IBX A;  3UTA D;  4L9E A;  2M1C A;  3AZJ B;  4WU8 A;  4JJN C;  1KX3 B;  4QLC C;  3LEL A;  4HH2 A;  3GV9 A;  2VQR A;  3LJA B;  1K56 A;  4Y5F A;  4MLL A;  4BBT A;  3REJ A;  1AOI C;  4LV2 A;  3EPH A;  4WLA A;  3MNN B;  5F5Y A;  2BYM B;  5CPJ A;  2LB9 A;  2OOL A;  4BD1 A;  5HW3 A;  1A0K A;  1H8Z A;  1HLU P;  1SDE A;  4M3K A;  3B0D C;  4UA7 A;  4Z5T D;  3LI8 A;  4NXE A;  1ED7 A;  4CLC D;  5CRF A;  2IO5 B;  4J8X B;  4ZUX A;  3MR0 A;  4MEZ A;  1I2W A;  3CUE A;  4IJE A;  1JFI A;  4WV4 B;  4KG5 A;  5AV8 D;  3V3S A;  3AZL A;  4DRB A;  1T1C A;  3TG9 A;  1KE4 A;  3G34 A;  1HQ3 A;  2B18 A;  3PAG A;  1G5U A;  2YKF A;  3K3D A;  3MSH A;  4OJL A;  1T18 A;  5B33 B;  5HAI A;  4Z2G A;  3FKE A;  3HL9 A;  4MNR A;  4P85 A;  1MBL A;  5FAQ A;  2FJ7 D;  3WTP D;  4IVK A;  3NHQ A;  1K4E A;  1P3K A;  1CI8 A;  4IBR A;  3NOU C;  1S66 L;  5B32 A;  1YSQ A;  2QPN A;  5KSC A;  4R23 A;  5CPI B;  5HAQ A;  3AV1 D;  1P34 C;  2PHY A;  2KDK A;  3T1X A;  1P3M C;  1GSV A;  3UME A;  4Y0U A;  1H3Q A;  3ISG A;  3IF6 C;  4UUZ B;  3AZN D;  3C7V A;  3WAA B;  3VSK A;  4IBF A;  3B0C W;  3MF0 A;  3BEC A;  3E4Q A;  2YFW A;  1XP4 A;  4OON A;  3UT9 D;  1YAX A;  2PT7 A;  2W1T B;  1H8M A;  2EA9 A;  3BFD A;  3AZE D;  2O9C A;  4HJ6 A;  1K56 D;  1FSY A;  3UTA C;  1U35 D;  4C3Q A;  3MGR A;  5C3I C;  3X1U B;  3REJ D;  1TS7 A;  4CAY A;  3FG8 A;  1P9R A;  1P3O A;  3L2A A;  2PYP A;  3QP5 A;  5GT3 A;  3A3D A;  3T12 B;  3REK B;  5CEB A;  4E04 A;  4WN5 A;  3SS4 A;  4A5R A;  2OWJ A;  1PIO A;  4ZUX D;  3C5A A;  4UAA A;  4Z5T C;  1E25 A;  3JYI A;  3SH8 A;  2W0N A;  3W97 D;  2L0W A;  3U4L P;  5B1M A;  4AWL B;  3LR0 A;  3B33 A;  1RCJ A;  5DTK A;  5G18 A;  1P3I D;  4OLG A;  3N3F A;  1HQ3 D;  5CPK C;  5EUA A;  3P7N A;  1P3B D;  3ZG5 A;  5AV8 C;  3H7W B;  2CV5 B;  3DTM A;  3IH9 A;  4GHA A;  3ZVW A;  5GSU A;  1ID3 A;  3Q7V A;  4B4X A;  3NJA A;  4HGA B;  4JGR A;  4WEK A;  4E3J A;  5EVI A;  2ZJ9 A;  5B32 D;  3NDE A;  3PBO A;  2EXB A;  3AV2 B;  2FJ7 C;  2J3W A;  3WTP C;  3T4L A;  3LZ0 A;  5HWT A;  3MVD A;  3OPP A;  3SH9 A;  3KXB D;  4KHA B;  3MZF A;  1CXW A;  1G6A A;  3AV1 C;  3IWQ A;  5M1A A;  5BNX A;  2XSS A;  3AGE A;  1G28 A;  2QHK A;  4U0T A;  3AZN C;  1L6J A;  2G2W A;  4BBU A;  2ZC3 B;  4EQI A;  3T4T A;  4UHU A;  1VB6 A;  2WGW B;  3VH5 W;  3W99 B;  1ULY A;  5B0Z A;  3UT9 C;  1YU2 A;  4H6J B;  2F8N K;  4EO5 B;  3AZE C;  2HJ9 C;  1MY8 A;  5CER A;  2JKR I;  3OOV A;  1SCW A;  3G35 A;  4GD8 A;  2V1A A;  2Z6C A;  1U35 C;  4KZ5 A;  1IYO A;  3ZCZ A;  4DJ2 