2Y2LA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e06)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
489
structure length
472
Chain Sequence
b'ISEITYSDGTVIASIESRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 162
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2lA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2lA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2lA02
3BLSA 3HL9A 4YINA 5DTSA 1RCJA 5CHUA 4QU3A 4KZ7A 2Q9NA 2DCFA 1M40A 3IF6A 2RL3A 5CTNA 2ZC5B 1TDLA 3C7VA 4P0MA 3S1YA 1Q2PA 2ZQCA 5FQQA 5CTMA 3OCNA 4DDSA 3FV7A 3FYZA 4DXCA 3VOYA 2P9VA 2J7VA 2XGNA 1ESIA 4P87A 1I5QA 4HESA 5AQAA 1NY0A 4O7DA 1E4DA 1GHIA 5F1GA 2XFSA 5GLCA 3OPHA 3V5MA 5CERA 1C3BA 4N1HA 5FDHA 4DE0A 1K57A 5GLAA 3VP3A 4IVIA 4RVAA 1ERMA 1GCEA 3IHAA 3MFDA 4K91A 4E6WA 4MEZA 1LL9A 4NK3A 5HARA 2Z2LB 4WMCD 3A3DA 3WS4A 1JTDA 2ZQ8A 5EPHA 3M6BA 3W4OA 3ITBA 4R0QA 1HTZA 3IWQA 4LV0A 1FSYA 4JXGA 4OVDA 3QNCA 4E6XA 4S2JA 3IQAA 3DTMA 3HVFA 2WAEA 1QMEA 4OKPA 5TFQA 3VP2A 3MZFA 1QMFA 3ZG7B 2Y2MA 5HAPA 1N4OA 4MBFA 4OLGA 2RCXA 3HUOA 4GKUA 4KG6A 3WS2A 5EUAA 3NC8A 1K38A 3UE3A 4OOMA 2FFYA 4GDNA 1IYSA 1W5DA 4R4RA 1RGZA 2V2FF 5CGWA 3ZG9B 3G4PA 1PWGA 4XUXA 4KZ3A 4N1XA 1MKIA 3VP4A 5BOHA 4R23A 4OP8A 1K56A 2H0YA 3G2YA 3ZGAB 1PW1A 2CC1A 3CG5A 3G31A 4EUZA 4Y0TA 4OQ0A 1BLSA 3IHBA 4XXRA 4OPYA 1NYMA 4E3OA 4WZ5C 4E3LA 1E25A 1YT4A 4R4SA 2WKHA 4ZAMA 3PAGA 1N9BA 5EVIB 1GHMA 3G32A 4PMAA 1KGEA 3GV9A 4QY5A 4RA7A 3LY4A 3TSGA 3WS0A 1MXOA 3N4IA 3OC2A 2Y4AA 1SCWA 5FAQA 4ZDXA 5KSCA 4JLFA 1IELA 3D4FA 2IWDA 3N6IA 3PAEA 2Y2LA 3E2LA 2Y59A 1L0EA 5GLDA 5GLBA 4E3KA 3BFFA 4OOYA 1K6RA 5CXWA 3SS5A 4C6YA 5CEBA 5I94A 2Y2NA 1O07A 1PZOA 4KQRA 1KVMA 2OLVA 4MNRA 1K54C 1WYCA 3C5AA 3HLEA 4X55A 5D3OA 3TOIA 3I7JA 1WE4A 5EVIA 3W8KA 3HLWA 4DE1A 3IWIA 1XP4A 3VFFA 2JCHA 1FR1A 4MLLA 5CECA 1JWPA 3HUNA 3C7UA 3UE1A 2Y2GA 4OP5A 1IYQA 4X68A 2EX2A 4E3NA 3IH8A 4KQOA 4OPZA 4JPMA 4P85A 5GHYA 4C75A 4DF6A 1XA1A 4PM5A 5M18A 3WRZA 2ZC3B 2B5RA 4OQIA 3ZHHA 2ZJ9A 2VGJA 4U3TA 5G18A 3P09A 4L0LA 5EVLA 1NZOA 3FKWA 2R9XA 1K55C 1O7EA 5FI6A 4S2KA 5HL1A 3LEZA 3UE0A 3AGDA 2A3UA 4PM8A 1EWZA 2HDUA 3O87A 3FWLA 1LHYA 1BZAA 1ZC2A 4IBRA 3IXHA 3O86A 3MXRA 1W7FA 3Q07A 4RX3A 1S6RA 5DTKA 5CHJA 4R3JA 3G34A 3A3EA 3IF6C 4Y7PA 3WWXA 1CEFA 2ZQAA 4RYEA 3TG9A 5CEDA 4S2IA 3PTEA 1BTLA 1KVLA 4OPQA 3GTCA 1YMSA 3ZVWA 1NYYA 1Y54A 2WK0A 3LY3A 4GD6A 2ZQ7A 3EQUA 2XLNA 2Y2JA 5A91A 1JVJA 4XUZA 4JF4A 4KZ4A 4EWFA 2WGVA 2ZQ9A 3WS5A 3QHYA 2X71A 2ZMAA 1XKZA 3A3FA 3UDFA 1KDWA 5CGXA 4NETA 4DE3A 1MY8A 1W8YA 1PZPA 2EX8A 2WKIA 4LCLA 3UPPA 4A5RA 4RX2A 3V3SA 3GVBA 1WYBA 3IXDA 3NI9A 3UPNA 5FQMA 1ZG6A 3N8RA 4WMCA 2ZM2A 4WYYA 5F82A 4B4XA 3B3XA 1BSGA 4FH2A 3PBTA 1DY6A 5E43A 1NJ4A 1DJBA 3N8SA 4N9LA 5E2HA 4Q8IA 4S2PA 3ZDJA 2HP5A 2Y2QA 5FQIA 2HDQA 3RJUA 3OZHA 1VQQA 2WYXA 4IBXA 4ID4A 2XK1A 2C6WB 3UNWA 3UY6A 1YLWA 2C5WB 2HP9A 3OPRA 4BL2A 3BM6A 1LL5A 4GD8A 2UWXA 4CJNA 5FASA 4OPRA 3IT9A 4BQMA 5FQ9A 1L2SA 1DJCA 4UAAA 2Z2MB 1L0DA 1W8QA 4DKIA 2WAFA 2EX6A 5FAPA 3SH8A 2OLUA 1E3UA 1VM1A 3HBRA 2EXBA 4ZJ3A 5L2FA 1ES3A 2XQZA 3O3VA 2IWCA 2R9WA 3EQVA 4IEDA 3Q7VB 4JKTA 3RXXA 1J9MA 3SH9A 3VSKA 5GHXA 3MZEA 3LO7A 1PYYA 4PM6A 4LV3A 1MWRA 5A90A 1NRFA 3N8LA 4HEFA 4OH0A 1XGJA 1ES5A 1PI4A 1FCNA 4HBTA 5EOOA 4S2OA 3HLFA 5GHZA 4C3QA 1BT5A 3IF5A 3IXBA 2ZQDA 3N7WA 3CJMA 5IHVA 3VOZA 3MBZA 4UA6A 1FCMA 1NZUA 1BLCA 2J8YA 4Y0UA 2Y91A 5HFOA 2QPNA 1G68A 1ONGA 1U60A 1YQSA 1W79A 4H8RA 2Y2IA 1K25A 1SDNA 5E2EA 4BD1A 4KENB 3GRJA 4QD4A 5FI2A 4QB8A 4GDBA 4OLDA 5U47A 4DE2A 3BYDA 5JYOA 2WUQA 4F94A 4KQQA 1IKIA 4LENA 4S2NA 2ZD8A 4KG2A 4U0TA 5GL9A 4BL3A 5M19A 3GQZA 4X6TA 1GA0A 4HBUA 1GA9A 1HZOA 3A3JA 5TGFA 3V50A 2P74A 5A93A 3JYIA 3ISGA 1BLHA 1H8YA 5F1FA 1NXYA 2H5SA 4Y0OA 2X01A 3HLDA 3OPPA 4BLMA 1Z6FA 1XPBA 3NDEA 1YLZA 5HAQA 3V3RA 4M3KA 1FOFA 3S4XA 2H0TA 5M1AA 3NBLA 2G2UA 2A49A 3UO9A 1AXBA 5JYPA 2DRWA 5E2FA 5AQ7A 4ZTKA 5EE8A 3Q7ZA 3HLBA 4OQGA 4S2MA 1G6AA 1GHPA 4OQHA 2EFXA 4MBHA 3ZFZA 5AQBA 2XDMA 2WGWB 3Q1FA 2E8IA 3BRMA 2XFTA 5A92A 2JE5A 3AGFA 3ITAA 4JXVA 1BUEA 4DRTA 2QZ6A 1HVBA 4WELA 1K6SA 4K0XA 1PIOA 4GOGA 2EXAA 4OONA 3A3IA 4LV1A 1KDSA 3BFEA 2ZC4B 1TVFA 3IF6B 3HREA 1RGYA 4FH4A 1ALQA 3M2KA 3ZVTA 4DDYA 4KZ6A 2IWBA 2P9VB 2ZLYA 4K0WA 4QJGA 2XEPA 4YFMA 1K57C 2WGWA 2BLSA 4JXWA 3VP0A 3PBQA 1JWVA 3NIAA 3WRTA 5KMWA 5HAIA 4JBFA 5J8XA 1IKGA 3M6HA 3MKFA 3UPOA 1HD8A 2V20A 1IEMA 4LV2A 3G2ZA 4QHCA 2Y2KA 1KGGA 1KGFA 1Q2QA 3S22A 3UN7A 1FR6A 3WS1A 1BULA 1ZG4A 1MWTA 4PM7A 4GB7A 3G35A 2OSUA 4KZ5A 4S2LA 3OCLA 2WZXA 1ZKJA 4JXSA 4KG5A 3W4PA 1BLPA 2HP6A 3AGEA 1EI5A 1PWCA 3C4OA 4BD0A 3RXWA 5F83A 2V1ZA 2XF3A 3FZCA 4R3BA 4ZJ1A 3NDGA 2Y2OA 2XR0A 3ZNTA 2HDSA 1YLPA 4WEKA 1YMXA 1K4EA 5FI7A 3OPLA 4KZAA 4KZBA 5DF7A 4P6BA 3VSLA 5FATA 2X02A 5TR7A 2EX9A 3UDIA 2BG1A 5FA7A 4JF6A 2JBFA 1MBLA 5KSHA 1FSWA 1MPLA 1JWZA 4PPRA 4UHUA 3GSGA 3O88A 5FQJA 2WADA 3DW0A 4UA9A 4X56A 3DWZA 1RP5A 1SHVA 2XH9A 3CMZA 3M2JA 2OV5A 1LI9A 3QNBA 3DWKA 4UA7A 2ZM0A 1I2WA 2H10A 1SKFA 1IYPA 1S0WA 2VGKA 3GR2A 3UDXA 3IWOA 4E3MA 2ZM8A 4GNUA 1ONHA 2PU4A 3BECA 3Q7VA 1E3UD 1SDEA 3BFCA 2J9OA 3IXGA 2I72A 3BEBA 2XD5A 3C4PA 5DVAA 4WEJA 1ES4A 3VMAA 1OMEA 1XA7A 2HPBA 3ZG0A 4DXBA 3SOIA 5EVIC 4S2NC 4EBPA 2PBYA 5CGSA 1K56D 4FD8A 3GMWA 4MBKA 4N9KA 4ZBEA 1KE0A 1M6KA 3HUMA 4N92A 1LLBA 5EECA 3CZDA 1CK3A 1CI8A 2XD1A 1TDGA 4IVKA 4FCFA 3VP1A 4CPKA 4WZ5A 4Z9QA 1H5XA 3LCEA 2HDRA 3PBSA 1YM1A 3MXSA 3NCKA 1ESUA 3BFDA 2QMIA 3BFGA 4KZ8A 4D2OA 3G30A 2ZC7A 1CI9A 4WM9A 1PW8A 3SS4A 4EBNA 2WKEA 1XX2A 1KE3A 5AQ9A 4B4ZA 1YLJA 4WZ4A 1K4FA 2JC7A 1XXMA 5DTTA 4KZ9A 4ZJ2A 1XGIA 4LCMA 3HLCA 3ZG5A 2ZC6B 5CRFA 5EOEA 5EVID 1K54A 4GZBA 4GN2A 4X53A 5FQKA 1IYOA 3ZG8B 4B88A 2PU2A 3VFHA 4EV4A 1KE4A 1ES2A 4WBGA 3FKVA 3PBNA 1YLTA 3NY4A 1L0FA 1ERQA 1MWSA 2GDNA 1H8ZA 4OOLA 5DF8A 1YLYA 4X69A 3ZCZA 1FQGA 2Q9MA 1JTGA 3PBOA 5HX9A 3IH9A 3SS3A 1L0GA 1FCOA 3MZDA 4BJPA 3E2KA 5DF9A 3MKEA 1EROA 4FSFA 2Y55A 4PM9A 2DNSA 4R1GA 3W4QA 4EQIA 1I2SA 4QY6A 4U0XA 4JF5A 3ZNYA 2WZZA 2FFFB 1TEMA 3Q82A 1LI0A 1DJAA 2Y2PA 5HW3A 1PWDA 5E2GA 4E3JA 1MWUA 5FSRA 4BENA 3HLGA 1K55A 2J9PA 5FAOA 2G2WA 3V39A 3Q81A 4E3IA 3PBRA 1CEGA 3SH7A 3BLMA 4EBLA 3P98A 2WGIA 2Y2HA 5CHMA 5KZHA 2EFUA 1PI5A
chains in the Genus database with same CATH superfamily
1JFIA 1NRJA 3HL9A 4EO5C 4QU3A 2Q9NA 4Z2KA 5CTNA 4EEUA 3C7VA 3KXBC 5B2IC 5JRGA 3FYZA 3WAAD 4G91C 5GXQA 3AZFD 2P9VA 4J8XD 4HESA 5AQAA 5KDMB 1GHIA 5GLCA 2XSSA 3OPHA 3A0SA 3T4QA 5CERA 1C3BA 2KX6A 4N1HA 3VP3A 4IVIA 3QP2A 1ERMA 4RVAA 3MFDA 4BBTA 5HWWA 3C30A 3TU4C 2KOIA 2NZDD 3UT9C 3LIDA 5EPHA 4DMZA 3ITBA 3NHQA 5B0ZC 4J8WA 2BTFP 3AV2C 3DTMA 3HVFA 4OKPA 3R7WA 3KYZA 1QMFA 2Y2MA 3AZEA 3REJA 3X1SD 3W97A 4KGCC 1P3KB 3HUOA 3C38A 4GKUA 1TZYB 1K38A 3UE3A 2FFYA 1HQ3A 4ME4A 1W5DA 5CGWA 2V2FF 3G4PA 3EPHA 4XUXA 1ULYA 4Z5TD 3VP4A 1J7MA 3ZGAB 5F69A 3QP5A 2HIOB 4EUZA 2IOUA 3MGSB 3L29A 3IHBA 2W8SA 1M18C 1E25A 4YM6A 2WKHA 3PAGA 2RVQD 4MDZA 3GV9A 4PKYA 4ZDXA 2Y4AA 5FAQA 4JLFA 1IELA 3D4FA 3N6IA 2ZL1A 3PAEA 4Z1WA 2AROD 2PYOB 1L0EA 2QJ5A 3MJQA 5HD5A 1K6RA 4HQAA 4C6YA 2JSSA 1KVMA 1WYCA 3L27A 2ZM5A 5CP6D 5EVIA 5F99D 4DE1A 3MQLA 3WD3A 2VV6A 4WNNB 1P0ZA 2JCHA 3MGRC 1JWPA 3KUYB 3C7UA 3UE1A 2INWA 1GSXA 4X68A 2EX2A 4LRYC 5B33A 5DNNB 4KQOA 1P34B 4PM5A 3AZIA 3ZHHA 2ZJ9A 5G18A 3REKC 3EGDC 4IBKA 5HPIA 4L0LA 5EVLA 4OJLA 3FKWA 2R9XA 1KX4B 4XUJC 5KIZA 5HL1A 3UE0A 5IT5A 3WX7A 4CLCA 5AV9B 3O87A 1TS8A 4IBRA 3IXHA 3NOTC 4R70A 4RX3A 1S6RA 3PHYA 1P3OC 1CEFA 3KSHA 4S2IA 1P3GD 4ZBJB 3AZJC 1VETB 4O0PA 1Y54A 3LY3A 2WK0A 4GD6A 3LR4A 1U35C 3W98B 4JJNC 2PYPA 2WKPA 2ZQ7A 1EQZD 1S1ZA 4X1LA 1ZLAD 1P3MB 4JF4A 2W3GA 5B0YC 4LG2A 3AZNC 3MXQA 5AVBB 3BWLA 4I39A 4DE3A 1MY8A 1XJ2A 1MKMA 2VV7A 4F3LB 5GT0B 3UTAB 3NI9A 3WA9B 3N8RA 2ZM2A 5DNMD 1P3BB 2HF6A 2PT7A 4NG2A 5GSUA 3UE6A 1BSGA 2M1CA 2RIQA 4KHAA 1DJBA 3T4TA 4Q8IA 1M19B 2HP5A 3AFAD 3OZHA 3KXBA 4ID4A 2C6WB 4BL2A 3MNNA 3E4QA 5GT3D 5FASA 3QP4A 4BQMA 5FQ9A 3MVDC 2PDRA 4UAAA 1L0DA 3HJIA 5FAPA 3AYWC 3X1TC 3W2ZA 5L2FA 2W3FA 2XQZA 3O3VA 3R45A 2IWCA 2G5HC 3SH9A 2O9CA 5B32D 4J8UC 4Z66C 4HMDA 4OJPA 3TU4A 3N8LA 4HEFA 3REHC 4PHTA 1PI4A 1N1JB 1R4VA 1FCNA 1OJ5A 5B0ZA 3EPKA 2ZQDA 4ZUXC 5EM1A 3MBZA 1TAFA 3M7PA 2V8CA 4Y0UA 5HFOA 1PZRA 4KGCA 1OGBA 3T50A 3TJZC 4H8RA 4CSRA 1K25A 4UEYA 4X23D 5C3IB 3GRJA 1H8MA 4GDBA 3BYDA 1Q9CA 3AZGC 4F94A 1B6WA 4KQQA 4LENA 4BL3A 1ID3D 4IHQA 2PYOC 4BBUA 4L9FA 3BQ8A 5AV6B 2CV5A 1M18A 3A3JA 3V50A 2P74A 4WN5A 4KUDC 5F1FA 3HLDA 3B6FB 3IBJA 1P3PB 3E0YA 3LIEA 2GX5A 2FJ7B 5HAQA 1HLUP 1KX5B 2G2UA 3CI6A 5CHLB 4LD9C 4LFUA 2DRWA 3X1VB 3HLBA 4S2MA 5IU1A 1G6AA 2L1MA 3AZKD 5AY8C 5CPJB 1GOIA 1ZTUA 4MBHA 3OLOA 2WGWB 3Q1FA 1G5UA 3MGRA 4JGPA 2XFTA 3DTKA 3SZTA 1V9ZA 1BUEA 4DRTA 1W1VA 5HDCA 1HVBA 1K6SA 4TX8A 4OONA 3IS2B 3H0MC 1ED7A 4LV1A 1VHMA 3WD1A 2QHKA 3HREA 3LJAD 1S32A 5JRGB 5L10A 4DDYA 5I5LA 2IWBA 5AV8C 3A6NB 3AV1A 1BYWA 2P9VB 4ZBJC 4QJGA 