A;  2VEA A;  4CPK A;  3TU4 D;  3AZJ A;  1KX3 A;  1D06 A;  2QJ5 A;  1KVL A;  5B1M D;  3LJA A;  3UMD A;  3LR3 A;  4ZUX C;  5G49 B;  3CUE C;  3B0C T;  4JKT A;  1FIL A;  3W97 C;  3MNN A;  4X56 A;  3MGQ B;  1VM1 A;  2BYM A;  4Z2K A;  2Y59 A;  3IX3 A;  4YM6 B;  1CEF A;  1P3I C;  1M18 B;  5B2I D;  1P3L B;  1N1J B;  4CQH A;  2NZD B;  5GSU D;  1ID3 D;  1P3B C;  2Y2L A;  4J8X A;  5GLD A;  1SKO B;  4X25 A;  3N8L A;  5EVI D;  5IT5 A;  3HUN A;  5M19 A;  5E2E A;  3R4K A;  1W5D A;  3ITB A;  2QJ7 A;  4EXO A;  5HX9 A;  1KS0 A;  1PZO A;  3BY8 A;  2V1Z A;  3O88 A;  3T1S A;  3AZG B;  4HHD A;  4H9O B;  5B32 C;  3LZ0 D;  3H0M C;  1W2E A;  3NUL A;  2XH9 A;  3MVD D;  2VZW A;  3ZQ5 A;  3ZHH A;  5B33 A;  2ZQ8 A;  5GT0 B;  3E4P A;  3NCK A;  3O87 A;  3A1K A;  1XJ4 A;  4QNL A;  3KXB C;  2LB5 A;  3PYP A;  3B6F B;  4KUD D;  1W7F A;  2WAD A;  1H8Y A;  5B0Z D;  3IX4 A;  3K2N A;  5CPI A;  4LD9 B;  1FIK A;  1ZHH B;  3BLM A;  1K57 C;  1VQQ A;  5AVB D;  1MXO A;  2YFV B;  4MCW A;  1YPR A;  1L0D A;  4UUZ A;  4R0Q A;  3WAA A;  3LUQ A;  1F98 A;  4Y0O A;  3WRT A;  1WE4 A;  2X01 A;  3G30 A;  2HDR A;  2NQB B;  3TRC A;  2W1T A;  3LID A;  4EBL A;  3AZJ D;  1VEU B;  3BM6 A;  3GMW A;  1KX3 D;  3MGS C;  4ESP A;  3LFV A;  4HEF A;  3LJA D;  4G3V A;  3MQ0 A;  3TW8 A;  2UWX A;  4JLF A;  3ZDJ A;  3TU4 C;  3PR6 A;  4P6B A;  3X1U A;  1XJ2 A;  4JPM A;  1PW8 A;  5HAR A;  3KWQ D;  4KZ6 A;  4KEN B;  4M6B A;  4ZBJ C;  2BG1 A;  4KG2 A;  1DP9 A;  3REK A;  3MZD A;  1GHM A;  3KYQ A;  4NXG A;  1K0K A;  4X68 A;  5B0Y B;  3EEA A;  3UE6 A;  5AVF A;  4LLO B;  5B2I C;  4OJ5 A;  1N4O A;  3L9K A;  3S1Y A;  5GSU C;  1ID3 C; 
#chains in the Genus database with same CATH homology
 1A7W A;  3X1S B;  2F8N G;  1P3F B;  2J8Y A;  5EVI C;  3S4X A;  1YU4 A;  4IJF A;  1RGY A;  5HL1 A;  2CV5 A;  4WU9 B;  5B33 D;  4KGC B;  3LZ0 C;  1H3O B;  3MVD C;  3X1V B;  4S2L A;  3AZM A;  5GHZ A;  3AV2 A;  3C1B B;  3VMA A;  5AV5 B;  5E43 A;  4KUD C;  1IEL A;  5B0Z C;  2FFY A;  3WAA D;  4KHA A;  3W98 B;  3C1C B;  5B24 D;  1O7E A;  5F1F A;  5DTS A;  5AVB C;  2WGW A;  2OSU A;  1F1E A;  3W99 A;  4RX2 A;  2Y2I A;  3ZG7 B;  1P3A B;  4WBG A;  1NRF A;  4WYY A;  3AZJ C;  3X1U D;  1L2S A;  1KX3 C;  1BH8 B;  3LJA C;  5DF9 A;  4J8V B;  3A1I A;  3KWQ C;  1Y54 A;  4YS3 D;  1M1A B;  2HP6 A;  2IO5 C;  3Q82 A;  5G49 A;  5DNN B;  3UTB D;  2H5S A;  3MGQ A;  1BUL A;  4YM6 A;  1IKI A;  4E3O A;  2CV5 D;  3OPL A;  1M18 A;  3AZK B;  1W79 A;  1P3L A;  1N1J A;  2NZD A;  5FDH A;  2Z2L B;  2DCF A;  4XUZ A;  4RYE A;  3HLF A;  4GKU A;  5BO0 B;  4J8U B;  3SS3 A;  4PM8 A;  5E5A B;  5B33 C;  3L25 A;  4MBK A;  3P98 A;  1YLZ A;  1WWS A;  2LY8 A;  1ZKJ A;  3AZG A;  4JXV A;  1L0G A;  4H9O A;  1KGF A;  5GXQ B;  4R3J A;  1MPL A;  4E44 A;  3UPO A;  4QY6 A;  1HZO A;  4H9P B;  5GT0 A;  1Q9C A;  1IEM A;  3WKJ B;  3NQJ B;  1H5X A;  5FQM A;  3MFD A;  3B6F A;  5B24 C;  1PWC A;  3W99 D;  1IKG A;  4LD9 A;  4S2N C;  2YFV A;  4LV1 A;  3OCN A;  3N8S A;  1PI5 A;  3EPK A;  3V50 A;  2HIO B;  3AGF A;  3D4F A;  1JWP A;  3ZNY A;  3X1U C;  3O62 B;  2NQB A;  1P3P D;  2WAF A;  4OKP A;  1ONG A;  1RGZ A;  3MGP D;  3B6G B;  3C4P A;  4Z2M G;  4OQH A;  4YS3 C;  2JCH A;  4AWL C;  4YM6 D;  3HLW A;  1M18 D;  1P3L D;  2NZD D;  3UTB C;  4LEN A;  4J8W B;  5B0Y A;  5B2J B;  2CV5 C;  2QMI A;  5FUG B;  3WS2 A;  4XUJ A;  3X1S A;  1P3F A;  4HGA C;  3HVF A;  2HP9 A;  3AZG D;  3AZH B;  2F8N B;  4KZ9 A;  1RP5 A;  3HLC A;  2XK1 A;  3RJU A;  3MXR A;  5FQ9 A;  4WU9 A;  4E3N A;  4KGC A;  1WYB A;  2JC7 A;  2Y2P A;  1H3O A;  3KUY D;  3X1V A;  3AZF B;  4R8P D;  3B6F D;  3W96 B;  3C1B A;  2ZM0 A;  3AYW B;  1K55 A;  1KX4 D;  4IED A;  5AV5 A;  2F8N H;  1ZLA B;  4LD9 D;  1I2S A;  2PU2 A;  4JF4 A;  4LV3 A;  2XD5 A;  3IHB A;  3W99 C;  3NQU B;  3W98 A;  3C1C A;  1TVF A;  3O3V A;  4X55 A;  5B31 G;  4K0W A;  2NQB D;  2VGK A;  5AV9 B;  3VFH A;  4N92 A;  3AFA D;  3SS5 A;  1TEM A;  1P3P C;  2E8I A;  2ZC4 B;  1P3A A;  3MGP C;  2PU4 A;  1BH8 A;  3E2K A;  2HUE B;  1EWZ A;  2C6W B;  1LHY A;  1WYC A;  4IVI A;  4J8V A;  4B88 A;  5GLC A;  4WJ3 C;  1W8Y A;  5B0Y D;  4YM6 C;  3UDF A;  4QHC A;  1M1A A;  4IBI A;  2EX9 A;  2NZD C;  3CJM A;  1P3F D;  5DNN A;  3WX7 A;  3IXH A;  3N8R A;  2DQN C;  4PM6 A;  5B40 B;  4OUI A;  3AZK A;  4X6T A;  4WU9 D;  3AZG C;  4R4S A;  3GRJ A;  3M2J A;  1YMX A;  3AL0 C;  5CP6 B;  5BO0 A;  1JTG A;  4J8U A;  2Y91 A;  3A3F A;  5E5A A;  5L2F A;  3C1B D;  2XLN A;  1C3B A;  1BLC A;  3FKW A;  3KUY C;  2R9W A;  4E3K A;  5AV5 D;  3LO7 A;  5GXQ A;  1ES3 A;  3V5M A;  4R8P C;  3B6F C;  4Z66 D;  1FR1 A;  5FAO A;  5F83 A;  4FSF A;  1KX4 C;  3W98 D;  3Q7Z A;  4H9P A;  4LD9 C;  4X69 A;  3WKJ A;  1GCE A;  3NQJ A;  4WZS B;  5AQA A;  4WU8 D;  3A3I A;  3LEL D;  4BL3 A;  1F66 B;  4ZDX A;  3A6N B;  2NQB C;  4NE3 A;  2WK0 A;  4E6W A;  1P3A D;  5CPJ D;  4OOM A;  3KS8 A;  3N6I A;  1LI9 A;  3AFA C;  1FOF A;  1QMF A;  2HIO A;  3BFF A;  4DE3 A;  5A92 A;  3O62 A;  4DRT A;  1MWT A;  1CEG A;  3B6G A;  3AZL D;  1GA9 A;  4X23 B;  5KSH A;  5DNN D;  