2XEPA 3L2AA 4IBCA 4JXWA 3VP0A 1K0KA 3ULFA 3O62B 3WKJD 1DP8A 1IKGA 3M6HA 2Z6CA 4Q0IA 4R8PC 3UPOA 1HD8A 1IEMA 4M6BA 1Q2QA 1KGFA 1YU1A 3UN7A 1FR6A 4AWLB 1KX3C 3WS1A 3LYXA 3UTAC 1MWTA 1U35A 4H9NA 1M1AB 4JJNA 3G35A 2ZY3A 2WZXA 4JXSA 3KWQA 5CPKD 1EI5A 4YS3B 4BD0A 5B0YA 5AVCC 3GECA 5FEFA 3SW1A 2VGLM 4R3BA 3NDGA 2XR0A 3AZNA 3ZNTA 2HDSA 2HUEC 2PD7A 3AZEB 3REJB 3W97B 1P3FA 5FI7A 3MFXA 1HQ3B 5TR7A 5B1MC 5FA7A 4NZ1A 3F1OA 1P3LA 1FSWA 4PPRA 4UHUA 1UR9A 2A24A 3T1QB 1YPRA 3GSGA 5FQJA 2GZAA 3DW0A 3BW6A 2NQBA 5B31B 1IYPA 4J8VA 3IWOA 5J7EA 4NY2A 4Z2GA 4LPZA 3MVDA 1KS0A 3LUQA 3AN2B 3Q7VA 1E3UD 2ZL1B 3C4PA 1BH8A 5DVAA 4H6JA 1XA7A 2YFVA 2HPBA 3ZG0A 3SOIA 3IBRA 4EBPA 2BYKA 2L0WA 2PBYA 1F66C 2BASA 1K56D 2VA0A 4N9KA 4J8UA 4YWZA 1LLBA 2LY8A 1YU0A 4FTXA 5B24A 3REHA 1P3KD 5C3IC 1TZYD 3LZ0C 1KU5A 2WKRA 4WZ5A 1A7WA 4Z9QA 5AV5C 3LCEA 3R4KA 3IP4C 4ZUXA 3BFDA 4KZ8A 4QLCC 4WM9A 3SS4A 4DQYB 4B4ZA 2OAP1 2HIOD 3AZIB 1K4FA 3MGSD 3AZHC 5DTTA 3HLCA 3MGQA 1K54A 4GN2A 3CWFA 4B88A 3AZGA 4EV4A 5IS1A 4CLCB 5B1LB 3FKEA 1MWSA 4Z2HA 3IX8A 3ZCZA 2PYOD 5HX9A 3WAAC 3IH9A 1L0GA 3AZFC 4J8XC 4BJPA 4KUDA 4FSFA 2Y55A 4PM9A 3W4QA 4QY6A 3LELA 1YU4A 4KUKA 4E3JA 2AVXA 3KUYD 1H3QA 4EBLA 2NZDC 5AY8A 2WGIA 5DNND 1P34D 3D9YA 1P3IB 1GSVA 2VX8A 3BLSA 3VH5T 3UMEA 3QP6A 4DN0A 1L3LA 2RL3A 4NKPA 1TDLA 1Q2PA 2ZQCA 3A1IA 5GSUB 1KX4D 4DDSA 3FV7A 4ETXA 4KHAB 3X1SC 5AV9D 4FUWA 1E4DA 1VEUA 3MNNB 3C1CB 3LR5A 5FDHA 4DE0A 4Z5TC 4E6WA 3LZ1A 3VH6W 3W98D 5HARA 2Z2LB 3WS4A 2L4RA 4R8PA 1JTDA 3MR0A 4ZRRA 1P3MD 3EEAA 4HJ6A 2RVQC 4EEPA 2O0YA 5TBMA 5DFYA 4S2JA 5AVBD 3IQAA 1QMEA 3VP2A 5EVEA 5HPFA 5GT0D 3UTAD 4O01A 2AROC 3JPUA 5HAPA 1N4OA 2RCXA 1XJ6A 1B67A 3WA9D 2J3TD 3NC8A 5EUAA 1P3BD 1EAKA 3UTBB 3C1BB 3F1NB 1RGZA 4GHIA 5FEGA 5CP6C 4KZ3A 4N1XA 5B31C 5F99C 4R23A 1M19D 2H0YA 5B1MA 3G31A 4Y0TA 4MN7A 4YNRA 3W96B 4HH3A 1NYMA 4E3OA 4R4SA 3T4LA 4WU9B 1N9BA 1NWZA 1GHMA 5HD3A 4RA7A 3TSGA 4UUZA 3N4IA 3OC2A 2CV5B 3WD2A 1AOIB 3E2LA 2Y59A 4KUOA 1S66L 2ZBBA 3S7PA 1CQAA 3H0RC 5CXWA 2Y2NA 1PZOA 4X55A 1F2KA 4MNRA 3N3FA 3TOIA 3OOVA 1WE4A 3W8KA 3HLWA 1F66A 3W99A 3VFFA 4G3KA 1P3GC 1YSQA 1FR1A 2V0WA 4MLLA 3D3OA 1IFQA 2V0UA 1EQZC 4C75A 1ZLAC 3WRZA 4ESPA 1OT9A 4HMCA 4OQIA 4Y2FA 3P09A 1NZOA 2F8NK 2VV8A 2YFWB 1K55C 5FI6A 1XJ3A 3LEZA 3B33A 1S32B 1ZHHB 2VEAA 4PM8A 2PR6A 1EWZA 2HDUA 5AV6D 4IBIA 4GCZA 2P08A 1WWSA 3AV1B 3G34A 3A3EA 3IF6C 3KSGA 3TG9A 3B6FD 2O9AA 1P3PD 4OPQA 1BTLA 2FJ7D 3AFAC 3ZVWA 5AVEA 1KX5D 5TJJA 2XLNA 2JKRM 3NQUB 5GT3C 2Y2JA 5L09A 3RELA 3X1VD 3WTPB 4CAYB 1P3IC 2ZQ9A 4EWFA 5CPJD 3LEQA 2X71A 2ZMAA 1XKZA 5DJTA 1KDWA 5CGXA 4NETA 1YSPA 4HY8A 2EX8A 4RX2A 5B32C 3IXDA 2DQNC 3MQ0A 1ZG6A 2NZDA 1P3FB 1OTEA 4B4XA 1DY6A 4N9LA 3N8SA 3C1CC 2KDKA 5JRGD 2Y2QA 5FQIA 3U4LP 1VQQA 3A6ND 1P3LB 4NXEA 4GLQA 2A24B 2C5WB 1YLWA 4WLAA 4Y3IA 3BM6A 1LL5A 4CJNA 3X1SA 4OPRA 1DRMA 3O62D 1DJCA 4Y5FA 2NQBB 5G4YA 1W8QA 4DKIA 3A0VA 2EX6A 4X23C 1OTIA 4E45A 2EXBA 4J8VB 2GJ3A 4Z5TA 4MB5A 5BPVA 3EQVA 3Q7VB 3RXXA 5B40B 1J9MA 5GHXA 1ID3C 3MZEA 3LO7A 3MSHA 4PM6A 3CUEC 4EQ1A 1M1AD 2YFVB 2FH5A 1MWRA 2KLIA 4OH0A 2BYKB 3S7OA 4YS3D 1XGJA 1ES5A 2VKSA 5GHZA 3L25A 3IF5A 2QJ7A 4EESA 3N7WA 3TE8A 5IHVA 3AZED 5E5AB 3REJD 3W97D 5B24B 2J8YA 4IBEA 1OJGA 2QPNA 4I5SA 1HQ3D 3MGPA 1U60A 4MB4A 4BD1A 3WD0A 3AZKC 4QD4A 5HDDA 2V5OA 4QB8A 2ZY4A 5U47A 4G3WA 4DE2A 3T1SA 3REIA 5JYOA 2OWJA 5B31D 5B2JB 4U0TA 5GL9A 5HL6A 3MGQB 1GA9A 5A93A 3JYIA 1H8YA 3AN2D 2H28A 3LJAC 4BLMA 1Z6FA 2BYMB 3VH5A 3S4XA 3V9RB 2CMNA 1TS6A 4NZ4A 3E4PA 3H7WA 5M1AA 3NBLA 4IBGA 3BY9A 5BNVA 5E2FA 3PXPA 3MS6A 5EE8A 4WU8A 3WKJC 1STZA 4OQGA 3LELB 3K3DA 3FPWA 1P3GA 3AL0C 5EV0A 3BRMA 3EOIA 2JE5A 2JKFA 4GS9A 4JXVA 3MQQA 4XZQA 3B0DC 3LIAA 4L9GA 4WELA 3ZQ5A 5BO0A 5CPKC 1PIOA 4EU0A 4HGAC 2EXAA 3AZID 3A3IA 3BFEA 3B6GA 4FH4A 3M2KA 5FUGB 4KZ6A 3AZMA 1T3UA 2ZLYA 5CPIB 1P3AB 4CLCD 5B1LD 1CXWA 3KX0X 3PBQA 1VEUB 3KYQA 1N9LA 5HAIA 5DNMA 2P04A 3TW8A 2Y2KA 1V9YA 4LRZE 3LZ1B 3X1UB 1BULA 4HHDA 3AFAA 1ZG4A 3B0CW 3AZLB 3OCLA 1F1EA 3W4PA 1BLPA 5GT3A 3JVVA 5B2IA 5TBMB 3C4OA 3B42A 3RXWA 2V1ZA 2OOLA 4IUKA 4ZJ1A 2K31A 2Y2OA 1P3ID 1YMXA 5G49A 2IO5B 4NE6A 3DAVA 4P6BA 5GSUD 2EX9A 1H3OA 2BG1A 2VGLS 4JF6A 1MBLA 4HNBA 5KSHA 5LBRA 1P3KC 1BH9B 3P5JB 3UT9A 4KQDA 1OTDA 1TZYC 2XA7M 2EA9A 3UB5P 1RP5A 4YOFA 3MNND 4H9PA 1LI9A 3C1CD 2F8NA 2ZM0A 3AV2A 3UDXA 2ZM8A 2V8FA 4GNUA 2PU4A 3KO6A 3BECA 2HIOC 4UUZB 4ETZA 3BFCA 3MGSC 3IXGA 3BEBA 2XD5A 4S2NC 2V1AA 1ID3A 4ZBEA 1M6KA 3CUEA 4N92A 1E6RA 3W99B 1CK3A 1CI8A 2XD1A 1TDGA 3VP1A 3VH6A 4CPKA 2FZ0A 3UTBD 4NZ3A 3C1BD 5HDSA 3PBSA 2HDRA 3MXSA 3NCKA 1YKDA 3BFGA 3G30A 2WKEA 1XX2A 1KE3A 1BFMA 3KUYC 1YLJA 4Q0HA 4IJEA 3W96D 1XFQA 4GW9A 1H0IA 4KZ9A 3AZKA 5DNNC 1P34C 2ZC6B 4WU9D 5EOEA 4QWOA 3ZG8B 1PDCA 4B9OA 3NQJA 2ZY5A 4H9QA 1KE4A 3FKVA 3NY4A 3EGXC 2GDNA 1H8ZA 4OOLA 1AIWA 1AOID 4X69A 1KX4C 1LSWA 4Y17A 3MZDA 5AV9C 1JFIB 1P9RA 3LJAA 4JGRA 3HJKA 4LLOB 4M4XA 1I2SA 4U0XA 4JF5A 3ZNYA 1F9IA 5HW3A 3REKA 1PWDA 5E2GA 5FL3A 3UB7A 5GXQB 3RELB 4BENA 4XUJA 4RQ9A 3FPVA 3W98C 3A0RA 3PBRA 3T1XA 3SH7A 3BLMA 3LIBA 2Y2HA 1AWIA 2EFUA 4HH2A 1P3MC 4FOFA 1RCJA 5CHUA 4KZ7A 2DCFA 1M40A 1HTAA 1P3AC 1P3OA 4NYYA 4Z2JA 2ZC5B 1W2EA 5AVBC 2ZMVA 4P0MA 3S1YA 3OCNA 5GT0C 3AZJA 5CPKA 3VOYA 2J7VA 2XGNA 1ESIA 1S32D 4P87A 4BBVA 5DJUA 1NY0A 3WA9C 2J3TC 4O7DA 2XFSA 1P3BC 3AV1D 5F6AA 3V5MA 4J8WB 1UWPX 3R7WB 5GLAA 1IOUA 1M19C 1GCEA 2P7JA 4K91A 4MEZA 4GHAA 1LL9A 4NK3A 4WMCD 1LSVA 1H0MA 5BS7C 4R6LA 3WTPD 5KDMA 3CPTA 3IWQA 2EWVA 1FSYA 4E6XA 1T1CA 4OVDA 2WAEA 2CWEA 2YKHA 3ZG7B 4MBFA 4OLGA 4YM6B 5L07A 4GH9A 4GDNA 4R4RA 2DF4C 1P3FD 3ZG9B 1Z2CB 1PWGA 3AYWA 3X1TA 2K7SA 4OP8A 3MGPB 1K56A 3G2YA 1PW1A 3CG5A 1P3LD 4OQ0A 1BLSA 4Z2IA 4XXRA 3T4KA 4Z66A 4E3LA 3REIB 5HSQA 1TZYA 5EVIB 2NQBD 4AFIA 1XJ4A 4PMAA 1KGEA 4QY5A 1MXOA 3T4JA 4ARZA 5KSCA 1SCWA 4J8VD 2IWDA 2YKFA 2Y2LA 4G92B 1N9NA 5GLDA 5B40D 5B33B 4E3KA 3BFFA 3F1PA 2HIOA 4OOYA 5I94A 5AV6C 1KOUA 4KQRA 5D3OA 2DMWA 1P9WA 3IWIA 4IBBA 3B6FC 5BNVB 1XP4A 3JVUA 1P3PC 5CECA 2FJ7C 5E5AD 2FN2A 4WU8B 5B24D 1KX5C 4OP5A 2PYOA 1IYQA 2NUTC 4P85A 3UB9A 4DJ3A 4EW7A 4JGQA 2ZC3B 4IBJA 3X1VC 2JKTI 4GS9B 4MN5A 5DKLA 2QWSA 5CPJC 4X1MA 1J3WA 2VGJA 3EG5B 4XZQB 2W3EA 5BO0B 1UWNX 3LICA 4WNNA 1O7EA 1T18A 3B6GB 5B2JD 3CITA 2W0NA 2A3UA 5F68A 3MGQD 4LD9A 3AZMB 3O86A 3MXRA 1P34A 3Q07A 5CHJA 4R3JA 2UV0E 5CX7A 4Y7PA 3WWXA 2QYBA 2ZQAA 2XRNA 4O8GA 3PTEA 3NOPC 4NZ5A 5JRGC 1CK7A 1NYYA 3A6NC 1KX4A 3LIFA 2VZWA 1GSWA 1TS0A 4UQIM 5AV9A 4XUZA 3WTPE 4KZ4A 5C5KA 3O62C 4EO5B 2WGVA 4BMWA 5B31G 3LELD 3WS5A 1LL8A 3F6TA 4HOIA 3UDFA 3KXBB 5B2IB 2WKIA 4G91B 4AWLC 3V3SA 3GVBA 5AV8A 1MZUA 2D49A 2ZOIA 1VETA 3CLOA 3UPNA 5FQMA 1M1AC 3W98A 1WWIA 4QPRA 5G49B 4WYYA 3P7NA 4YS3C 1P3MA 1DP6A 3B3XA 3PBTA 3VOLA 1NJ4A 4S2PA 3ZDJA 1GXDA 3R45B 2W3DA 2HDQA 5AVBA 1KX3A 3AZEC 2WYXA 3REJC 2G5IC 3W97C 3TU4B 5CPID 5GT0A 1P3AD 3UTAA 3OPRA 2UWXA 3UT9B 3FDDA 1HQ3C 5J3WA 5EM0A 2Z2MB 3UB8A 2WAFA 2F8NB 5B0ZB 4EERA 1Z09A 5AVCA 1OTAA 2OLUA 3SH8A 3AV2B 1VM1A 3HBRA 1YU3A 3LZ1D 3BY8A 1TAFB 1ES3A 1M19A 3X1UD 1XFNA 4IEDA 2R9WA 4KGCB 1S4SA 3AZLD 4LV3A 3VV4A 4CSRB 4Q0JA 1NRFA 5A90A 4R38A 1D1JA 1TF1A 3AN2C 4S2OA 4C3QA 1BT5A 3CJMA 4WV4B 2Y8HA 2MJ6A 4UA6A 1NZUA 1BLCA 4MMNA 1M18B 1CF0A 1G68A 1ONGA 1W63M 1FILA 2PHYA 3FC7A 1N1JA 1W63Q 3KSIA 4QNLA 1N9OA 4IBDA 2Q0OA 2WUQA 1IKIA 4KG2A 3LI9A 1TS7A 3L28A 1HZOA 5TGFA 1OTBA 4H9QB 3AZIC 2JKTM 2X01A 2VJWA 5K5BA 3OPPA 3NDEA 3LZ0A 1YLZA 3MGRB 5AV5A 5B32G 4M3KA 1NLYA 3UO9A 4CLCC 4QLCA 5B1LC 2PR5A 1S4RA 5AV6A 4OJ5A 4HMEA 5DFXA 2PRFA 3Q7ZA 3W99D 4OQHA 4IJFA 3REKB 3AZHA 4XUJB 3B6FA 5AQBA 3VH6T 3B0BA 1P3PA 2XDMA 4HIAA 4NXFA 2ZY2A 4NE5A 3U2AA 1KX5A 3MMHA 4Z2MH 4GOGA 1KDSA 2V9AA 5BT1D 3WAAA 3X1VA 1P3OB 3AZFA 4J8XA 1RGYA 5CPJA 1ALQA 2K2NA 3AZJB 2NUPC 1E8BA 2D01A 1U35B 4H9NB 3WD4A 4JJNB 1K57C 2WGWA 2BLSA 3KWQB 2PAVP 3S7NA 4IBFA 1JWVA 1OT6A 3NIAA 2M7UA 3WRTA 5GSUC 4JBFA 5B0YB 4WUJA 4HP4A 3AZNB 3IS2A 3MKFA 2V20A 3G2ZA 3MNNC 3A6NA 4PM7A 4HJ3A 4S2LA 4KZ5A 3T4SA 3L7HA 2O9BA 1ZKJA 3KSFA 5GXQD 3RELD 2HP6A 3AGEA 3F1OB 5BNXA 1PWCA 3CPTB 3O62A 5F83A 3FZCA 4XT2A 5G4ZA 4NFTA 3HONA 4WEKA 5HZHA 2JKGA 3OPLA 5DF7A 4KZBA 3NJAA 3VSLA 3MVDB 4GHLA 1M1AA 4HJ4A 4R3AA 2JBFA 2VLGA 3AYWB 3X1TB 1BH8B 4H6JB 4YS3A 5EFWA 3UTBC 3C1BC 1SHVA 3M2JA 4J8WD 3CMZA 4J8UB 3QNBA 3H9WA 4Z66B 5HWTA 3DWKA 2H10A 3EWKA 1SKFA 1S0WA 2VGKA 3GR2A 4E3MA 1ONHA 3REHB 4H9OA 2XA7S 2AROA 2L5AA 4ARZB 1SDEA 4NXBA 2J9OA 3W96C 3ICYA 4P6ZM 3DTIA 1OMEA 4DXBA 4ZUXB 4WU9C 3F1PB 3V67A 5CGSA 4FD8A 5CP6A 3GMWA 4MCWA 3VE3A 5F99A 5B31A 2CV5C 1AOIC 2M7VA 3CZDA 4WZSB 2HGVA 5AJGA 4YM6D 3AN2A 4FCFA 1Y28A 3AZGB 1T19A 3EPLA 2QMIA 5L8MA 2ZC7A 1CI9A 1PW8A 3MGPD 2W1RA 4WZ4A 4KUDB 2OAQ1 2JC7A 1XXMA 4ZJ2A 1XGIA 3REID 1A0KA 5EVID 4GZBA 5FQKA 3C8CA 3VFHA 1ES2A 3B47A 1YLTA 4LD9B 1L0FA 1FQGA 3SS3A 1JTGA 5B33D 4DJ2A 5AY8B 1FCOA 4IUHA 1S32C 4I3IA 2W27A 3MKEA 1EQZA 1EROA 2G7UA 3AV1C 1ZLAA 4R1GA 4EQIA 1X0OA 1QO6A 1YUEA 3D72A 1W1PA 1TEMA 3Q82A 1DJAA 2Y2PA 5B1LA 1G6OA 1MWUA 4WU8D 1K55A 2W3HA 5CHMA 3E98A 2HZ5A 1PI5A 5AV8B 1D06A 1F98A 4YINA 5DTSA 3WTPC 3UB6A 2XROA 3EEHA 2HJEA 1E6PA 3IF6A 4XZQD 3KWQC 5FQQA 3LR0A 5CTMA 3S7QA 4H9SC 4DXCA 3B6GD 4R8PB 4I3JA 1I5QA 3AZMD 5F1GA 1KX3B 5DKKA 1P3FC 1P3IA 2PD8A 3TRCA 3L26A 1K57A 4DRBA 3IHAA 5A8BA 3H0LC 1P3LC 5AVCB 5B32A 1PRQA 3A3DA 3IX3A 5J4EA 2B95A 2J8PA 4HP9A 2ZQ8A 4GHIB 2HUEB 3M6BA 3W4OA 3H82A 2NQBC 4R0QA 1HTZA 4LV0A 4JXGA 4D60A 3NECA 3QNCA 3KXBD 3C1CA 5B1MB 4J8VC 5TFQA 5B2ID 5F5YA 4WF0A 3MZFA 5B40C 4NYUA 4E44A 2E8JA 4KG6A 3WS2A 4OOMA 1IYSA 1CJFA 4X23A 1MKIA 2W1TA 5BOHA 2ZMFA 1WA9A 2WKQA 3CHWP 4Y15A 3PYPA 2CC1A 5E5AC 5B24C 3TU4D 1SZVA 1YAXA 3DBAA 4EXOA 3UT9D 5HWVA 1GPFA 4OPYA 3VE4A 4WZ5C 4H9RA 1E15A 1YT4A 4ZAMA 3G32A 2F2AC 1F66B 3UTBA 2F8ND 5B0ZD 3C1BA 3F1NA 3LY4A 3WS0A 3AV2D 1E6ZA 1S67L 1ACFA 5GLBA 5B2JC 4KGCD 1TD5A 3SS5A 5CEBA 3LZ0B 1O07A 1H8PA 3MGQC 2RTSA 3W96A 4OJOA 5AV5B 1K54C 2OLVA 3C5AA 3HLEA 4WU9A 3I7JA 4QLCB 1NLZA 1EW0A 4Z2MG 3HUNA 4CLCE 1AOIA 2Y2GA 3EPJA 3K2NA 3AZHB 2CV5D 4E3NA 4BWIA 1LSXA 1M18D 3IH8A 4OPZA 4JPMA 5GHYA 4DF6A 1XA1A 4MN6A 5M18A 2B5RA 3LELC 3B0CT 4U3TA 3IX4A 3QP1A 3WAAB 3AZFB 4S2KA 4J8XB 3AGDA 1P97A 4LRXC 3KS8A 3FWLA 3RTYA 3NULA 2J3WA 1LHYA 1BZAA 1ZC2A 4L9EA 1E88A 1W7FA 5DTKA 3WKJA 5FDSA 5CEDA 4RYEA 1S1YA 1KVLA 3GTCA 3MGRD 1YMSA 1JNUA 2YFWA 2LB9A 5CPIC 2NZDB 3EQUA 4Z2LA 5A91A 5JA4A 1JVJA 1T1AA 3MQOA 4WL9A 4I3AA 3QHYA 3REKD 1SKOA 3A3FA 3T1RA 1W8YA 1PZPA 4XUJD 4LCLA 5BNXB 3LZ1C 2QKPA 3UPPA 4A5RA 3X1UC 1WYBA 3X1SB 4UQIS 4XT2B 3AZLC 4WMCA 3NQUA 5F82A 1O6IA 4FH2A 5E43A 2F8NH 1P3OD 4CAYA 3WTPA 5E2HA 4Z5TB 4UPKA 1YU2A 3RJUA 3AZJD 4IBXA 3UNWA 2XK1A 2IO5C 1U35D 2HP9A 4JJND 3UY6A 4H9SA 4GD8A 4NEED 3KWQD 3GDIA 3IT9A 1L2SA 5B0YD 3AZND 1E3UA 4OUIA 4ZJ3A 2I9VA 4H9OB 2AROB 4JKTA 3VSKA 3LGOA 1PYYA 3VH5W 2PYRA 3LR3A 1F5MA 4EETB 2IA2A 4NXGA 5CP6B 4HBTA 5F99B 5EOOA 3HLFA 1P3KA 3IXBA 1ODVA 4CQHA 3DTEA 3VOZA 1FCMA 3RFBA 2B18A 4LGWA 5B40A 2Y91A 3MVDD 1YQSA 1W79A 5E2EA 2Y2IA 1SDNA 3X1TD 3AYWD 3K3CA 1PFLA 2R78A 3W99C 3G6OA 4KENB 3MGSA 5FI2A 3C2WA 1E6NA 4OLDA 3FG8A 4PAUA 3H7WB 4S2NA 4J8UD 2ZD8A 4Z66D 5E5AA 5M19A 2EWWA 3GQZA 4X6TA 1GA0A 4HBUA 3REHD 3KS4A 3ISGA 1BLHA 3O5YA 2Z6DA 5BT1C 1NXYA 2H5SA 4Y0OA 1W1TA 1P3GB 1XPBA 4ZUXD 3V3RA 2VK3A 1FOFA 2H0TA 2A49A 1EQZB 5B2JA 1AXBA 5JYPA 1ZLAB 3LFVA 4E04A 5AQ7A 4ZTKA 3KUYA 3NOUC 1OPXA 1GHPA 2J80A 2EFXA 3ZFZA 5DNNA 3E4OA 3AZGD 2BYMA 2E8IA 5A92A 3V9RA 3AGFA 3ITAA 2QZ6A 4G3VA 4B93A 5DNMB 4K0XA 5GXQC 3RELC 1L6JA 3CAXA 4KUDD 2LB5A 2ZC4B 1TVFA 3IF6B 3ZVTA 3AFAB 4K0WA 4I38A 4YFMA 4Y13A 5GT3B 4LD9D 4JGOA 3L9KA 1Y4OA 5KMWA 4PKYG 5J8XA 5AY8D 4LV2A 4QHCA 1KGGA 3S22A 5FUGA 5B32B 4J8WC 1VB6A 4GB7A 2JKRI 2OSUA 1H3OB 4DRAA 5CPIA 1P3AA 4KG5A 4OJ6A 1DP9A 3H82B 4HI4A 4F3LA 2V1BA 4II7A 2XF3A 3WA9A 4X25A 4H9PB 1YLPA 5AV8D 1P3BA 1K4EA 3X1UA 4MB3A 2D02A 4KZAA 3KFUG 2ZOHA 5FATA 2X02A 3AZLA 2ACGA 3UDIA 2HV1A 3BJNA 3LI8A 1OGGA 4X23B 1MPLA 2W1TB 1JWZA 4R8PD 3P01A 3A1KA 3RH8B 3O88A 2WADA 4YM6C 1KX3D 5BS7A 4UA9A 1LT0A 4X56A 3DWZA 2OWHA 2XH9A 2OV5A 1ID3B 1G28A 4UA7A 1I2WA 4H9RB 3UMDA 3MGPC 4WJ3C 2O99A 5AVCD 2I72A 3PR6A 4WEJA 1ES4A 3VMAA 1D7EA 1BH9A 3REIC 5EVIC 4MBKA 1KE0A 5B1MD 3HCYA 3HUMA 1MC0A 3QP8A 4GJ4A 4G92C 2HJ9C 5EECA 5B33C 4P6ZS 4IJGA 3AZKB 4IVKA 2VQRA 3NQJB 1H5XA 4NE3A 1YM1A 3OBFA 1ESUA 4D2OA 2JHEA 1FIKA 1PNEA 4EBNA 1UGUA 5AQ9A 5MC7A 5AVFA 4WU8C 3LJAB 3KSYA 3MF0A 2A2LA 4LCMA 3ZG5A 2PBDP 5CRFA 4X53A 3BQAA 1IYOA 1F66D 2PU2A 4WBGA 3PBNA 1ERQA 4XZQC 5DF8A 1YLYA 3T4OA 2FJ7A 2Q9MA 3WKJB 3PBOA 3B6GC 3E2KA 3KYEA 5DF9A 3LZ0D 4EUVA 1H0GA 5AV5D 2Y79A 3AZMC 2GNXA 2DNSA 4QLCD 2WZZA 2FFFB 2JN7A 5JA4B 1LI0A 3HSHA 3B0DB 5CPKB 5FSRA 1W1YA 4HGAB 3HLGA 3T12B 2J9PA 3ZYTA 5DNMC 5FAOA 2G2WA 3V39A 2F8NG 3Q81A 4E3IA 1SKOB 1UR8A 3AZHD 1CEGA 3P98A 2B02A 4K08A 1T1BA 5KZHA
chains in the Genus database with same CATH topology
1JFIA 3HL9A 4EO5C 4QU3A 2Q9NA 5CTNA 3C7VA 3KXBC 5B2IC 5JRGA 3FYZA 3WAAD 4G91C 5GXQA 3AZFD 2P9VA 4J8XD 4HESA 5AQAA 5KDMB 1GHIA 5GLCA 3OPHA 5CERA 1C3BA 4N1HA 3VP3A 4IVIA 4RVAA 1ERMA 3MFDA 3TU4C 2NZDD 3UT9C 5EPHA 3ITBA 5B0ZC 4J8WA 3AV2C 3DTMA 3HVFA 4OKPA 1QMFA 2Y2MA 3AZEA 3REJA 3X1SD 3W97A 4KGCC 1P3KB 3HUOA 4GKUA 1TZYB 1K38A 3UE3A 2FFYA 1HQ3A 1W5DA 5CGWA 2V2FF 3G4PA 3EPHA 4XUXA 1ULYA 4Z5TD 3VP4A 3ZGAB 2HIOB 4EUZA 2IOUA 3MGSB 3L29A 3IHBA 2W8SA 1M18C 1E25A 4YM6A 2WKHA 3PAGA 2RVQD 3GV9A 4ZDXA 2Y4AA 5FAQA 4JLFA 1IELA 3D4FA 3N6IA 3PAEA 2AROD 2PYOB 1L0EA 1K6RA 4C6YA 2JSSA 1KVMA 1WYCA 3L27A 2ZM5A 5CP6D 5EVIA 5F99D 4DE1A 4WNNB 2JCHA 3MGRC 1JWPA 3KUYB 3C7UA 3UE1A 4X68A 2EX2A 5B33A 5DNNB 4KQOA 1P34B 4PM5A 3AZIA 3ZHHA 2ZJ9A 5G18A 3REKC 4IBKA 4L0LA 5EVLA 4OJLA 3FKWA 2R9XA 1KX4B 4XUJC 5HL1A 3UE0A 3WX7A 5AV9B 3O87A 4IBRA 3IXHA 4RX3A 1S6RA 1P3OC 1CEFA 4S2IA 1P3GD 4ZBJB 3AZJC 1Y54A 3LY3A 2WK0A 4GD6A 1U35C 3W98B 4JJNC 2ZQ7A 1EQZD 1ZLAD 1P3MB 4JF4A 5B0YC 4LG2A 3AZNC 5AVBB 4DE3A 1MY8A 5GT0B 3UTAB 3NI9A 3WA9B 3N8RA 2ZM2A 5DNMD 1P3BB 5GSUA 1BSGA 2RIQA 4KHAA 1DJBA 4Q8IA 1M19B 2HP5A 3AFAD 3OZHA 3KXBA 4ID4A 2C6WB 4BL2A 3MNNA 5GT3D 5FASA 4BQMA 5FQ9A 3MVDC 4UAAA 1L0DA 5FAPA 3AYWC 3X1TC 5L2FA 2XQZA 3O3VA 3R45A 2IWCA 2G5HC 3SH9A 5B32D 4J8UC 4Z66C 4OJPA 3TU4A 3N8LA 4HEFA 3REHC 1PI4A 1N1JB 1R4VA 1FCNA 5B0ZA 3EPKA 2ZQDA 4ZUXC 3MBZA 1TAFA 4Y0UA 5HFOA 1PZRA 4KGCA 4H8RA 4CSRA 1K25A 4X23D 5C3IB 3GRJA 4GDBA 3BYDA 1Q9CA 3AZGC 4F94A 1B6WA 4KQQA 4LENA 4BL3A 1ID3D 2PYOC 5AV6B 2CV5A 1M18A 3A3JA 3V50A 2P74A 4KUDC 5F1FA 3HLDA 3B6FB 1P3PB 2FJ7B 5HAQA 1KX5B 2G2UA 5CHLB 4LD9C 2DRWA 3X1VB 3HLBA 4S2MA 1G6AA 3AZKD 5AY8C 5CPJB 4MBHA 2WGWB 3Q1FA 3MGRA 2XFTA 1BUEA 4DRTA 1HVBA 1K6SA 4OONA 3H0MC 4LV1A 3HREA 3LJAD 1S32A 5JRGB 4DDYA 2IWBA 5AV8C 3A6NB 3AV1A 2P9VB 4ZBJC 4QJGA 2XEPA 3L2AA 4IBCA 4JXWA 3VP0A 3O62B 3WKJD 1IKGA 3M6HA 4R8PC 3UPOA 1HD8A 1IEMA 4M6BA 1Q2QA 1KGFA 1YU1A 3UN7A 1FR6A 4AWLB 1KX3C 3WS1A 3UTAC 1MWTA 1U35A 4H9NA 1M1AB 4JJNA 3G35A 2ZY3A 2WZXA 4JXSA 3KWQA 5CPKD 1EI5A 4YS3B 4BD0A 5B0YA 5AVCC 4R3BA 3NDGA 2XR0A 3AZNA 3ZNTA 2HDSA 2HUEC 3AZEB 3REJB 3W97B 1P3FA 5FI7A 1HQ3B 5TR7A 5B1MC 5FA7A 4NZ1A 1P3LA 1FSWA 4PPRA 4UHUA 3GSGA 5FQJA 3DW0A 2NQBA 5B31B 1IYPA 4J8VA 3IWOA 4NY2A 3MVDA 3AN2B 3Q7VA 1E3UD 3C4PA 1BH8A 5DVAA 1XA7A 2YFVA 2HPBA 3ZG0A 3SOIA 4EBPA 2BYKA 2PBYA 1F66C 1K56D 4N9KA 4J8UA 1LLBA 2LY8A 1YU0A 5B24A 3REHA 1P3KD 5C3IC 1TZYD 3LZ0C 1KU5A 4WZ5A 1A7WA 4Z9QA 5AV5C 3LCEA 3IP4C 4ZUXA 3BFDA 4KZ8A 4QLCC 4WM9A 3SS4A 4DQYB 4B4ZA 2HIOD 3AZIB 1K4FA 3MGSD 3AZHC 5DTTA 3HLCA 3MGQA 1K54A 4GN2A 4B88A 3AZGA 4EV4A 5B1LB 3FKEA 1MWSA 3ZCZA 2PYOD 5HX9A 3WAAC 3IH9A 1L0GA 3AZFC 4J8XC 4BJPA 4KUDA 4FSFA 2Y55A 4PM9A 3W4QA 4QY6A 3LELA 1YU4A 4E3JA 3KUYD 4EBLA 2NZDC 5AY8A 2WGIA 5DNND 1P34D 1P3IB 3BLSA 3VH5T 2RL3A 1TDLA 1Q2PA 2ZQCA 3A1IA 5GSUB 1KX4D 4DDSA 3FV7A 4KHAB 3X1SC 5AV9D 1E4DA 3MNNB 3C1CB 5FDHA 4DE0A 4Z5TC 4E6WA 3LZ1A 3VH6W 3W98D 5HARA 2Z2LB 3WS4A 4R8PA 1JTDA 1P3MD 2RVQC 4S2JA 5AVBD 3IQAA 1QMEA 3VP2A 5GT0D 3UTAD 2AROC 5HAPA 1N4OA 2RCXA 1B67A 3WA9D 5EUAA 3NC8A 1P3BD 3UTBB 3C1BB 1RGZA 5CP6C 4KZ3A 4N1XA 5B31C 5F99C 4R23A 1M19D 2H0YA 5B1MA 3G31A 4Y0TA 3W96B 1NYMA 4E3OA 4R4SA 4WU9B 1N9BA 1GHMA 4RA7A 3TSGA 4UUZA 3N4IA 3OC2A 2CV5B 1AOIB 3E2LA 2Y59A 3H0RC 5CXWA 2Y2NA 1PZOA 4X55A 4MNRA 3N3FA 3TOIA 1WE4A 3W8KA 3HLWA 1F66A 3W99A 3VFFA 1P3GC 1FR1A 4MLLA 1EQZC 4C75A 1ZLAC 3WRZA 4OQIA 3P09A 1NZOA 2F8NK 2YFWB 1K55C 5FI6A 3LEZA 1S32B 4PM8A 1EWZA 2HDUA 5AV6D 4IBIA 1WWSA 3AV1B 3G34A 3A3EA 3IF6C 3TG9A 3B6FD 1P3PD 4OPQA 1BTLA 2FJ7D 3AFAC 3ZVWA 1KX5D 2XLNA 3NQUB 5GT3C 2Y2JA 3RELA 3X1VD 3WTPB 4CAYB 1P3IC 2ZQ9A 4EWFA 5CPJD 2X71A 2ZMAA 1XKZA 1KDWA 5CGXA 4NETA 2EX8A 4RX2A 5B32C 3IXDA 2DQNC 1ZG6A 2NZDA 1P3FB 4B4XA 1DY6A 4N9LA 3N8SA 3C1CC 5JRGD 2Y2QA 5FQIA 1VQQA 3A6ND 1P3LB 1YLWA 2C5WB 3BM6A 1LL5A 4CJNA 3X1SA 4OPRA 3O62D 1DJCA 2NQBB 1W8QA 4DKIA 2EX6A 4X23C 4E45A 2EXBA 4J8VB 4Z5TA 5BPVA 3EQVA 3Q7VB 3RXXA 5B40B 1J9MA 5GHXA 1ID3C 3MZEA 3LO7A 4PM6A 1M1AD 2YFVB 1MWRA 4OH0A 2BYKB 4YS3D 1XGJA 1ES5A 5GHZA 3L25A 3IF5A 3N7WA 5IHVA 3AZED 5E5AB 3REJD 3W97D 5B24B 2J8YA 4IBEA 2QPNA 1HQ3D 3MGPA 1U60A 4BD1A 3AZKC 4QD4A 4QB8A 2ZY4A 5U47A 4DE2A 3REIA 5JYOA 5B31D 5B2JB 4U0TA 5GL9A 3MGQB 1GA9A 5A93A 3JYIA 1H8YA 3AN2D 3LJAC 4BLMA 1Z6FA 2BYMB 3VH5A 3S4XA 3V9RB 4NZ4A 5M1AA 3NBLA 4IBGA 5BNVA 5E2FA 5EE8A 4WU8A 3WKJC 4OQGA 3LELB 1P3GA 3AL0C 3BRMA 2JE5A 4JXVA 4XZQA 3B0DC 4WELA 5BO0A 5CPKC 1PIOA 4HGAC 2EXAA 3AZID 3A3IA 3BFEA 3B6GA 4FH4A 3M2KA 5FUGB 4KZ6A 3AZMA 1T3UA 2ZLYA 5CPIB 1P3AB 5B1LD 3PBQA 5HAIA 5DNMA 2Y2KA 3LZ1B 3X1UB 1BULA 3AFAA 1ZG4A 3B0CW 3AZLB 3OCLA 1F1EA 3W4PA 1BLPA 5GT3A 5B2IA 3C4OA 3RXWA 2V1ZA 4ZJ1A 2Y2OA 1P3ID 1YMXA 5G49A 2IO5B 4NE6A 4P6BA 5GSUD 2EX9A 1H3OA 2BG1A 4JF6A 1MBLA 5KSHA 1P3KC 1BH9B 3P5JB 3UT9A 1TZYC 1RP5A 3MNND 4H9PA 1LI9A 3C1CD 2F8NA 2ZM0A 3AV2A 3UDXA 