1E4D A;  4IBE A;  4UPK A;  3GTC A;  4OH0 A;  1YLP A;  4DQY B;  4D2O A;  4OJP A;  1P3F C;  3AZK D;  1Q2P A;  5A90 A;  3HLG A;  1P3K D;  4J8W A;  3AZM B;  3IT9 A;  1ZG4 A;  5B2J A;  1ALQ A;  4IBK A;  3A3J A;  4H9R B;  4J8U D;  2IOU A;  4RX3 A;  3L26 A;  4WU9 C;  5E5A D;  5FUG A;  3IQA A;  4Z2M H;  5JA4 A;  4GB7 A;  4WEL A;  5AQ7 A;  3AZH A;  5GLB A;  5GXQ D;  2F8N A;  1XA7 A;  3C1B C;  3BFG A;  3W8K A;  3HLB A;  1S32 B;  5CTN A;  5CXW A;  5BS7 C;  1DY6 A;  5AV5 C;  3NC8 A;  3WKJ D;  4Z66 C;  3AZF A;  1XKZ A;  3WS4 A;  3DW0 A;  3W98 C;  3W96 A;  5CHU A;  3FYZ A;  3AYW A;  4PM5 A;  4WU8 C;  3MGR D;  1ZLA A;  3LEL C;  5TGF A;  4GH9 A;  1P3O D;  2H10 A;  3NQU A;  3ZFZ A;  5GT3 D;  3REJ C;  3IWO A;  2HIO D;  1CK3 A;  4E3M A;  1P3A C;  5CPJ C;  3O62 D;  1KE0 A;  2HP5 A;  5AV9 A;  3PBR A;  3IP4 C;  5B31 B;  4QD4 A;  3FWL A;  3UN7 A;  5CGX A;  3HLD A;  2QZ6 A;  4E45 A;  3V3R A;  1ES5 A;  5BOH A;  4EUZ A;  3V9R B;  3HON A;  2G2U A;  3FKV A;  1XX2 A;  3AZL C;  1HQ3 C;  1E3U A;  5DNN C;  4JXG A;  4G92 B;  3B0D B;  3WS0 A;  1AXB A;  3VH5 A;  4J8W D;  1MWR A;  5B2J D;  2XFS A;  3AZK C;  3VFF A;  1P3K C;  1T3U A;  1K25 A;  2H0Y A;  1JTD A;  3PBT A;  4J8U C;  2VGJ A;  3AZH D;  2F8N D;  2V20 A;  5B40 A;  3LEZ A;  2CWE A;  1N9B A;  1GA0 A;  2ZM8 A;  2XGN A;  5FSR A;  2RVQ D;  5GXQ C;  1DJC A;  1Z6F A;  5CP6 A;  3HUM A;  4DE0 A;  5FI6 A;  3AZF D;  2EX2 A;  1KE3 A;  3W96 D;  1ERO A;  3AYW D;  3CMZ A;  2Z2M B;  3AGD A;  1ZLA D;  4LV0 A;  3L27 A;  4QY5 A;  3MGR C;  5DVA A;  3SH7 A;  2JE5 A;  3IF6 B;  2G5H C;  1P3O C;  5AV9 D;  5GT3 C;  3W4O A;  4DKI A;  2ZC6 B;  2HIO C;  1F66 A;  1YLT A;  3UO9 A;  1KX5 B;  2Y2Q A;  4G91 C;  2ZC5 B;  3A6N A;  3O62 C;  3A3E A;  5GHY A;  4EWF A;  3MNN D;  5B1M C;  3W4Q A;  1B67 A;  1BT5 A;  3EG5 B;  4QB8 A;  3BRM A;  4NE5 A;  4FH4 A;  4XUX A;  3VP0 A;  4J8X D;  4ID4 A;  2ZD8 A;  4K91 A;  3TOI A;  3WA9 B;  4XUJ B;  3UPP A;  4J8W C;  4DDS A;  1ESI A;  4BL2 A;  4X23 A;  4H9S A;  5B2J C;  1M40 A;  5CHM A;  1HTA A;  3QHY A;  3ZG8 B;  4WZ4 A;  3VH6 A;  5EE8 A;  5CPK B;  3LY4 A;  5AV8 B;  3AZH C;  4OPQ A;  1K54 A;  4NZ5 A;  1EQZ B;  2ZQ9 A;  1XXM A;  2ZY4 A;  4H9R A;  3R45 B;  4JBF A;  2P74 A;  3PBQ A;  4OPR A;  1FR6 A;  2IWB A;  2RVQ C;  5CPI D;  3UY6 A;  2EFU A;  5FAT A;  3AZF C;  2FJ7 B;  2WGI A;  3IWI A;  4WMC A;  3IXG A;  4KG6 A;  5GL9 A;  3W96 C;  2ZM5 A;  1YM1 A;  3AYW C;  1S32 A;  4B4Z A;  3B0B A;  1ZLA C;  4PPR A;  4DXC A;  2H0T A;  3H0L C;  3PAE A;  1LLB A;  3HUO