2ZM8A 4GNUA 2PU4A 3BECA 2HIOC 4UUZB 3BFCA 3MGSC 3IXGA 3BEBA 2XD5A 4S2NC 1ID3A 4ZBEA 1M6KA 4N92A 3W99B 1CK3A 1CI8A 2XD1A 1TDGA 3VP1A 3VH6A 4CPKA 3UTBD 4NZ3A 3C1BD 3PBSA 2HDRA 3MXSA 3NCKA 3BFGA 3G30A 2WKEA 1XX2A 1KE3A 1BFMA 3KUYC 1YLJA 4IJEA 3W96D 4KZ9A 3AZKA 5DNNC 1P34C 2ZC6B 4WU9D 5EOEA 3ZG8B 3NQJA 2ZY5A 4H9QA 1KE4A 3FKVA 3NY4A 2GDNA 1H8ZA 4OOLA 1AOID 4X69A 1KX4C 3MZDA 5AV9C 1JFIB 3LJAA 1I2SA 4U0XA 4JF5A 3ZNYA 5HW3A 3REKA 1PWDA 5E2GA 5GXQB 3RELB 4BENA 4XUJA 3W98C 3PBRA 3SH7A 3BLMA 2Y2HA 2EFUA 1P3MC 1RCJA 5CHUA 4KZ7A 2DCFA 1M40A 1HTAA 1P3AC 1P3OA 4NYYA 2ZC5B 1W2EA 5AVBC 4P0MA 3S1YA 3OCNA 5GT0C 3AZJA 5CPKA 3VOYA 2J7VA 2XGNA 1ESIA 1S32D 4P87A 1NY0A 3WA9C 4O7DA 2XFSA 1P3BC 3AV1D 3V5MA 4J8WB 5GLAA 1M19C 1GCEA 4K91A 4MEZA 4GHAA 1LL9A 4NK3A 4WMCD 5BS7C 3WTPD 5KDMA 3IWQA 1FSYA 4E6XA 4OVDA 2WAEA 2CWEA 3ZG7B 4MBFA 4OLGA 4YM6B 4GH9A 4GDNA 4R4RA 2DF4C 1P3FD 3ZG9B 1Z2CB 1PWGA 3AYWA 3X1TA 4OP8A 3MGPB 1K56A 3G2YA 1PW1A 3CG5A 1P3LD 4OQ0A 1BLSA 4XXRA 4Z66A 4E3LA 3REIB 1TZYA 5EVIB 2NQBD 4PMAA 1KGEA 4QY5A 1MXOA 5KSCA 1SCWA 4J8VD 2IWDA 2Y2LA 4G92B 5GLDA 5B40D 5B33B 4E3KA 3BFFA 2HIOA 4OOYA 5I94A 5AV6C 4KQRA 5D3OA 3IWIA 4IBBA 3B6FC 5BNVB 1XP4A 1P3PC 5CECA 2FJ7C 5E5AD 4WU8B 5B24D 1KX5C 4OP5A 2PYOA 1IYQA 4P85A 2ZC3B 4IBJA 3X1VC 5CPJC 2VGJA 3EG5B 4XZQB 5BO0B 4WNNA 1O7EA 3B6GB 5B2JD 2A3UA 3MGQD 4LD9A 3AZMB 3O86A 3MXRA 1P34A 3Q07A 5CHJA 4R3JA 4Y7PA 3WWXA 2ZQAA 3PTEA 4NZ5A 5JRGC 1NYYA 3A6NC 1KX4A 5AV9A 4XUZA 3WTPE 4KZ4A 3O62C 4EO5B 2WGVA 5B31G 3LELD 3WS5A 3F6TA 3UDFA 3KXBB 5B2IB 2WKIA 4G91B 4AWLC 3V3SA 3GVBA 5AV8A 3UPNA 5FQMA 1M1AC 3W98A 1WWIA 5G49B 4WYYA 4YS3C 1P3MA 3B3XA 3PBTA 1NJ4A 4S2PA 3ZDJA 3R45B 2HDQA 5AVBA 1KX3A 3AZEC 2WYXA 3REJC 2G5IC 3W97C 3TU4B 5CPID 5GT0A 1P3AD 3UTAA 3OPRA 2UWXA 3UT9B 3FDDA 1HQ3C 2Z2MB 2WAFA 2F8NB 5B0ZB 3SH8A 5AVCA 2OLUA 3AV2B 1VM1A 3HBRA 1YU3A 3LZ1D 1TAFB 1ES3A 1M19A 3X1UD 4IEDA 2R9WA 4KGCB 3AZLD 4LV3A 4CSRB 5A90A 1NRFA 3AN2C 4S2OA 4C3QA 1BT5A 3CJMA 4WV4B 4UA6A 1NZUA 1BLCA 1M18B 1G68A 1ONGA 1N1JA 4QNLA 4IBDA 2WUQA 1IKIA 4KG2A 3L28A 1HZOA 5TGFA 4H9QB 3AZIC 2X01A 3OPPA 3NDEA 3LZ0A 1YLZA 3MGRB 5AV5A 5B32G 4M3KA 3UO9A 4QLCA 5B1LC 5AV6A 4OJ5A 3Q7ZA 3W99D 4OQHA 4IJFA 3REKB 3AZHA 4XUJB 3B6FA 5AQBA 3VH6T 3B0BA 1P3PA 2XDMA 2ZY2A 4NE5A 1KX5A 4Z2MH 4GOGA 1KDSA 5BT1D 3WAAA 3X1VA 1P3OB 3AZFA 4J8XA 1RGYA 5CPJA 1ALQA 3AZJB 1U35B 4H9NB 4JJNB 1K57C 2WGWA 2BLSA 3KWQB 4IBFA 1JWVA 3NIAA 3WRTA 5GSUC 4JBFA 5B0YB 3AZNB 3MKFA 2V20A 3G2ZA 3MNNC 3A6NA 4PM7A 4S2LA 4KZ5A 1ZKJA 5GXQD 3RELD 2HP6A 3AGEA 5BNXA 1PWCA 3O62A 5F83A 3FZCA 4NFTA 3HONA 4WEKA 3OPLA 5DF7A 4KZBA 3VSLA 3MVDB 4GHLA 1M1AA 2JBFA 3AYWB 3X1TB 1BH8B 4YS3A 3UTBC 3C1BC 3M2JA 1SHVA 4J8WD 3CMZA 4J8UB 3QNBA 4Z66B 3DWKA 2H10A 1SKFA 1S0WA 2VGKA 3GR2A 4E3MA 1ONHA 3REHB 4H9OA 2AROA 2L5AA 1SDEA 2J9OA 3W96C 1OMEA 4DXBA 4ZUXB 4WU9C 5CGSA 4FD8A 5CP6A 3GMWA 5F99A 5B31A 2CV5C 1AOIC 3CZDA 4WZSB 4YM6D 3AN2A 4FCFA 3AZGB 3EPLA 2QMIA 2ZC7A 1CI9A 1PW8A 3MGPD 4WZ4A 4KUDB 2JC7A 1XXMA 4ZJ2A 1XGIA 3REID 5EVID 4GZBA 5FQKA 3VFHA 1ES2A 1YLTA 4LD9B 1L0FA 1FQGA 3SS3A 1JTGA 5B33D 5AY8B 1FCOA 1S32C 3MKEA 1EQZA 1EROA 3AV1C 1ZLAA 4R1GA 4EQIA 1YUEA 1TEMA 3Q82A 1DJAA 2Y2PA 5B1LA 1MWUA 4WU8D 1K55A 5CHMA 1PI5A 5AV8B 4YINA 5DTSA 3WTPC 3IF6A 4XZQD 3KWQC 5FQQA 5CTMA 4H9SC 4DXCA 3B6GD 4R8PB 1I5QA 3AZMD 5F1GA 1KX3B 1P3FC 1P3IA 3L26A 1K57A 4DRBA 3IHAA 3H0LC 1P3LC 5AVCB 5B32A 3A3DA 2J8PA 2ZQ8A 2HUEB 3M6BA 3W4OA 2NQBC 4R0QA 1HTZA 4LV0A 4JXGA 3QNCA 3KXBD 3C1CA 5B1MB 4J8VC 5TFQA 5B2ID 3MZFA 5B40C 4NYUA 4E44A 4KG6A 3WS2A 4OOMA 1IYSA 4X23A 1MKIA 5BOHA 2CC1A 5E5AC 5B24C 3TU4D 3UT9D 4OPYA 4WZ5C 4H9RA 1YT4A 4ZAMA 3G32A 2F2AC 1F66B 3UTBA 2F8ND 5B0ZD 3C1BA 3LY4A 3WS0A 3AV2D 5GLBA 5B2JC 4KGCD 3SS5A 5CEBA 3LZ0B 1O07A 3MGQC 3W96A 4OJOA 5AV5B 1K54C 2OLVA 3C5AA 3HLEA 4WU9A 3I7JA 4QLCB 4Z2MG 3HUNA 1AOIA 2Y2GA 3EPJA 3AZHB 2CV5D 4E3NA 1M18D 3IH8A 4OPZA 4JPMA 5GHYA 4DF6A 1XA1A 5M18A 2B5RA 3LELC 3B0CT 4U3TA 3WAAB 3AZFB 4S2KA 4J8XB 3AGDA 3KS8A 3FWLA 1LHYA 1BZAA 1ZC2A 1W7FA 5DTKA 3WKJA 5CEDA 4RYEA 1KVLA 3GTCA 3MGRD 1YMSA 2YFWA 5CPIC 2NZDB 3EQUA 5A91A 5JA4A 1JVJA 3QHYA 3REKD 3A3FA 1W8YA 1PZPA 4XUJD 4LCLA 5BNXB 3LZ1C 3UPPA 4A5RA 3X1UC 1WYBA 3X1SB 3AZLC 4WMCA 3NQUA 5F82A 4FH2A 5E43A 2F8NH 1P3OD 4CAYA 3WTPA 5E2HA 4Z5TB 4UPKA 1YU2A 3RJUA 3AZJD 4IBXA 3UNWA 2XK1A 2IO5C 1U35D 2HP9A 4JJND 3UY6A 4H9SA 4GD8A 3KWQD 3IT9A 1L2SA 5B0YD 3AZND 1E3UA 4OUIA 4ZJ3A 4H9OB 2AROB 4JKTA 3VSKA 1PYYA 3VH5W 5CP6B 4HBTA 5F99B 5EOOA 3HLFA 1P3KA 3IXBA 3VOZA 1FCMA 5B40A 2Y91A 3MVDD 1YQSA 1W79A 5E2EA 2Y2IA 1SDNA 3X1TD 3AYWD 3W99C 4KENB 3MGSA 5FI2A 4OLDA 4S2NA 4J8UD 2ZD8A 4Z66D 5E5AA 5M19A 3GQZA 4X6TA 1GA0A 4HBUA 3REHD 3KS4A 3ISGA 1BLHA 5BT1C 1NXYA 2H5SA 4Y0OA 1P3GB 1XPBA 4ZUXD 3V3RA 1FOFA 2H0TA 2A49A 1EQZB 5B2JA 1AXBA 5JYPA 1ZLAB 5AQ7A 4ZTKA 3KUYA 1GHPA 2EFXA 3ZFZA 5DNNA 3AZGD 2BYMA 2E8IA 5A92A 3V9RA 3AGFA 3ITAA 2QZ6A 5DNMB 4K0XA 5GXQC 3RELC 4KUDD 2ZC4B 1TVFA 3IF6B 3ZVTA 3AFAB 4K0WA 4YFMA 5GT3B 4LD9D 5KMWA 5J8XA 5AY8D 4LV2A 4QHCA 1KGGA 3S22A 5FUGA 5B32B 4J8WC 4GB7A 2OSUA 1H3OB 4DRAA 5CPIA 1P3AA 4KG5A 4OJ6A 2XF3A 3WA9A 4H9PB 1YLPA 5AV8D 1P3BA 1K4EA 3X1UA 4KZAA 3KFUG 5FATA 2X02A 3AZLA 3UDIA 4X23B 1MPLA 1JWZA 4R8PD 3A1KA 3O88A 2WADA 4YM6C 1KX3D 5BS7A 4UA9A 4X56A 3DWZA 2XH9A 2OV5A 1ID3B 4UA7A 1I2WA 4H9RB 3MGPC 4WJ3C 5AVCD 2I72A 4WEJA 1ES4A 3VMAA 1BH9A 3REIC 5EVIC 4MBKA 1KE0A 5B1MD 3HUMA 4G92C 5EECA 5B33C 3AZKB 4IVKA 2VQRA 3NQJB 1H5XA 4NE3A 1YM1A 1ESUA 4D2OA 4EBNA 5AQ9A 4WU8C 3LJAB 3KSYA 4LCMA 3ZG5A 5CRFA 4X53A 1IYOA 1F66D 2PU2A 4WBGA 3PBNA 1ERQA 4XZQC 5DF8A 1YLYA 2FJ7A 2Q9MA 3WKJB 3PBOA 3B6GC 3E2KA 5DF9A 3LZ0D 5AV5D 3AZMC 2DNSA 4QLCD 2WZZA 2FFFB 5JA4B 1LI0A 3HSHA 3B0DB 5CPKB 5FSRA 4HGAB 3HLGA 2J9PA 5DNMC 5FAOA 2G2WA 3V39A 2F8NG 3Q81A 4E3IA 3AZHD 1CEGA 3P98A 5KZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLS A;  3HL9 A;  4YIN A;  5DTS A;  1RCJ A;  5CHU A;  4QU3 A;  4KZ7 A;  2Q9N A;  2DCF A;  1M40 A;  3IF6 A;  2RL3 A;  5CTN A;  2ZC5 B;  1TDL A;  3C7V A;  4P0M A;  3S1Y A;  1Q2P A;  2ZQC A;  5FQQ A;  5CTM A;  3OCN A;  4DDS A;  3FV7 A;  3FYZ A;  4DXC A;  3VOY A;  2P9V A;  2J7V A;  2XGN A;  1ESI A;  4P87 A;  1I5Q A;  4HES A;  5AQA A;  1NY0 A;  4O7D A;  1E4D A;  1GHI A;  5F1G A;  2XFS A;  5GLC A;  3OPH A;  3V5M A;  5CER A;  1C3B A;  4N1H A;  5FDH A;  4DE0 A;  1K57 A;  5GLA A;  3VP3 A;  4IVI A;  4RVA A;  1ERM A;  1GCE A;  3IHA A;  3MFD A;  4K91 A;  4E6W A;  4MEZ A;  1LL9 A;  4NK3 A;  5HAR A;  2Z2L B;  4WMC D;  3A3D A;  3WS4 A;  1JTD A;  2ZQ8 A;  5EPH A;  3M6B A;  3W4O A;  3ITB A;  4R0Q A;  1HTZ A;  3IWQ A;  4LV0 A;  1FSY A;  4JXG A;  4OVD A;  3QNC A;  4E6X A;  4S2J A;  3IQA A;  3DTM A;  3HVF A;  2WAE A;  1QME A;  4OKP A;  5TFQ A;  3VP2 A;  3MZF A;  1QMF A;  3ZG7 B;  2Y2M A;  5HAP A;  1N4O A;  4MBF A;  4OLG A;  2RCX A;  3HUO A;  4GKU A;  4KG6 A;  3WS2 A;  5EUA A;  3NC8 A;  1K38 A;  3UE3 A;  4OOM A;  2FFY A;  4GDN A;  1IYS A;  1W5D A;  4R4R A;  1RGZ A;  2V2F F;  5CGW A;  3ZG9 B;  3G4P A;  1PWG A;  4XUX A;  4KZ3 A;  4N1X A;  1MKI A;  3VP4 A;  5BOH A;  4R23 A;  4OP8 A;  1K56 A;  2H0Y A;  3G2Y A;  3ZGA B;  1PW1 A;  2CC1 A;  3CG5 A;  3G31 A;  4EUZ A;  4Y0T A;  4OQ0 A;  1BLS A;  3IHB A;  4XXR A;  4OPY A;  1NYM A;  4E3O A;  4WZ5 C;  4E3L A;  1E25 A;  1YT4 A;  4R4S A;  2WKH A;  4ZAM A;  3PAG A;  1N9B A;  5EVI B;  1GHM A;  3G32 A;  4PMA A;  1KGE A;  3GV9 A;  4QY5 A;  4RA7 A;  3LY4 A;  3TSG A;  3WS0 A;  1MXO A;  3N4I A;  3OC2 A;  2Y4A A;  1SCW A;  5FAQ A;  4ZDX A;  5KSC A;  4JLF A;  1IEL A;  3D4F A;  2IWD A;  3N6I A;  3PAE A;  2Y2L A;  3E2L A;  2Y59 A;  1L0E A;  5GLD A;  5GLB A;  4E3K A;  3BFF A;  4OOY A;  1K6R A;  5CXW A;  3SS5 A;  4C6Y A;  5CEB A;  5I94 A;  2Y2N A;  1O07 A;  1PZO A;  4KQR A;  1KVM A;  2OLV A;  4MNR A;  1K54 C;  1WYC A;  3C5A A;  3HLE A;  4X55 A;  5D3O A;  3TOI A;  3I7J A;  1WE4 A;  5EVI A;  3W8K A;  3HLW A;  4DE1 A;  3IWI A;  1XP4 A;  3VFF A;  2JCH A;  1FR1 A;  4MLL A;  5CEC A;  1JWP A;  3HUN A;  3C7U A;  3UE1 A;  2Y2G A;  4OP5 A;  1IYQ A;  4X68 A;  2EX2 A;  4E3N A;  3IH8 A;  4KQO A;  4OPZ A;  4JPM A;  4P85 A;  5GHY A;  4C75 A;  4DF6 A;  1XA1 A;  4PM5 A;  5M18 A;  3WRZ A;  2ZC3 B;  2B5R A;  4OQI A;  3ZHH A;  2ZJ9 A;  2VGJ A;  4U3T A;  5G18 A;  3P09 A;  4L0L A;  5EVL A;  1NZO A;  3FKW A;  2R9X A;  1K55 C;  1O7E A;  5FI6 A;  4S2K A;  5HL1 A;  3LEZ A;  3UE0 A;  3AGD A;  2A3U A;  4PM8 A;  1EWZ A;  2HDU A;  3O87 A;  3FWL A;  1LHY A;  1BZA A;  1ZC2 A;  4IBR A;  3IXH A;  3O86 A;  3MXR A;  1W7F A;  3Q07 A;  4RX3 A;  1S6R A;  5DTK A;  5CHJ A;  4R3J A;  3G34 A;  3A3E A;  3IF6 C;  4Y7P A;  3WWX A;  1CEF A;  2ZQA A;  4RYE A;  3TG9 A;  5CED A;  4S2I A;  3PTE A;  1BTL A;  1KVL A;  4OPQ A;  3GTC A;  1YMS A;  3ZVW A;  1NYY A;  1Y54 A;  2WK0 A;  3LY3 A;  4GD6 A;  2ZQ7 A;  3EQU A;  2XLN A;  2Y2J A;  5A91 A;  1JVJ A;  4XUZ A;  4JF4 A;  4KZ4 A;  4EWF A;  2WGV A;  2ZQ9 A;  3WS5 A;  3QHY A;  2X71 A;  2ZMA A;  1XKZ A;  3A3F A;  3UDF A;  1KDW A;  5CGX A;  4NET A;  4DE3 A;  1MY8 A;  1W8Y A;  1PZP A;  2EX8 A;  2WKI A;  4LCL A;  3UPP A;  4A5R A;  4RX2 A;  3V3S A;  3GVB A;  1WYB A;  3IXD A;  3NI9 A;  3UPN A;  5FQM A;  1ZG6 A;  3N8R A;  4WMC A;  2ZM2 A;  4WYY A;  5F82 A;  4B4X A;  3B3X A;  1BSG A;  4FH2 A;  3PBT A;  1DY6 A;  5E43 A;  1NJ4 A;  1DJB A;  3N8S A;  4N9L A;  5E2H A;  4Q8I A;  4S2P A;  3ZDJ A;  2HP5 A;  2Y2Q A;  5FQI A;  2HDQ A;  3RJU A;  3OZH A;  1VQQ A;  2WYX A;  4IBX A;  4ID4 A;  2XK1 A;  2C6W B;  3UNW A;  3UY6 A;  1YLW A;  2C5W B;  2HP9 A;  3OPR A;  4BL2 A;  3BM6 A;  1LL5 A;  4GD8 A;  2UWX A;  4CJN A;  5FAS A;  4OPR A;  3IT9 A;  4BQM A;  5FQ9 A;  1L2S A;  1DJC A;  4UAA A;  2Z2M B;  1L0D A;  1W8Q A;  4DKI A;  2WAF A;  2EX6 A;  5FAP A;  3SH8 A;  2OLU A;  1E3U A;  1VM1 A;  3HBR A;  2EXB A;  4ZJ3 A;  5L2F A;  1ES3 A;  2XQZ A;  3O3V A;  2IWC A;  2R9W A;  3EQV A;  4IED A;  3Q7V B;  4JKT A;  3RXX A;  1J9M A;  3SH9 A;  3VSK A;  5GHX A;  3MZE A;  3LO7 A;  1PYY A;  4PM6 A;  4LV3 A;  1MWR A;  5A90 A;  1NRF A;  3N8L A;  4HEF A;  4OH0 A;  1XGJ A;  1ES5 A;  1PI4 A;  1FCN A;  4HBT A;  5EOO A;  4S2O A;  3HLF A;  5GHZ A;  4C3Q A;  1BT5 A;  3IF5 A;  3IXB A;  2ZQD A;  3N7W A;  3CJM A;  5IHV A;  3VOZ A;  3MBZ A;  4UA6 A;  1FCM A;  1NZU A;  1BLC A;  2J8Y A;  4Y0U A;  2Y91 A;  5HFO A;  2QPN A;  1G68 A;  1ONG A;  1U60 A;  1YQS A;  1W79 A;  4H8R A;  2Y2I A;  1K25 A;  1SDN A;  5E2E A;  4BD1 A;  4KEN B;  3GRJ A;  4QD4 A;  5FI2 A;  4QB8 A;  4GDB A;  4OLD A;  5U47 A;  4DE2 A;  3BYD A;  5JYO A;  2WUQ A;  4F94 A;  4KQQ A;  1IKI A;  4LEN A;  4S2N A;  2ZD8 A;  4KG2 A;  4U0T A;  5GL9 A;  4BL3 A;  5M19 A;  3GQZ A;  4X6T A;  1GA0 A;  4HBU A;  1GA9 A;  1HZO A;  3A3J A;  5TGF A;  3V50 A;  2P74 A;  5A93 A;  3JYI A;  3ISG A;  1BLH A;  1H8Y A;  5F1F A;  1NXY A;  2H5S A;  4Y0O A;  2X01 A;  3HLD A;  3OPP A;  4BLM A;  1Z6F A;  1XPB A;  3NDE A;  1YLZ A;  5HAQ A;  3V3R A;  4M3K A;  1FOF A;  3S4X A;  2H0T A;  5M1A A;  3NBL A;  2G2U A;  2A49 A;  3UO9 A;  1AXB A;  5JYP A;  2DRW A;  5E2F A;  5AQ7 A;  4ZTK A;  5EE8 A;  3Q7Z A;  3HLB A;  4OQG A;  4S2M A;  1G6A A;  1GHP A;  4OQH A;  2EFX A;  4MBH A;  3ZFZ A;  5AQB A;  2XDM A;  2WGW B;  3Q1F A;  2E8I A;  3BRM A;  2XFT A;  5A92 A;  2JE5 A;  3AGF A;  3ITA A;  4JXV A;  1BUE A;  4DRT A;  2QZ6 A;  1HVB A;  4WEL A;  1K6S A;  4K0X A;  1PIO A;  4GOG A;  2EXA A;  4OON A;  3A3I A;  4LV1 A;  1KDS A;  3BFE A;  2ZC4 B;  1TVF A;  3IF6 B;  3HRE A;  1RGY A;  4FH4 A;  1ALQ A;  3M2K A;  3ZVT A;  4DDY A;  4KZ6 A;  2IWB A;  2P9V B;  2ZLY A;  4K0W A;  4QJG A;  2XEP A;  4YFM A;  1K57 C;  2WGW A;  2BLS A;  4JXW A;  3VP0 A;  3PBQ A;  1JWV A;  3NIA A;  3WRT A;  5KMW A;  5HAI A;  4JBF A;  5J8X A;  1IKG A;  3M6H A;  3MKF A;  3UPO A;  1HD8 A;  2V20 A;  1IEM A;  4LV2 A;  3G2Z A;  4QHC A;  2Y2K A;  1KGG A;  1KGF A;  1Q2Q A;  3S22 A;  3UN7 A;  1FR6 A;  3WS1 A;  1BUL A;  1ZG4 A;  1MWT A;  4PM7 A;  4GB7 A;  3G35 A;  2OSU A;  4KZ5 A;  4S2L A;  3OCL A;  2WZX A;  1ZKJ A;  4JXS A;  4KG5 A;  3W4P A;  1BLP A;  2HP6 A;  3AGE A;  1EI5 A;  1PWC A;  3C4O A;  4BD0 A;  3RXW A;  5F83 A;  2V1Z A;  2XF3 A;  3FZC A;  4R3B A;  4ZJ1 A;  3NDG A;  2Y2O A;  2XR0 A;  3ZNT A;  2HDS A;  1YLP A;  4WEK A;  1YMX A;  1K4E A;  5FI7 A;  3OPL A;  4KZA A;  4KZB A;  5DF7 A;  4P6B A;  3VSL A;  5FAT A;  2X02 A;  5TR7 A;  2EX9 A;  3UDI A;  2BG1 A;  5FA7 A;  4JF6 A;  2JBF A;  1MBL A;  5KSH A;  1FSW A;  1MPL A;  1JWZ A;  4PPR A;  4UHU A;  3GSG A;  3O88 A;  5FQJ A;  2WAD A;  3DW0 A;  4UA9 A;  4X56 A;  3DWZ A;  1RP5 A;  1SHV A;  2XH9 A;  3CMZ A;  3M2J A;  2OV5 A;  1LI9 A;  3QNB A;  3DWK A;  4UA7 A;  2ZM0 A;  1I2W A;  2H10 A;  1SKF A;  1IYP A;  1S0W A;  2VGK A;  3GR2 A;  3UDX A;  3IWO A;  4E3M A;  2ZM8 A;  4GNU A;  1ONH A;  2PU4 A;  3BEC A;  3Q7V A;  1E3U D;  1SDE A;  3BFC A;  2J9O A;  3IXG A;  2I72 A;  3BEB A;  2XD5 A;  3C4P A;  5DVA A;  4WEJ A;  1ES4 A;  3VMA A;  1OME A;  1XA7 A;  2HPB A;  3ZG0 A;  4DXB A;  3SOI A;  5EVI C;  4S2N C;  4EBP A;  2PBY A;  5CGS A;  1K56 D;  4FD8 A;  3GMW A;  4MBK A;  4N9K A;  4ZBE A;  1KE0 A;  1M6K A;  3HUM A;  4N92 A;  1LLB A;  5EEC A;  3CZD A;  1CK3 A;  1CI8 A;  2XD1 A;  1TDG A;  4IVK A;  4FCF A;  3VP1 A;  4CPK A;  4WZ5 A;  4Z9Q A;  1H5X A;  3LCE A;  2HDR A;  3PBS A;  1YM1 A;  3MXS A;  3NCK A;  1ESU A;  3BFD A;  2QMI A;  3BFG A;  4KZ8 A;  4D2O A;  3G30 A;  2ZC7 A;  1CI9 A;  4WM9 A;  1PW8 A;  3SS4 A;  4EBN A;  2WKE A;  1XX2 A;  1KE3 A;  5AQ9 A;  4B4Z A;  1YLJ A;  4WZ4 A;  1K4F A;  2JC7 A;  1XXM A;  5DTT A;  4KZ9 A;  4ZJ2 A;  1XGI A;  4LCM A;  3HLC A;  3ZG5 A;  2ZC6 B;  5CRF A;  5EOE A;  5EVI D;  1K54 A;  4GZB A;  4GN2 A;  4X53 A;  5FQK A;  1IYO A;  3ZG8 B;  4B88 A;  2PU2 A;  3VFH A;  4EV4 A;  1KE4 A;  1ES2 A;  4WBG A;  3FKV A;  3PBN A;  1YLT A;  3NY4 A;  1L0F A;  1ERQ A;  1MWS A;  2GDN A;  1H8Z A;  4OOL A;  5DF8 A;  1YLY A;  4X69 A;  3ZCZ A;  1FQG A;  2Q9M A;  1JTG A;  3PBO A;  5HX9 A;  3IH9 A;  3SS3 A;  1L0G A;  1FCO A;  3MZD A;  4BJP A;  3E2K A;  5DF9 A;  3MKE A;  1ERO A;  4FSF A;  2Y55 A;  4PM9 A;  2DNS A;  4R1G A;  3W4Q A;  4EQI A;  1I2S A;  4QY6 A;  4U0X A;  4JF5 A;  3ZNY A;  2WZZ A;  2FFF B;  1TEM A;  3Q82 A;  1LI0 A;  1DJA A;  2Y2P A;  5HW3 A;  1PWD A;  5E2G A;  4E3J A;  1MWU A;  5FSR A;  4BEN A;  3HLG A;  1K55 A;  2J9P A;  5FAO A;  2G2W A;  3V39 A;  3Q81 A;  4E3I A;  3PBR A;  1CEG A;  3SH7 A;  3BLM A;  4EBL A;  3P98 A;  2WGI A;  2Y2H A;  5CHM A;  5KZH A;  2EFU A;  1PI5 A; 
#chains in the Genus database with same CATH topology
 1JFI A;  1NRJ A;  3HL9 A;  4EO5 C;  4QU3 A;  2Q9N A;  4Z2K A;  5CTN A;  4EEU A;  3C7V A;  3KXB C;  5B2I C;  5JRG A;  3FYZ A;  3WAA D;  4G91 C;  5GXQ A;  3AZF D;  2P9V A;  4J8X D;  4HES A;  5AQA A;  5KDM B;  1GHI A;  5GLC A;  2XSS A;  3OPH A;  3A0S A;  3T4Q A;  5CER A;  1C3B A;  2KX6 A;  4N1H A;  3VP3 A;  4IVI A;  3QP2 A;  1ERM A;  4RVA A;  3MFD A;  4BBT A;  5HWW A;  3C30 A;  3TU4 C;  2KOI A;  2NZD D;  3UT9 C;  3LID A;  5EPH A;  4DMZ A;  3ITB A;  3NHQ A;  5B0Z C;  4J8W A;  2BTF P;  3AV2 C;  3DTM A;  3HVF A;  4OKP A;  3R7W A;  3KYZ A;  1QMF A;  2Y2M A;  3AZE A;  3REJ A;  3X1S D;  3W97 A;  4KGC C;  1P3K B;  3HUO A;  3C38 A;  4GKU A;  1TZY B;  1K38 A;  3UE3 A;  2FFY A;  1HQ3 A;  4ME4 A;  1W5D A;  5CGW A;  2V2F F;  3G4P A;  3EPH A;  4XUX A;  1ULY A;  4Z5T D;  3VP4 A;  1J7M A;  3ZGA B;  5F69 A;  3QP5 A;  2HIO B;  4EUZ A;  2IOU A;  3MGS B;  3L29 A;  3IHB A;  2W8S A;  1M18 C;  1E25 A;  4YM6 A;  2WKH A;  3PAG A;  2RVQ D;  4MDZ A;  3GV9 A;  4PKY A;  4ZDX A;  2Y4A A;  5FAQ A;  4JLF A;  1IEL A;  3D4F A;  3N6I A;  2ZL1 A;  3PAE A;  4Z1W A;  2ARO D;  2PYO B;  1L0E A;  2QJ5 A;  3MJQ A;  5HD5 A;  1K6R A;  4HQA A;  4C6Y A;  2JSS A;  1KVM A;  1WYC A;  3L27 A;  2ZM5 A;  5CP6 D;  5EVI A;  5F99 D;  4DE1 A;  3MQL A;  3WD3 A;  2VV6 A;  4WNN B;  1P0Z A;  2JCH A;  3MGR C;  1JWP A;  3KUY B;  3C7U A;  3UE1 A;  2INW A;  1GSX A;  4X68 A;  2EX2 A;  4LRY C;  5B33 A;  5DNN B;  4KQO A;  1P34 B;  4PM5 A;  3AZI A;  3ZHH A;  2ZJ9 A;  5G18 A;  3REK C;  3EGD C;  4IBK A;  5HPI A;  4L0L A;  5EVL A;  4OJL A;  3FKW A;  2R9X A;  1KX4 B;  4XUJ C;  5KIZ A;  5HL1 A;  3UE0 A;  5IT5 A;  3WX7 A;  4CLC A;  5AV9 B;  3O87 A;  1TS8 A;  4IBR A;  3IXH A;  3NOT C;  4R70 A;  4RX3 A;  1S6R A;  3PHY A;  1P3O C;  1CEF A;  3KSH A;  4S2I A;  1P3G D;  4ZBJ B;  3AZJ C;  1VET B;  4O0P A;  1Y54 A;  3LY3 A;  2WK0 A;  4GD6 A;  3LR4 A;  1U35 C;  3W98 B;  4JJN C;  2PYP A;  2WKP A;  2ZQ7 A;  1EQZ D;  1S1Z A;  4X1L A;  1ZLA D;  1P3M B;  4JF4 A;  2W3G A;  5B0Y C;  4LG2 A;  3AZN C;  3MXQ A;  5AVB B;  3BWL A;  4I39 A;  4DE3 A;  1MY8 A;  1XJ2 A;  1MKM A;  2VV7 A;  4F3L B;  5GT0 B;  3UTA B;  3NI9 A;  3WA9 B;  3N8R A;  2ZM2 A;  5DNM D;  1P3B B;  2HF6 A;  2PT7 A;  4NG2 A;  5GSU A;  3UE6 A;  1BSG A;  2M1C A;  2RIQ A;  4KHA A;  1DJB A;  3T4T A;  4Q8I A;  1M19 B;  2HP5 A;  3AFA D;  3OZH A;  3KXB A;  4ID4 A;  2C6W B;  4BL2 A;  3MNN A;  3E4Q A;  5GT3 D;  5FAS A;  3QP4 A;  4BQM A;  5FQ9 A;  3MVD C;  2PDR A;  4UAA A;  1L0D A;  3HJI A;  5FAP A;  3AYW C;  3X1T C;  3W2Z A;  5L2F A;  2W3F A;  2XQZ A;  3O3V A;  3R45 A;  2IWC A;  2G5H C;  3SH9 A;  2O9C A;  5B32 D;  4J8U C;  4Z66 C;  4HMD A;  4OJP A;  3TU4 A;  3N8L A;  4HEF A;  3REH C;  4PHT A;  1PI4 A;  1N1J B;  1R4V A;  1FCN A;  1OJ5 A;  5B0Z A;  3EPK A;  2ZQD A;  4ZUX C;  5EM1 A;  3MBZ A;  1TAF A;  3M7P A;  2V8C A;  4Y0U A;  5HFO A;  1PZR A;  4KGC A;  1OGB A;  3T50 A;  3TJZ C;  4H8R A;  4CSR A;  1K25 A;  4UEY A;  4X23 D;  5C3I B;  3GRJ A;  1H8M A;  4GDB A;  3BYD A;  1Q9C A;  3AZG C;  4F94 A;  1B6W A;  4KQQ A;  4LEN A;  4BL3 A;  1ID3 D;  4IHQ A;  2PYO C;  4BBU A;  4L9F