A;  2DF4 C;  1F66 D;  3NY4 A;  3AZN B;  3BLS A;  4O7D A;  1BFM A;  5AV9 C;  2HDS A;  3OZH A;  4NZ3 A;  3UT9 B;  3HLE A;  2PYO B;  4PM7 A;  3AZE B;  2IWD A;  4IBC A;  5M18 A;  5A91 A;  5JRG B;  3REK D;  4KZA A;  3MNN C;  5FAS A;  2L5A A;  1U35 B;  5B31 A;  2HUE C;  1SHV A;  2I72 A;  4E3L A;  5DNM B;  4J8X C;  2ZQ7 A;  1HD8 A;  3V9R A;  4X23 D;  5HFO A;  5BNV B;  3W97 B;  4QU3 A;  4WM9 A;  4KZB A;  1DJA A;  4EBP A;  1L0E A;  1BLH A;  1P3I B;  3KFU G;  1ERQ A;  3AZM D;  3W4P A;  1P3B B;  3AV2 D;  3SOI A;  3HBR A;  1O07 A;  1YU1 A;  1FCO A;  4K0X A;  1SDN A;  5CPI C;  3LY3 A;  1S32 D;  3WTP E;  1TDL A;  4NE6 A;  2OV5 A;  3WAA C;  1JWZ A;  1ONH A;  2W8S A;  3KXB B;  4UA6 A;  1PI4 A;  4NET A;  5CTM A;  1L0F A;  3G2Z A;  3LZ1 B;  3REL B;  3KSY A;  1F66 C;  1QME A;  1K4F A;  3N4I A;  1MKI A;  4GD6 A;  4CJN A;  3IF6 A;  4YIN A;  4LCM A;  5FI7 A;  5F82 A;  3REK C;  3L29 A;  1KX5 A;  3VP2 A;  3H0R C;  5AVC B;  4XXR A;  3MGS B;  3LCE A;  1DJB A;  3MGQ D;  3UNW A;  3ZG9 B;  4GNU A;  3TU4 B;  5EOO A;  2ZC7 A;  3EQV A;  1YLJ A;  2XFT A;  1WWI A;  4X23 C;  4H9S C;  3HRE A;  1ES4 A;  4Z9Q A;  3UDI A;  3WA9 A;  3IH8 A;  3REH B;  5JA4 B;  4IBB A;  1M19 B;  3GR2 A;  4BEN A;  3AZM C;  5B2I B;  1NXY A;  4ZJ3 A;  4Q8I A;  2Q9N A;  3AV2 C;  3BFC A;  3ZNT A;  5A93 A;  5KDM B;  1PZR A;  5AY8 B;  5CPK A;  1YMS A;  5GT0 D;  4S2I A;  5AV8 A;  1K6S A;  1BUE A;  3DWZ A;  5BT1 D;  1EQZ A;  5F1G A;  5TFQ A;  3G2Y A;  1S32 C;  4OPY A;  3R45 A;  4CSR B;  1PWD A;  2ZQC A;  4GN2 A;  2F2A C;  2BLS A;  3G32 A;  2FJ7 A;  4LG2 A;  2J9P A;  4OQ0 A;  3V39 A;  4H9N B;  4ZJ2 A;  4KUD B;  4EO5 C;  3OPR A;  5FQI A;  2Y55 A;  3PBS A;  3CZD A;  4OPZ A;  1BLP A;  4DF6 A;  5AVB B;  4WZ5 A;  1KX5 D;  1FSW A;  2FFF B;  5DF8 A;  3AZN A;  4E3I A;  3UT9 A;  2PYO A;  3VP3 A;  5B1L B;  3REI B;  3AZE A;  5JRG A;  1KVM A;  3MGQ C;  3NDG A;  4NYY A;  2Y2O A;  1U35 A;  1M18 C;  1IYQ A;  3WA9 D;  1P3L C;  3KWQ B;  5DNM A;  4XUJ D;  3X1S D;  4G92 C;  3OC2 A;  4BQM A;  3VSL A;  2EX8 A;  4S2K A;  5J8X A;  5E2H A;  1NYY A;  4HBT A;  3M2K A;  2EX6 A;  1XPB A;  2WYX A;  5BNV A;  5CPK D;  4KGC D;  3W97 A;  1PWG A;  4JF5 A;  5CED A;  3WWX A;  1P3I A;  5FQK A;  3X1V D;  4PM9 A;  2WKE A;  1EQZ D;  3I7J A;  3IHA A;  1P3B A;  5GT0 C;  1CI9 A;  5BT1 C;  1ERM A;  2PBY A;  4IBJ A;  4NZ4 A;  2HPB A;  4BJP A;  1BH9 B;  3C1C D;  3UPN A;  5E2G A;  2WKH A;  4NZ1 A;  1BSG A;  2ZY3 A;  4S2J A;  3Q1F A;  1TZY B;  4N9L A;  3WRZ A;  1YLY A;  1ESU A;  4ZJ1 