A;  3BQ8 A;  5AV6 B;  2CV5 A;  1M18 A;  3A3J A;  3V50 A;  2P74 A;  4WN5 A;  4KUD C;  5F1F A;  3HLD A;  3B6F B;  3IBJ A;  1P3P B;  3E0Y A;  3LIE A;  2GX5 A;  2FJ7 B;  5HAQ A;  1HLU P;  1KX5 B;  2G2U A;  3CI6 A;  5CHL B;  4LD9 C;  4LFU A;  2DRW A;  3X1V B;  3HLB A;  4S2M A;  5IU1 A;  1G6A A;  2L1M A;  3AZK D;  5AY8 C;  5CPJ B;  1GOI A;  1ZTU A;  4MBH A;  3OLO A;  2WGW B;  3Q1F A;  1G5U A;  3MGR A;  4JGP A;  2XFT A;  3DTK A;  3SZT A;  1V9Z A;  1BUE A;  4DRT A;  1W1V A;  5HDC A;  1HVB A;  1K6S A;  4TX8 A;  4OON A;  3IS2 B;  3H0M C;  1ED7 A;  4LV1 A;  1VHM A;  3WD1 A;  2QHK A;  3HRE A;  3LJA D;  1S32 A;  5JRG B;  5L10 A;  4DDY A;  5I5L A;  2IWB A;  5AV8 C;  3A6N B;  3AV1 A;  1BYW A;  2P9V B;  4ZBJ C;  4QJG A;  2XEP A;  3L2A A;  4IBC A;  4JXW A;  3VP0 A;  1K0K A;  3ULF A;  3O62 B;  3WKJ D;  1DP8 A;  1IKG A;  3M6H A;  2Z6C A;  4Q0I A;  4R8P C;  3UPO A;  1HD8 A;  1IEM A;  4M6B A;  1Q2Q A;  1KGF A;  1YU1 A;  3UN7 A;  1FR6 A;  4AWL B;  1KX3 C;  3WS1 A;  3LYX A;  3UTA C;  1MWT A;  1U35 A;  4H9N A;  1M1A B;  4JJN A;  3G35 A;  2ZY3 A;  2WZX A;  4JXS A;  3KWQ A;  5CPK D;  1EI5 A;  4YS3 B;  4BD0 A;  5B0Y A;  5AVC C;  3GEC A;  5FEF A;  3SW1 A;  2VGL M;  4R3B A;  3NDG A;  2XR0 A;  3AZN A;  3ZNT A;  2HDS A;  2HUE C;  2PD7 A;  3AZE B;  3REJ B;  3W97 B;  1P3F A;  5FI7 A;  3MFX A;  1HQ3 B;  5TR7 A;  5B1M C;  5FA7 A;  4NZ1 A;  3F1O A;  1P3L A;  1FSW A;  4PPR A;  4UHU A;  1UR9 A;  2A24 A;  3T1Q B;  1YPR A;  3GSG A;  5FQJ A;  2GZA A;  3DW0 A;  3BW6 A;  2NQB A;  5B31 B;  1IYP A;  4J8V A;  3IWO A;  5J7E A;  4NY2 A;  4Z2G A;  4LPZ A;  3MVD A;  1KS0 A;  3LUQ A;  3AN2 B;  3Q7V A;  1E3U D;  2ZL1 B;  3C4P A;  1BH8 A;  5DVA A;  4H6J A;  1XA7 A;  2YFV A;  2HPB A;  3ZG0 A;  3SOI A;  3IBR A;  4EBP A;  2BYK A;  2L0W A;  2PBY A;  1F66 C;  2BAS A;  1K56 D;  2VA0 A;  4N9K A;  4J8U A;  4YWZ A;  1LLB A;  2LY8 A;  1YU0 A;  4FTX A;  5B24 A;  3REH A;  1P3K D;  5C3I C;  1TZY D;  3LZ0 C;  1KU5 A;  2WKR A;  4WZ5 A;  1A7W A;  4Z9Q A;  5AV5 C;  3LCE A;  3R4K A;  3IP4 C;  4ZUX A;  3BFD A;  4KZ8 A;  4QLC C;  4WM9 A;  3SS4 A;  4DQY B;  4B4Z A;  2OAP 1;  2HIO D;  3AZI B;  1K4F A;  3MGS D;  3AZH C;  5DTT A;  3HLC A;  3MGQ A;  1K54 A;  4GN2 A;  3CWF A;  4B88 A;  3AZG A;  4EV4 A;  5IS1 A;  4CLC B;  5B1L B;  3FKE A;  1MWS A;  4Z2H A;  3IX8 A;  3ZCZ A;  2PYO D;  5HX9 A;  3WAA C;  3IH9 A;  1L0G A;  3AZF C;  4J8X C;  4BJP A;  4KUD A;  4FSF A;  2Y55 A;  4PM9 A;  3W4Q A;  4QY6 A;  3LEL A;  1YU4 A;  4KUK A;  4E3J A;  2AVX A;  3KUY D;  1H3Q A;  4EBL A;  2NZD C;  5AY8 A;  2WGI A;  5DNN D;  1P34 D;  3D9Y A;  1P3I B;  1GSV A;  2VX8 A;  3BLS A;  3VH5 T;  3UME A;  3QP6 A;  4DN0 A;  1L3L A;  2RL3 A;  4NKP A;  1TDL A;  1Q2P A;  2ZQC A;  3A1I A;  5GSU B;  1KX4 D;  4DDS A;  3FV7 A;  4ETX A;  4KHA B;  3X1S C;  5AV9 D;  4FUW A;  1E4D A;  1VEU A;  3MNN B;  3C1C B;  3LR5 A;  5FDH A;  4DE0 A;  4Z5T C;  4E6W A;  3LZ1 A;  3VH6 W;  3W98 D;  5HAR A;  2Z2L B;  3WS4 A;  2L4R A;  4R8P A;  1JTD A;  3MR0 A;  4ZRR A;  1P3M D;  3EEA A;  4HJ6 A;  2RVQ C;  4EEP A;  2O0Y A;  5TBM A;  5DFY A;  4S2J A;  5AVB D;  3IQA A;  1QME A;  3VP2 A;  5EVE A;  5HPF A;  5GT0 D;  3UTA D;  4O01 A;  2ARO C;  3JPU A;  5HAP A;  1N4O A;  2RCX A;  1XJ6 A;  1B67 A;  3WA9 D;  2J3T D;  3NC8 A;  5EUA A;  1P3B D;  1EAK A;  3UTB B;  3C1B B;  3F1N B;  1RGZ A;  4GHI A;  5FEG A;  5CP6 C;  4KZ3 A;  4N1X A;  5B31 C;  5F99 C;  4R23 A;  1M19 D;  2H0Y A;  5B1M A;  3G31 A;  4Y0T A;  4MN7 A;  4YNR A;  3W96 B;  4HH3 A;  1NYM A;  4E3O A;  4R4S A;  3T4L A;  4WU9 B;  1N9B A;  1NWZ A;  1GHM A;  5HD3 A;  4RA7 A;  3TSG A;  4UUZ A;  3N4I A;  3OC2 A;  2CV5 B;  3WD2 A;  1AOI B;  3E2L A;  2Y59 A;  4KUO A;  1S66 L;  2ZBB A;  3S7P A;  1CQA A;  3H0R C;  5CXW A;  2Y2N A;  1PZO A;  4X55 A;  1F2K A;  4MNR A;  3N3F A;  3TOI A;  3OOV A;  1WE4 A;  3W8K A;  3HLW A;  1F66 A;  3W99 A;  3VFF A;  4G3K A;  1P3G C;  1YSQ A;  1FR1 A;  2V0W A;  4MLL A;  3D3O A;  1IFQ A;  2V0U A;  1EQZ C;  4C75 A;  1ZLA C;  3WRZ A;  4ESP A;  1OT9 A;  4HMC A;  4OQI A;  4Y2F A;  3P09 A;  1NZO A;  2F8N K;  2VV8 A;  2YFW B;  1K55 C;  5FI6 A;  1XJ3 A;  3LEZ A;  3B33 A;  1S32 B;  1ZHH B;  2VEA A;  4PM8 A;  2PR6 A;  1EWZ A;  2HDU A;  5AV6 D;  4IBI A;  4GCZ A;  2P08 A;  1WWS A;  3AV1 B;  3G34 A;  3A3E A;  3IF6 C;  3KSG A;  3TG9 A;  3B6F D;  2O9A A;  1P3P D;  4OPQ A;  1BTL A;  2FJ7 D;  3AFA C;  3ZVW A;  5AVE A;  1KX5 D;  5TJJ A;  2XLN A;  2JKR M;  3NQU B;  5GT3 C;  2Y2J A;  5L09 A;  3REL A;  3X1V D;  3WTP B;  4CAY B;  1P3I C;  2ZQ9 A;  4EWF A;  5CPJ D;  3LEQ A;  2X71 A;  2ZMA A;  1XKZ A;  5DJT A;  1KDW A;  5CGX A;  4NET A;  1YSP A;  4HY8 A;  2EX8 A;  4RX2 A;  5B32 C;  3IXD A;  2DQN C;  3MQ0 A;  1ZG6 A;  2NZD A;  1P3F B;  1OTE A;  4B4X A;  1DY6 A;  4N9L A;  3N8S A;  3C1C C;  2KDK A;  5JRG D;  2Y2Q A;  5FQI A;  3U4L P;  1VQQ A;  3A6N D;  1P3L B;  4NXE A;  4GLQ A;  2A24 B;  2C5W B;  1YLW A;  4WLA A;  4Y3I A;  3BM6 A;  1LL5 A;  4CJN A;  3X1S A;  4OPR A;  1DRM A;  3O62 D;  1DJC A;  4Y5F A;  2NQB B;  5G4Y A;  1W8Q A;  4DKI A;  3A0V A;  2EX6 A;  4X23 C;  1OTI A;  4E45 A;  2EXB A;  4J8V B;  2GJ3 A;  4Z5T A;  4MB5 A;  5BPV A;  3EQV A;  3Q7V B;  3RXX A;  5B40 B;  1J9M A;  5GHX A;  1ID3 C;  3MZE A;  3LO7 A;  3MSH A;  4PM6 A;  3CUE C;  4EQ1 A;  1M1A D;  2YFV B;  2FH5 A;  1MWR A;  2KLI A;  4OH0 A;  2BYK B;  3S7O A;  4YS3 D;  1XGJ A;  1ES5 A;  2VKS A;  5GHZ A;  3L25 A;  3IF5 A;  2QJ7 A;  4EES A;  3N7W A;  3TE8 A;  5IHV A;  3AZE D;  5E5A B;  3REJ D;  3W97 D;  5B24 B;  2J8Y A;  4IBE A;  1OJG A;  2QPN A;  4I5S A;  1HQ3 D;  3MGP A;  1U60 A;  4MB4 A;  4BD1 A;  3WD0 A;  3AZK C;  4QD4 A;  5HDD A;  2V5O A;  4QB8 A;  2ZY4 A;  5U47 A;  4G3W A;  4DE2 A;  3T1S A;  3REI A;  5JYO A;  2OWJ A;  5B31 D;  5B2J B;  4U0T A;  5GL9 A;  5HL6 A;  3MGQ B;  1GA9 A;  5A93 A;  3JYI A;  1H8Y A;  3AN2 D;  2H28 A;  3LJA C;  4BLM A;  1Z6F A;  2BYM B;  3VH5 A;  3S4X A;  3V9R B;  2CMN A;  1TS6 A;  4NZ4 A;  3E4P A;  3H7W A;  5M1A A;  3NBL A;  4IBG A;  3BY9 A;  5BNV A;  5E2F A;  3PXP A;  3MS6 A;  5EE8 A;  4WU8 A;  3WKJ C;  1STZ A;  4OQG A;  3LEL B;  3K3D A;  3FPW A;  1P3G A;  3AL0 C;  5EV0 A;  3BRM A;  3EOI A;  2JE5 A;  2JKF A;  4GS9 A;  4JXV A;  3MQQ A;  4XZQ A;  3B0D C;  3LIA A;  4L9G A;  4WEL A;  3ZQ5 A;  5BO0 A;  5CPK C;  1PIO A;  4EU0 A;  4HGA C;  2EXA A;  3AZI D;  3A3I A;  3BFE A;  3B6G A;  4FH4 A;  3M2K A;  5FUG B;  4KZ6 A;  3AZM A;  1T3U A;  2ZLY A;  5CPI B;  1P3A B;  4CLC D;  5B1L D;  1CXW A;  3KX0 X;  3PBQ A;  1VEU B;  3KYQ A;  1N9L A;  5HAI A;  5DNM A;  2P04 A;  3TW8 A;  2Y2K A;  1V9Y A;  4LRZ E;  3LZ1 B;  3X1U B;  1BUL A;  4HHD A;  3AFA A;  1ZG4 A;  3B0C W;  3AZL B;  3OCL A;  1F1E A;  3W4P A;  1BLP A;  5GT3 A;  3JVV A;  5B2I A;  5TBM B;  3C4O A;  3B42 A;  3RXW A;  2V1Z A;  2OOL A;  4IUK A;  4ZJ1 A;  2K31 A;  2Y2O A;  1P3I D;  1YMX A;  5G49 A;  2IO5 B;  4NE6 A;  3DAV A;  4P6B A;  5GSU D;  2EX9 A;  1H3O A;  2BG1 A;  2VGL S;  4JF6 A;  1MBL A;  4HNB A;  5KSH A;  5LBR A;  1P3K C;  1BH9 B;  3P5J B;  3UT9 A;  4KQD A;  1OTD A;  1TZY C;  2XA7 M;  2EA9 A;  3UB5 P;  1RP5 A;  4YOF A;  3MNN D;  4H9P A;  1LI9 A;  3C1C D;  2F8N A;  2ZM0 A;  3AV2 A;  3UDX A;  2ZM8 A;  2V8F A;  4GNU A;  2PU4 A;  3KO6 A;  3BEC A;  2HIO C;  4UUZ B;  4ETZ A;  3BFC A;  3MGS C;  3IXG A;  3BEB A;  2XD5 A;  4S2N C;  2V1A A;  1ID3 A;  4ZBE A;  1M6K A;  3CUE A;  4N92 A;  1E6R A;  3W99 B;  1CK3 A;  1CI8 A;  2XD1 A;  1TDG A;  3VP1 A;  3VH6 A;  4CPK A;  2FZ0 A;  3UTB D;  4NZ3 A;  3C1B D;  5HDS A;  3PBS A;  2HDR A;  3MXS A;  3NCK A;  1YKD A;  3BFG A;  3G30 A;  2WKE A;  1XX2 A;  1KE3 A;  1BFM A;  3KUY C;  1YLJ A;  4Q0H A;  4IJE A;  3W96 D;  1XFQ A;  4GW9 A;  1H0I A;  4KZ9 A;  3AZK A;  5DNN C;  1P34 C;  2ZC6 B;  4WU9 D;  5EOE A;  4QWO A;  3ZG8 B;  1PDC A;  4B9O A;  3NQJ A;  2ZY5 A;  4H9Q A;  1KE4 A;  3FKV A;  3NY4 A;  3EGX C;  2GDN A;  1H8Z A;  4OOL A;  1AIW A;  1AOI D;  4X69 A;  1KX4 C;  1LSW A;  4Y17 A;  3MZD A;  5AV9 C;  1JFI B;  1P9R A;  3LJA A;  4JGR A;  3HJK A;  4LLO B;  4M4X A;  1I2S A;  4U0X A;  4JF5 A;  3ZNY A;  1F9I A;  5HW3 A;  3REK A;  1PWD A;  5E2G A;  5FL3 A;  3UB7 A;  5GXQ B;  3REL B;  4BEN A;  4XUJ A;  4RQ9 A;  3FPV A;  3W98 C;  3A0R A;  3PBR A;  3T1X A;  3SH7 A;  3BLM A;  3LIB A;  2Y2H A;  1AWI A;  2EFU A;  4HH2 A;  1P3M C;  4FOF A;  1RCJ A;  5CHU A;  4KZ7 A;  2DCF A;  1M40 A;  1HTA A;  1P3A C;  1P3O A;  4NYY A;  4Z2J A;  2ZC5 B;  1W2E A;  5AVB C;  2ZMV A;  4P0M A;  3S1Y A;  3OCN A;  5GT0 C;  3AZJ A;  5CPK A;  3VOY A;  2J7V A;  2XGN A;  1ESI A;  1S32 D;  4P87 A;  4BBV A;  5DJU A;  1NY0 A;  3WA9 C;  2J3T C;  4O7D A;  2XFS A;  1P3B C;  3AV1 D;  5F6A A;  3V5M A;  4J8W B;  1UWP X;  3R7W B;  5GLA A;  1IOU A;  1M19 C;  1GCE A;  2P7J A;  4K91 A;  4MEZ A;  4GHA A;  1LL9 A;  4NK3 A;  