A;  2ZY5 A;  1FCM A;  3KXB A;  5IHV A;  5B24 B;  3LZ1 A;  4HES A;  4IBD A;  3REL A;  1G68 A;  1KX5 C;  2PYO D;  3NBL A;  1LL5 A;  4H8R A;  1K57 A;  3G31 A;  4J8V D;  5JRG D;  5F99 B;  1GHI A;  4XZQ B;  3AN2 B;  1YU0 A;  1M1A D;  4R1G A;  3UDX A;  3IXB A;  5DNM D;  5AVC A;  4OLD A;  4C6Y A;  5B0Y C;  5EEC A;  5CGW A;  3MGS A;  4GHL A;  1J9M A;  2ZM2 A;  3WA9 C;  1W8Q A;  4NK3 A;  3TU4 A;  4XUJ C;  3X1S C;  2J9O A;  3F6T A;  4YS3 B;  4MBF A;  3VP4 A;  5JYO A;  5AV6 B;  5I94 A;  1SKF A;  2J7V A;  3UTB B;  4KGC C;  4OP5 A;  1TAF B;  4EV4 A;  3REH A;  5DF7 A;  1M19 A;  2P9V B;  3X1V C;  1KDS A;  5B2I A;  1EQZ C;  2ZQA A;  1Z2C B;  2WUQ A;  2WAE A;  2Y4A A;  4OQI A;  5KDM A;  1K55 C;  5AY8 A;  1OME A;  1KGE A;  3EPJ A;  3TSG A;  1PYY A;  4KZ7 A;  2Y2K A;  1JWV A;  3X1T B;  1P3G B;  3C1C C;  3GQZ A;  1HVB A;  2WKI A;  4CSR A;  5CEC A;  2ARO B;  3QNC A;  2X71 A;  5EPH A;  2GDN A;  3AZI B;  3LZ1 D;  2R9X A;  2G5I C;  3ZGA B;  3REL D;  4WZ5 C;  4H9N A;  3S22 A;  2HDU A;  1ZC2 A;  4KZ3 A;  3EPL A;  4KUD A;  1KDW A;  5GLA A;  2PYO C;  1U60 A;  3DWK A;  4OJO A;  1M6K A;  2ZY2 A;  5AVB A;  3B6G D;  4J8V C;  5JRG C;  4JJN B;  4QLC B;  4P87 A;  5AVC D;  3MGS D;  1M1A C;  4U3T A;  4GZB A;  1P3P B;  1AOI B;  3P09 A;  5DNM C;  5B1L A;  2XQZ A;  3REI A;  3MGP B;  2WZX A;  4N1X A;  1NZO A;  2IWC A;  3FZC A;  2JBF A;  3KWQ A;  3REH D;  3NI9 A;  1M19 D;  3MXS A;  4WNN B;  5B32 G;  5E5A C;  1LI0 A;  5AY8 D;  5FA7 A;  3VOZ A;  4Y7P A;  3CG5 A;  1K38 A;  3L28 A;  4Y0T A;  3WS1 A;  3MKE A;  3FDD A;  4KZ8 A;  3IXD A;  4P0M A;  3MZE A;  3WKJ C;  4HBU A;  2Y2J A;  4EBN A;  1P34 B;  5FI2 A;  3KUY B;  1P3M B;  4C75 A;  1BH9 A;  2ZMA A;  1PW1 A;  4R8P B;  3NIA A;  3LZ1 C;  5DTT A;  3REL C;  1KX4 B;  4JF6 A;  1TZY A;  3FV7 A;  4OJ6 A;  1BZA A;  4YFM A;  4GOG A;  2BYK B;  1NJ4 A;  5B24 A;  1ZG6 A;  3VH6 W;  3UTA B;  3B6G C;  2Y2N A;  2ZLY A;  4BLM A;  5C3I B;  5B1L D;  5AVC C;  4DDY A;  4S2N A;  3REI D;  5U47 A;  1E3U D;  1S6R A;  5GHX A;  4RVA A;  5F99 A;  2XEP A;  4BD0 A;  3AFA B;  2DRW A;  1YT4 A;  4XZQ A;  3ITA A;  3AN2 A;  4GDB A;  3RXX A;  4Z5T B;  4R4R A;  2RL3 A;  1YU3 A;  1Q2Q A;  3GSG A;  5FQJ A;  1S0W A;  4S2O A;  5B40 D;  3VH5 T;  3C4O A;  3REH C;  2WGV A;  4YS3 A;  1M19 C;  3M6H A;  2OLV A;  4JXS A;  5AV6 A;  4L0L A;  3GVB A;  3OPH A;  5CP6 D;  3MKF A;  5AY8 C;  3Q07 A;  3UTB A;  1XA1 A;  1TAF A;  2WZZ A;  1R4V A;  2EXA A;  2P9V A;  3UE0 A;  3WTP B;  5CGS A;  3G4P A;  2V2F F;  4KQQ A;  3Q81 A;  5BPV A;  3N7W A;  1PZP A;  3WS5 A;  1KU5 A;  2CC1 A;  4N9K A;  4S2P A;  3AV1 B;  5AQ9 A;  3X1T A;  1NZU A;  1P3G A;  1YLW A;  1TZY D;  3OCL A;  3M6B A;  4FH2 A;  2ARO A;  1YUE A;  4Z66 B;  4H9Q B;  3A6N D;  1GHP A;  3AZI A;  5TR7 A;  1LL9 A;  4FD8 A;  4WU8 B;  2OLU A;  3LEL B;  5CHL B;  5F99 D;  3ZVT A;  4R3B A;  4U0X A;  3REJ B;  4XZQ D;  3AN2 D;  5B1L C;  3REI C;  1FCN A;  5CPJ B;  1EI5 A;  3KS4 A;  1NYM A;  4JJN A;  4DE2 A;  4QLC A;  3BYD A;  3PTE A;  2A3U A;  4RA7 A;  4ZAM A;  4ZUX B;  1I5Q A;  1P3P A;  4DRA A;  1AOI A;  5E2F A;  4OOY A;  1JFI B;  1NY0 A;  3MGP A;  3VOY A;  2J8P A;  5KZH A;  3AZL B;  5AV6 D;  5B40 C;  1IYP A;  2X02 A;  1HQ3 B;  2XR0 A;  3B3X A;  3VH6 T;  3BFE A;  5CP6 C;  4WNN A;  3ZG0 A;  4KZ4 A;  4DXB A;  5AQB A;  4WMC D;  1P3K B;  2ZQD A;  5B32 B;  4GDN A;  5D3O A;  5CHJ A;  3UE1 A;  4E6X A;  4JXW A;  3P5J B;  3E2L A;  5JYP A;  3X1T D;  1P3G D;  4ZTK A;  3RXW A;  4PMA A;  2EFX A;  1TDG A;  3MBZ A;  4NYU A;  2ARO D;  1MWS A;  1IYS A;  4UA9 A;  2HDQ A;  1KGG A;  2YFW B;  4LCL A;  4OVD A;  3AZI D;  1TZY C;  2Y2G A;  4ZBE A;  1P34 A;  2RCX A;  3KUY A;  3A6N C;  1P3M A;  5FAP A;  4R8P A;  3IF5 A;  3BEB A;  1FQG A;  1B6W A;  5B31 D;  1KX4 A;  3MGR B;  4OOL A;  4CAY B;  1P3O B;  5F99 C;  1ES2 A;  2A49 A;  4JJN D;  4FCF A;  4QLC D;  5GT3 B;  4XZQ C;  2BYK A;  4N1H A;  3AN2 C;  4G91 B;  3C7U A;  3UTA A;  1AOI D;  5B1M B;  4ZBJ B;  3AFA A;  4WEJ A;  2Q9M A;  2DNS A;  3VP1 A;  4IBG A;  3HSH A;  5KMW A;  1HTZ A;  4OP8 A;  2XF3 A;  3PBN A;  4Z5T A;  1K54 C;  4S2M A;  5AV6 C;  1MWU A;  4QJG A;  2JSS A;  5GSU B;  1ID3 B;  3Q7V B;  3UE3 A;  5EVI B;  1JVJ A;  5EOE A;  2B5R A;  3QNB A;  3LZ0 B;  2XDM A;  1BLS A;  3MVD B;  1XGI A;  2Y2M A;  2Y2H A;  3O86 A;  5HAP A;  4OQG A;  1YQS A;  3WTP A;  3X1T C;  5BNX B;  1P3G C;  5FQQ A;  1P34 D;  2ARO C;  1P3M D;  2XD1 A;  2RIQ A;  2C5W B;  1XGJ A;  5B0Z B;  3AZI C;  5EVL A;  1K6R A;  3AV1 A;  4F94 A;  5BS7 A;  4NY2 A;  4KQR A;  4NFT A;  4Z66 A;  4H9Q A;  4X53 A;  4KQO A;  4DE1 A;  5B31 C;  1BTL A;  4MBH A;  3EQU A;  4IBX A;  3UTA D;  3AZJ B;  4WU8 A;  4JJN C;  1KX3 B;  4QLC C;  3LEL A;  3GV9 A;  2VQR A;  3LJA B;  1K56 A;  4MLL A;  3REJ A;  1AOI C;  4LV2 A;  3EPH A;  3MNN B;  5HW3 A;  2BYM B;  5CPJ A;  4BD1 A;  1H8Z A;  1SDE A;  4M3K A;  3B0D C;  4UA7 A;  4Z5T D;  5CRF A;  2IO5 B;  4J8X B;  4ZUX A;  4MEZ A;  1I2W A;  4IJE A;  1JFI A;  4WV4 B;  4KG5 A;  5AV8 D;  3V3S A;  3AZL A;  4DRB A;  3TG9 A;  1KE4 A;  3G34 A;  1HQ3 A;  3PAG