4WMC D;  1LSV A;  1H0M A;  5BS7 C;  4R6L A;  3WTP D;  5KDM A;  3CPT A;  3IWQ A;  2EWV A;  1FSY A;  4E6X A;  1T1C A;  4OVD A;  2WAE A;  2CWE A;  2YKH A;  3ZG7 B;  4MBF A;  4OLG A;  4YM6 B;  5L07 A;  4GH9 A;  4GDN A;  4R4R A;  2DF4 C;  1P3F D;  3ZG9 B;  1Z2C B;  1PWG A;  3AYW A;  3X1T A;  2K7S A;  4OP8 A;  3MGP B;  1K56 A;  3G2Y A;  1PW1 A;  3CG5 A;  1P3L D;  4OQ0 A;  1BLS A;  4Z2I A;  4XXR A;  3T4K A;  4Z66 A;  4E3L A;  3REI B;  5HSQ A;  1TZY A;  5EVI B;  2NQB D;  4AFI A;  1XJ4 A;  4PMA A;  1KGE A;  4QY5 A;  1MXO A;  3T4J A;  4ARZ A;  5KSC A;  1SCW A;  4J8V D;  2IWD A;  2YKF A;  2Y2L A;  4G92 B;  1N9N A;  5GLD A;  5B40 D;  5B33 B;  4E3K A;  3BFF A;  3F1P A;  2HIO A;  4OOY A;  5I94 A;  5AV6 C;  1KOU A;  4KQR A;  5D3O A;  2DMW A;  1P9W A;  3IWI A;  4IBB A;  3B6F C;  5BNV B;  1XP4 A;  3JVU A;  1P3P C;  5CEC A;  2FJ7 C;  5E5A D;  2FN2 A;  4WU8 B;  5B24 D;  1KX5 C;  4OP5 A;  2PYO A;  1IYQ A;  2NUT C;  4P85 A;  3UB9 A;  4DJ3 A;  4EW7 A;  4JGQ A;  2ZC3 B;  4IBJ A;  3X1V C;  2JKT I;  4GS9 B;  4MN5 A;  5DKL A;  2QWS A;  5CPJ C;  4X1M A;  1J3W A;  2VGJ A;  3EG5 B;  4XZQ B;  2W3E A;  5BO0 B;  1UWN X;  3LIC A;  4WNN A;  1O7E A;  1T18 A;  3B6G B;  5B2J D;  3CIT A;  2W0N A;  2A3U A;  5F68 A;  3MGQ D;  4LD9 A;  3AZM B;  3O86 A;  3MXR A;  1P34 A;  3Q07 A;  5CHJ A;  4R3J A;  2UV0 E;  5CX7 A;  4Y7P A;  3WWX A;  2QYB A;  2ZQA A;  2XRN A;  4O8G A;  3PTE A;  3NOP C;  4NZ5 A;  5JRG C;  1CK7 A;  1NYY A;  3A6N C;  1KX4 A;  3LIF A;  2VZW A;  1GSW A;  1TS0 A;  4UQI M;  5AV9 A;  4XUZ A;  3WTP E;  4KZ4 A;  5C5K A;  3O62 C;  4EO5 B;  2WGV A;  4BMW A;  5B31 G;  3LEL D;  3WS5 A;  1LL8 A;  3F6T A;  4HOI A;  3UDF A;  3KXB B;  5B2I B;  2WKI A;  4G91 B;  4AWL C;  3V3S A;  3GVB A;  5AV8 A;  1MZU A;  2D49 A;  2ZOI A;  1VET A;  3CLO A;  3UPN A;  5FQM A;  1M1A C;  3W98 A;  1WWI A;  4QPR A;  5G49 B;  4WYY A;  3P7N A;  4YS3 C;  1P3M A;  1DP6 A;  3B3X A;  3PBT A;  3VOL A;  1NJ4 A;  4S2P A;  3ZDJ A;  1GXD A;  3R45 B;  2W3D A;  2HDQ A;  5AVB A;  1KX3 A;  3AZE C;  2WYX A;  3REJ C;  2G5I C;  3W97 C;  3TU4 B;  5CPI D;  5GT0 A;  1P3A D;  3UTA A;  3OPR A;  2UWX A;  3UT9 B;  3FDD A;  1HQ3 C;  5J3W A;  5EM0 A;  2Z2M B;  3UB8 A;  2WAF A;  2F8N B;  5B0Z B;  4EER A;  1Z09 A;  5AVC A;  1OTA A;  2OLU A;  3SH8 A;  3AV2 B;  1VM1 A;  3HBR A;  1YU3 A;  3LZ1 D;  3BY8 A;  1TAF B;  1ES3 A;  1M19 A;  3X1U D;  1XFN A;  4IED A;  2R9W A;  4KGC B;  1S4S A;  3AZL D;  4LV3 A;  3VV4 A;  4CSR B;  4Q0J A;  1NRF A;  5A90 A;  4R38 A;  1D1J A;  1TF1 A;  3AN2 C;  4S2O A;  4C3Q A;  1BT5 A;  3CJM A;  4WV4 B;  2Y8H A;  2MJ6 A;  4UA6 A;  1NZU A;  1BLC A;  4MMN A;  1M18 B;  1CF0 A;  1G68 A;  1ONG A;  1W63 M;  1FIL A;  2PHY A;  3FC7 A;  1N1J A;  1W63 Q;  3KSI A;  4QNL A;  1N9O A;  4IBD A;  2Q0O A;  2WUQ A;  1IKI A;  4KG2 A;  3LI9 A;  1TS7 A;  3L28 A;  1HZO A;  5TGF A;  1OTB A;  4H9Q B;  3AZI C;  2JKT M;  2X01 A;  2VJW A;  5K5B A;  3OPP A;  3NDE A;  3LZ0 A;  1YLZ A;  3MGR B;  5AV5 A;  5B32 G;  4M3K A;  1NLY A;  3UO9 A;  4CLC C;  4QLC A;  5B1L C;  2PR5 A;  1S4R A;  5AV6 A;  4OJ5 A;  4HME A;  5DFX A;  2PRF A;  3Q7Z A;  3W99 D;  4OQH A;  4IJF A;  3REK B;  3AZH A;  4XUJ B;  3B6F A;  5AQB A;  3VH6 T;  3B0B A;  1P3P A;  2XDM A;  4HIA A;  4NXF A;  2ZY2 A;  4NE5 A;  3U2A A;  1KX5 A;  3MMH A;  4Z2M H;  4GOG A;  1KDS A;  2V9A A;  5BT1 D;  3WAA A;  3X1V A;  1P3O B;  3AZF A;  4J8X A;  1RGY A;  5CPJ A;  1ALQ A;  2K2N A;  3AZJ B;  2NUP C;  1E8B A;  2D01 A;  1U35 B;  4H9N B;  3WD4 A;  4JJN B;  1K57 C;  2WGW A;  2BLS A;  3KWQ B;  2PAV P;  3S7N A;  4IBF A;  1JWV A;  1OT6 A;  3NIA A;  2M7U A;  3WRT A;  5GSU C;  4JBF A;  5B0Y B;  4WUJ A;  4HP4 A;  3AZN B;  3IS2 A;  3MKF A;  2V20 A;  3G2Z A;  3MNN C;  3A6N A;  4PM7 A;  4HJ3 A;  4S2L A;  4KZ5 A;  3T4S A;  3L7H A;  2O9B A;  1ZKJ A;  3KSF A;  5GXQ D;  3REL D;  2HP6 A;  3AGE A;  3F1O B;  5BNX A;  1PWC A;  3CPT B;  3O62 A;  5F83 A;  3FZC A;  4XT2 A;  5G4Z A;  4NFT A;  3HON A;  4WEK A;  5HZH A;  2JKG A;  3OPL A;  5DF7 A;  4KZB A;  3NJA A;  3VSL A;  3MVD B;  4GHL A;  1M1A A;  4HJ4 A;  4R3A A;  2JBF A;  2VLG A;  3AYW B;  3X1T B;  1BH8 B;  4H6J B;  4YS3 A;  5EFW A;  3UTB C;  3C1B C;  1SHV A;  3M2J A;  4J8W D;  3CMZ A;  4J8U B;  3QNB A;  3H9W A;  4Z66 B;  5HWT A;  3DWK A;  2H10 A;  3EWK A;  1SKF A;  1S0W A;  2VGK A;  3GR2 A;  4E3M A;  1ONH A;  3REH B;  4H9O A;  2XA7 S;  2ARO A;  2L5A A;  4ARZ B;  1SDE A;  4NXB A;  2J9O A;  3W96 C;  3ICY A;  4P6Z M;  3DTI A;  1OME A;  4DXB A;  4ZUX B;  4WU9 C;  3F1P B;  3V67 A;  5CGS A;  4FD8 A;  5CP6 A;  3GMW A;  4MCW A;  3VE3 A;  5F99 A;  5B31 A;  2CV5 C;  1AOI C;  2M7V A;  3CZD A;  4WZS B;  2HGV A;  5AJG A;  4YM6 D;  3AN2 A;  4FCF A;  1Y28 A;  3AZG B;  1T19 A;  3EPL A;  2QMI A;  5L8M A;  2ZC7 A;  1CI9 A;  1PW8 A;  3MGP D;  2W1R A;  4WZ4 A;  4KUD B;  2OAQ 1;  2JC7 A;  1XXM A;  4ZJ2 A;  1XGI A;  3REI D;  1A0K A;  5EVI D;  4GZB A;  5FQK A;  3C8C A;  3VFH A;  1ES2 A;  3B47 A;  1YLT A;  4LD9 B;  1L0F A;  1FQG A;  3SS3 A;  1JTG A;  5B33 D;  4DJ2 A;  5AY8 B;  1FCO A;  4IUH A;  1S32 C;  4I3I A;  2W27 A;  3MKE A;  1EQZ A;  1ERO A;  2G7U A;  3AV1 C;  1ZLA A;  4R1G A;  4EQI A;  1X0O A;  1QO6 A;  1YUE A;  3D72 A;  1W1P A;  1TEM A;  3Q82 A;  1DJA A;  2Y2P A;  5B1L A;  1G6O A;  1MWU A;  4WU8 D;  1K55 A;  2W3H A;  5CHM A;  3E98 A;  2HZ5 A;  1PI5 A;  5AV8 B;  1D06 A;  1F98 A;  4YIN A;  5DTS A;  3WTP C;  3UB6 A;  2XRO A;  3EEH A;  2HJE A;  1E6P A;  3IF6 A;  4XZQ D;  3KWQ C;  5FQQ A;  3LR0 A;  5CTM A;  3S7Q A;  4H9S C;  4DXC A;  3B6G D;  4R8P B;  4I3J A;  1I5Q A;  3AZM D;  5F1G A;  1KX3 B;  5DKK A;  1P3F C;  1P3I A;  2PD8 A;  3TRC A;  3L26 A;  1K57 A;  4DRB A;  3IHA A;  5A8B A;  3H0L C;  1P3L C;  5AVC B;  5B32 A;  1PRQ A;  3A3D A;  3IX3 A;  5J4E A;  2B95 A;  2J8P A;  4HP9 A;  2ZQ8 A;  4GHI B;  2HUE B;  3M6B A;  3W4O A;  3H82 A;  2NQB C;  4R0Q A;  1HTZ A;  4LV0 A;  4JXG A;  4D60 A;  3NEC A;  3QNC A;  3KXB D;  3C1C A;  5B1M B;  4J8V C;  5TFQ A;  5B2I D;  5F5Y A;  4WF0 A;  3MZF A;  5B40 C;  4NYU A;  4E44 A;  2E8J A;  4KG6 A;  3WS2 A;  4OOM A;  1IYS A;  1CJF A;  4X23 A;  1MKI A;  2W1T A;  5BOH A;  2ZMF A;  1WA9 A;  2WKQ A;  3CHW P;  4Y15 A;  3PYP A;  2CC1 A;  5E5A C;  5B24 C;  3TU4 D;  1SZV A;  1YAX A;  3DBA A;  4EXO A;  3UT9 D;  5HWV A;  1GPF A;  4OPY A;  3VE4 A;  4WZ5 C;  4H9R A;  1E15 A;  1YT4 A;  4ZAM A;  3G32 A;  2F2A C;  1F66 B;  3UTB A;  2F8N D;  5B0Z D;  3C1B A;  3F1N A;  3LY4 A;  3WS0 A;  3AV2 D;  1E6Z A;  1S67 L;  1ACF A;  5GLB A;  5B2J C;  4KGC D;  1TD5 A;  3SS5 A;  5CEB A;  3LZ0 B;  1O07 A;  1H8P A;  3MGQ C;  2RTS A;  3W96 A;  4OJO A;  5AV5 B;  1K54 C;  2OLV A;  3C5A A;  3HLE A;  4WU9 A;  3I7J A;  4QLC B;  1NLZ A;  1EW0 A;  4Z2M G;  3HUN A;  4CLC E;  1AOI A;  2Y2G A;  3EPJ A;  3K2N A;  3AZH B;  2CV5 D;  4E3N A;  4BWI A;  1LSX A;  1M18 D;  3IH8 A;  4OPZ A;  4JPM A;  5GHY A;  4DF6 A;  1XA1 A;  4MN6 A;  5M18 A;  2B5R A;  3LEL C;  3B0C T;  4U3T A;  3IX4 A;  3QP1 A;  3WAA B;  3AZF B;  4S2K A;  4J8X B;  3AGD A;  1P97 A;  4LRX C;  3KS8 A;  3FWL A;  3RTY A;  3NUL A;  2J3W A;  1LHY A;  1BZA A;  1ZC2 A;  4L9E A;  1E88 A;  1W7F A;  5DTK A;  3WKJ A;  5FDS A;  5CED A;  4RYE A;  1S1Y A;  1KVL A;  3GTC A;  3MGR D;  1YMS A;  1JNU A;  2YFW A;  2LB9 A;  5CPI C;  2NZD B;  3EQU A;  4Z2L A;  5A91 A;  5JA4 A;  1JVJ A;  1T1A A;  3MQO A;  4WL9 A;  4I3A A;  3QHY A;  3REK D;  1SKO A;  3A3F A;  3T1R A;  1W8Y A;  1PZP A;  4XUJ D;  4LCL A;  5BNX B;  3LZ1 C;  2QKP A;  3UPP A;  4A5R A;  3X1U C;  1WYB A;  3X1S B;  4UQI S;  4XT2 B;  3AZL C;  4WMC A;  3NQU A;  5F82 A;  1O6I A;  4FH2 A;  5E43 A;  2F8N H;  1P3O D;  4CAY A;  3WTP A;  5E2H A;  4Z5T B;  4UPK A;  1YU2 A;  3RJU A;  3AZJ D;  4IBX A;  3UNW A;  2XK1 A;  2IO5 C;  1U35 D;  2HP9 A;  4JJN D;  3UY6 A;  4H9S A;  4GD8 A;  4NEE D;  3KWQ D;  3GDI A;  3IT9 A;  1L2S A;  5B0Y D;  3AZN D;  1E3U A;  4OUI A;  4ZJ3 A;  2I9V A;  4H9O B;  2ARO B;  4JKT A;  3VSK A;  3LGO A;  1PYY A;  3VH5 W;  2PYR A;  3LR3 A;  1F5M A;  4EET B;  2IA2 A;  4NXG A;  5CP6 B;  4HBT A;  5F99 B;  5EOO A;  3HLF A;  1P3K A;  3IXB A;  1ODV A;  4CQH A;  3DTE A;  3VOZ A;  1FCM A;  3RFB A;  2B18 A;  4LGW A;  5B40 A;  2Y91 A;  3MVD D;  1YQS A;  1W79 A;  5E2E A;  2Y2I A;  1SDN A;  3X1T D;  3AYW D;  3K3C A;  1PFL A;  2R78 A;  3W99 C;  3G6O A;  4KEN B;  3MGS A;  5FI2 A;  3C2W A;  1E6N A;  4OLD A;  3FG8 A;  4PAU A;  3H7W B;  4S2N A;  4J8U D;  2ZD8 A;  4Z66 D;  5E5A A;  5M19 A;  2EWW A;  3GQZ A;  4X6T A;  1GA0 A;  4HBU A;  3REH D;  3KS4 A;  3ISG A;  1BLH A;  3O5Y A;  2Z6D A;  5BT1 C;  1NXY A;  2H5S A;  4Y0O A;  1W1T A;  1P3G B;  1XPB A;  4ZUX D;  3V3R A;  2VK3 A;  1FOF A;  2H0T A;  2A49 A;  1EQZ B;  5B2J A;  1AXB A;  5JYP A;  1ZLA B;  3LFV A;  4E04 A;  5AQ7 A;  4ZTK A;  3KUY A;  3NOU C;  1OPX