A;  4OJL A;  5B33 B;  5HAI A;  5FAQ A;  3FKE A;  3HL9 A;  4MNR A;  4P85 A;  1MBL A;  2FJ7 D;  3WTP D;  4IVK A;  1K4E A;  1P3K A;  1CI8 A;  4IBR A;  5B32 A;  2QPN A;  5KSC A;  4R23 A;  5CPI B;  5HAQ A;  3AV1 D;  1P34 C;  1P3M C;  4Y0U A;  3ISG A;  3IF6 C;  4UUZ B;  3AZN D;  3C7V A;  3WAA B;  3VSK A;  4IBF A;  3B0C W;  3BEC A;  2YFW A;  1XP4 A;  4OON A;  3UT9 D;  3BFD A;  3AZE D;  1K56 D;  1FSY A;  3UTA C;  1U35 D;  4C3Q A;  3MGR A;  5C3I C;  3X1U B;  3REJ D;  4CAY A;  1P3O A;  3L2A A;  5GT3 A;  3A3D A;  3REK B;  5CEB A;  3SS4 A;  4A5R A;  1PIO A;  4ZUX D;  3C5A A;  4UAA A;  4Z5T C;  1E25 A;  3JYI A;  3SH8 A;  3W97 D;  5B1M A;  4AWL B;  5DTK A;  1RCJ A;  5G18 A;  1P3I D;  4OLG A;  3N3F A;  1HQ3 D;  5CPK C;  5EUA A;  1P3B D;  3ZG5 A;  5AV8 C;  2CV5 B;  3DTM A;  3IH9 A;  4GHA A;  3ZVW A;  5GSU A;  1ID3 A;  3Q7V A;  4B4X A;  4HGA B;  4WEK A;  4E3J A;  5EVI A;  2ZJ9 A;  5B32 D;  3NDE A;  3PBO A;  2EXB A;  3AV2 B;  2FJ7 C;  3WTP C;  3LZ0 A;  3MVD A;  3OPP A;  3SH9 A;  3KXB D;  4KHA B;  3MZF A;  1G6A A;  3AV1 C;  3IWQ A;  5M1A A;  5BNX A;  3AGE A;  4U0T A;  3AZN C;  2G2W A;  2ZC3 B;  4EQI A;  4UHU A;  2WGW B;  3VH5 W;  3W99 B;  1ULY A;  5B0Z A;  3UT9 C;  1YU2 A;  2F8N K;  4EO5 B;  3AZE C;  1MY8 A;  5CER A;  1SCW A;  3G35 A;  4GD8 A;  1U35 C;  4KZ5 A;  1IYO A;  3ZCZ A;  4CPK A;  3TU4 D;  3AZJ A;  1KX3 A;  1KVL A;  5B1M D;  3LJA A;  4ZUX C;  5G49 B;  3B0C T;  4JKT A;  3W97 C;  3MNN A;  4X56 A;  3MGQ B;  2BYM A;  1VM1 A;  2Y59 A;  4YM6 B;  1CEF A;  1P3I C;  1M18 B;  5B2I D;  1P3L B;  1N1J B;  2NZD B;  5GSU D;  1ID3 D;  1P3B C;  2Y2L A;  4J8X A;  5GLD A;  3N8L A;  5EVI D;  3HUN A;  5M19 A;  5E2E A;  1W5D A;  3ITB A;  5HX9 A;  1PZO A;  2V1Z A;  3O88 A;  3AZG B;  4H9O B;  5B32 C;  3LZ0 D;  3H0M C;  1W2E A;  2XH9 A;  3MVD D;  3ZHH A;  5B33 A;  2ZQ8 A;  5GT0 B;  3NCK A;  3O87 A;  3A1K A;  4QNL A;  3KXB C;  3B6F B;  4KUD D;  1W7F A;  2WAD A;  1H8Y A;  5B0Z D;  5CPI A;  4LD9 B;  3BLM A;  1K57 C;  1VQQ A;  5AVB D;  1MXO A;  2YFV B;  1L0D A;  4UUZ A;  4R0Q A;  3WAA A;  4Y0O A;  3WRT A;  1WE4 A;  2X01 A;  3G30 A;  2HDR A;  2NQB B;  4EBL A;  3AZJ D;  3BM6 A;  3GMW A;  1KX3 D;  3MGS C;  4HEF A;  3LJA D;  2UWX A;  4JLF A;  3ZDJ A;  3TU4 C;  4P6B A;  3X1U A;  4JPM A;  1PW8 A;  5HAR A;  3KWQ D;  4KZ6 A;  4KEN B;  4M6B A;  4ZBJ C;  2BG1 A;  4KG2 A;  3REK A;  3MZD A;  1GHM A;  4X68 A;  5B0Y B;  5B2I C;  4OJ5 A;  1N4O A;  3S1Y A;  5GSU C;  1ID3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...