A;  1GHP A;  2J80 A;  2EFX A;  3ZFZ A;  5DNN A;  3E4O A;  3AZG D;  2BYM A;  2E8I A;  5A92 A;  3V9R A;  3AGF A;  3ITA A;  2QZ6 A;  4G3V A;  4B93 A;  5DNM B;  4K0X A;  5GXQ C;  3REL C;  1L6J A;  3CAX A;  4KUD D;  2LB5 A;  2ZC4 B;  1TVF A;  3IF6 B;  3ZVT A;  3AFA B;  4K0W A;  4I38 A;  4YFM A;  4Y13 A;  5GT3 B;  4LD9 D;  4JGO A;  3L9K A;  1Y4O A;  5KMW A;  4PKY G;  5J8X A;  5AY8 D;  4LV2 A;  4QHC A;  1KGG A;  3S22 A;  5FUG A;  5B32 B;  4J8W C;  1VB6 A;  4GB7 A;  2JKR I;  2OSU A;  1H3O B;  4DRA A;  5CPI A;  1P3A A;  4KG5 A;  4OJ6 A;  1DP9 A;  3H82 B;  4HI4 A;  4F3L A;  2V1B A;  4II7 A;  2XF3 A;  3WA9 A;  4X25 A;  4H9P B;  1YLP A;  5AV8 D;  1P3B A;  1K4E A;  3X1U A;  4MB3 A;  2D02 A;  4KZA A;  3KFU G;  2ZOH A;  5FAT A;  2X02 A;  3AZL A;  2ACG A;  3UDI A;  2HV1 A;  3BJN A;  3LI8 A;  1OGG A;  4X23 B;  1MPL A;  2W1T B;  1JWZ A;  4R8P D;  3P01 A;  3A1K A;  3RH8 B;  3O88 A;  2WAD A;  4YM6 C;  1KX3 D;  5BS7 A;  4UA9 A;  1LT0 A;  4X56 A;  3DWZ A;  2OWH A;  2XH9 A;  2OV5 A;  1ID3 B;  1G28 A;  4UA7 A;  1I2W A;  4H9R B;  3UMD A;  3MGP C;  4WJ3 C;  2O99 A;  5AVC D;  2I72 A;  3PR6 A;  4WEJ A;  1ES4 A;  3VMA A;  1D7E A;  1BH9 A;  3REI C;  5EVI C;  4MBK A;  1KE0 A;  5B1M D;  3HCY A;  3HUM A;  1MC0 A;  3QP8 A;  4GJ4 A;  4G92 C;  2HJ9 C;  5EEC A;  5B33 C;  4P6Z S;  4IJG A;  3AZK B;  4IVK A;  2VQR A;  3NQJ B;  1H5X A;  4NE3 A;  1YM1 A;  3OBF A;  1ESU A;  4D2O A;  2JHE A;  1FIK A;  1PNE A;  4EBN A;  1UGU A;  5AQ9 A;  5MC7 A;  5AVF A;  4WU8 C;  3LJA B;  3KSY A;  3MF0 A;  2A2L A;  4LCM A;  3ZG5 A;  2PBD P;  5CRF A;  4X53 A;  3BQA A;  1IYO A;  1F66 D;  2PU2 A;  4WBG A;  3PBN A;  1ERQ A;  4XZQ C;  5DF8 A;  1YLY A;  3T4O A;  2FJ7 A;  2Q9M A;  3WKJ B;  3PBO A;  3B6G C;  3E2K A;  3KYE A;  5DF9 A;  3LZ0 D;  4EUV A;  1H0G A;  5AV5 D;  2Y79 A;  3AZM C;  2GNX A;  2DNS A;  4QLC D;  2WZZ A;  2FFF B;  2JN7 A;  5JA4 B;  1LI0 A;  3HSH A;  3B0D B;  5CPK B;  5FSR A;  1W1Y A;  4HGA B;  3HLG A;  3T12 B;  2J9P A;  3ZYT A;  5DNM C;  5FAO A;  2G2W A;  3V39 A;  2F8N G;  3Q81 A;  4E3I A;  1SKO B;  1UR8 A;  3AZH D;  1CEG A;  3P98 A;  2B02 A;  4K08 A;  1T1B A;  5KZH A; 
#chains in the Genus database with same CATH homology
 1JFI A;  3HL9 A;  4EO5 C;  4QU3 A;  2Q9N A;  5CTN A;  3C7V A;  3KXB C;  5B2I C;  5JRG A;  3FYZ A;  3WAA D;  4G91 C;  5GXQ A;  3AZF D;  2P9V A;  4J8X D;  4HES A;  5AQA A;  5KDM B;  1GHI A;  5GLC A;  3OPH A;  5CER A;  1C3B A;  4N1H A;  3VP3 A;  4IVI A;  4RVA A;  1ERM A;  3MFD A;  3TU4 C;  2NZD D;  3UT9 C;  5EPH A;  3ITB A;  5B0Z C;  4J8W A;  3AV2 C;  3DTM A;  3HVF A;  4OKP A;  1QMF A;  2Y2M A;  3AZE A;  3REJ A;  3X1S D;  3W97 A;  4KGC C;  1P3K B;  3HUO A;  4GKU A;  1TZY B;  1K38 A;  3UE3 A;  2FFY A;  1HQ3 A;  1W5D A;  5CGW A;  2V2F F;  3G4P A;  3EPH A;  4XUX A;  1ULY A;  4Z5T D;  3VP4 A;  3ZGA B;  2HIO B;  4EUZ A;  2IOU A;  3MGS B;  3L29 A;  3IHB A;  2W8S A;  1M18 C;  1E25 A;  4YM6 A;  2WKH A;  3PAG A;  2RVQ D;  3GV9 A;  4ZDX A;  2Y4A A;  5FAQ A;  4JLF A;  1IEL A;  3D4F A;  3N6I A;  3PAE A;  2ARO D;  2PYO B;  1L0E A;  1K6R A;  4C6Y A;  2JSS A;  1KVM A;  1WYC A;  3L27 A;  2ZM5 A;  5CP6 D;  5EVI A;  5F99 D;  4DE1 A;  4WNN B;  2JCH A;  3MGR C;  1JWP A;  3KUY B;  3C7U A;  3UE1 A;  4X68 A;  2EX2 A;  5B33 A;  5DNN B;  4KQO A;  1P34 B;  4PM5 A;  3AZI A;  3ZHH A;  2ZJ9 A;  5G18 A;  3REK C;  4IBK A;  4L0L A;  5EVL A;  4OJL A;  3FKW A;  2R9X A;  1KX4 B;  4XUJ C;  5HL1 A;  3UE0 A;  3WX7 A;  5AV9 B;  3O87 A;  4IBR A;  3IXH A;  4RX3 A;  1S6R A;  1P3O C;  1CEF A;  4S2I A;  1P3G D;  4ZBJ B;  3AZJ C;  1Y54 A;  3LY3 A;  2WK0 A;  4GD6 A;  1U35 C;  3W98 B;  4JJN C;  2ZQ7 A;  1EQZ D;  1ZLA D;  1P3M B;  4JF4 A;  5B0Y C;  4LG2 A;  3AZN C;  5AVB B;  4DE3 A;  1MY8 A;  5GT0 B;  3UTA B;  3NI9 A;  3WA9 B;  3N8R A;  2ZM2 A;  5DNM D;  1P3B B;  5GSU A;  1BSG A;  2RIQ A;  4KHA A;  1DJB A;  4Q8I A;  1M19 B;  2HP5 A;  3AFA D;  3OZH A;  3KXB A;  4ID4 A;  2C6W B;  4BL2 A;  3MNN A;  5GT3 D;  5FAS A;  4BQM A;  5FQ9 A;  3MVD C;  4UAA A;  1L0D A;  5FAP A;  3AYW C;  3X1T C;  5L2F A;  2XQZ A;  3O3V A;  3R45 A;  2IWC A;  2G5H C;  3SH9 A;  5B32 D;  4J8U C;  4Z66 C;  4OJP A;  3TU4 A;  3N8L A;  4HEF A;  3REH C;  1PI4 A;  1N1J B;  1R4V A;  1FCN A;  5B0Z A;  3EPK A;  2ZQD A;  4ZUX C;  3MBZ A;  1TAF A;  4Y0U A;  5HFO A;  1PZR A;  4KGC A;  4H8R A;  4CSR A;  1K25 A;  4X23 D;  5C3I B;  3GRJ A;  4GDB A;  3BYD A;  1Q9C A;  3AZG C;  4F94 A;  1B6W A;  4KQQ A;  4LEN A;  4BL3 A;  1ID3 D;  2PYO C;  5AV6 B;  2CV5 A;  1M18 A;  3A3J A;  3V50 A;  2P74 A;  4KUD C;  5F1F A;  3HLD A;  3B6F B;  1P3P B;  2FJ7 B;  5HAQ A;  1KX5 B;  2G2U A;  5CHL B;  4LD9 C;  2DRW A;  3X1V B;  3HLB A;  4S2M A;  1G6A A;  3AZK D;  5AY8 C;  5CPJ B;  4MBH A;  2WGW B;  3Q1F A;  3MGR A;  2XFT A;  1BUE A;  4DRT A;  1HVB A;  1K6S A;  4OON A;  3H0M C;  4LV1 A;  3HRE A;  3LJA D;  1S32 A;  5JRG B;  4DDY A;  2IWB A;  5AV8 C;  3A6N B;  3AV1 A;  2P9V B;  4ZBJ C;  4QJG A;  2XEP A;  3L2A A;  4IBC A;  4JXW A;  3VP0 A;  3O62 B;  3WKJ D;  1IKG A;  3M6H A;  4R8P C;  3UPO A;  1HD8 A;  1IEM A;  4M6B A;  1Q2Q A;  1KGF A;  1YU1 A;  3UN7 A;  1FR6 A;  4AWL B;  1KX3 C;  3WS1 A;  3UTA C;  1MWT A;  1U35 A;  4H9N A;  1M1A B;  4JJN A;  3G35 A;  2ZY3 A;  2WZX A;  4JXS A;  3KWQ A;  5CPK D;  1EI5 A;  4YS3 B;  4BD0 A;  5B0Y A;  5AVC C;  4R3B A;  3NDG A;  2XR0 A;  3AZN A;  3ZNT A;  2HDS A;  2HUE C;  3AZE B;  3REJ B;  3W97 B;  1P3F A;  5FI7 A;  1HQ3 B;  5TR7 A;  5B1M C;  5FA7 A;  4NZ1 A;  1P3L A;  1FSW A;  4PPR A;  4UHU A;  3GSG A;  5FQJ A;  3DW0 A;  2NQB A;  5B31 B;  1IYP A;  4J8V A;  3IWO A;  4NY2 A;  3MVD A;  3AN2 B;  3Q7V A;  1E3U D;  3C4P A;  1BH8 A;  5DVA A;  1XA7 A;  2YFV A;  2HPB A;  3ZG0 A;  3SOI A;  4EBP A;  2BYK A;  2PBY A;  1F66 C;  1K56 D;  4N9K A;  4J8U A;  1LLB A;  2LY8 A;  1YU0 A;  5B24 A;  3REH A;  1P3K D;  5C3I C;  1TZY D;  3LZ0 C;  1KU5 A;  4WZ5 A;  1A7W A;  4Z9Q A;  5AV5 C;  3LCE A;  3IP4 C;  4ZUX A;  3BFD A;  4KZ8 A;  4QLC C;  4WM9 A;  3SS4 A;  4DQY B;  4B4Z A;  2HIO D;  3AZI B;  1K4F A;  3MGS D;  3AZH C;  5DTT A;  3HLC A;  3MGQ A;  1K54 A;  4GN2 A;  4B88 A;  3AZG A;  4EV4 A;  5B1L B;  3FKE A;  1MWS A;  3ZCZ A;  2PYO D;  5HX9 A;  3WAA C;  3IH9 A;  1L0G A;  3AZF C;  4J8X C;  4BJP A;  4KUD A;  4FSF A;  2Y55 A;  4PM9 A;  3W4Q A;  4QY6 A;  3LEL A;  1YU4 A;  4E3J A;  3KUY D;  4EBL A;  2NZD C;  5AY8 A;  2WGI A;  5DNN D;  1P34 D;  1P3I B;  3BLS A;  3VH5 T;  2RL3 A;  1TDL A;  1Q2P A;  2ZQC A;  3A1I A;  5GSU B;  1KX4 D;  4DDS A;  3FV7 A;  4KHA B;  3X1S C;  5AV9 D;  1E4D A;  3MNN B;  3C1C B;  5FDH A;  4DE0 A;  4Z5T C;  4E6W A;  3LZ1 A;  3VH6 W;  3W98 D;  5HAR A;  2Z2L B;  3WS4 A;  4R8P A;  1JTD A;  1P3M D;  2RVQ C;  4S2J A;  5AVB D;  3IQA A;  1QME A;  3VP2 A;  5GT0 D;  3UTA D;  2ARO C;  5HAP A;  1N4O A;  2RCX A;  1B67 A;  3WA9 D;  5EUA A;  3NC8 A;  1P3B D;  3UTB B;  3C1B B;  1RGZ A;  5CP6 C;  4KZ3 A;  4N1X A;  5B31 C;  5F99 C;  4R23 A;  1M19 D;  2H0Y A;  5B1M A;  3G31 A;  4Y0T A;  3W96 B;  1NYM A;  4E3O A;  4R4S A;  4WU9 B;  1N9B A;  1GHM A;  4RA7 A;  3TSG A;  4UUZ A;  3N4I A;  3OC2 A;  2CV5 B;  1AOI B;  3E2L A;  2Y59 A;  3H0R C;  5CXW A;  2Y2N A;  1PZO A;  4X55 A;  4MNR A;  3N3F A;  3TOI A;  1WE4 A;  3W8K A;  3HLW A;  1F66 A;  3W99 A;  3VFF A;  1P3G C;  1FR1 A;  4MLL A;  1EQZ C;  4C75 A;  1ZLA C;  3WRZ A;  4OQI A;  3P09 A;  1NZO A;  2F8N K;  2YFW B;  1K55 C;  5FI6 A;  3LEZ A;  1S32 B;  4PM8 A;  1EWZ A;  2HDU A;  5AV6 D;  4IBI A;  1WWS A;  3AV1 B;  3G34 A;  3A3E A;  3IF6 C;  3TG9 A;  3B6F D;  1P3P D;  4OPQ A;  1BTL A;  2FJ7 D;  3AFA C;  3ZVW A;  1KX5 D;  2XLN A;  3NQU B;  5GT3 C;  2Y2J A;  3REL A;  3X1V D;  3WTP B;  4CAY B;  1P3I C;  2ZQ9 A;  4EWF A;  5CPJ D;  2X71 A;  2ZMA A;  1XKZ A;  1KDW A;  5CGX A;  4NET A;  2EX8 A;  4RX2 A;  5B32 C;  3IXD A;  2DQN C;  1ZG6 A;  2NZD A;  1P3F B;  4B4X A;  1DY6 A;  4N9L A;  3N8S A;  3C1C C;  5JRG D;  2Y2Q A;  5FQI A;  1VQQ A;  3A6N D;  1P3L B;  1YLW A;  2C5W B;  3BM6 A;  1LL5 A;  4CJN A;  3X1S A;  4OPR A;  3O62 D;  1DJC A;  2NQB B;  1W8Q A;  4DKI A;  2EX6 A;  4X23 C;  4E45 A;  2EXB A;  4J8V B;  4Z5T A;  5BPV A;  3EQV A;  3Q7V B;  3RXX A;  5B40 B;  1J9M A;  5GHX A;  1ID3 C;  3MZE A;  3LO7 A;  4PM6 A;  1M1A D;  2YFV B;  1MWR A;  4OH0 A;  2BYK B;  4YS3 D;  1XGJ A;  1ES5 A;  5GHZ A;  3L25 A;  3IF5 A;  3N7W A;  5IHV A;  3AZE D;  5E5A B;  3REJ D;  3W97 D;  5B24 B;  2J8Y A;  4IBE A;  2QPN A;  1HQ3 D;  3MGP A;  1U60 A;  4BD1 A;  3AZK C;  4QD4 A;  4QB8 A;  2ZY4 A;  5U47 A;  4DE2 A;  3REI A;  5JYO A;  5B31 D;  5B2J B;  4U0T A;  5GL9 A;  3MGQ B;  1GA9 A;  5A93 A;  3JYI A;  1H8Y A;  3AN2 D;  3LJA C;  4BLM A;  1Z6F A;  2BYM B;  3VH5 A;  3S4X A;  3V9R B;  4NZ4 A;  5M1A A;  3NBL A;  4IBG A;  5BNV A;  5E2F A;  5EE8 A;  4WU8 A;  3WKJ C;  4OQG A;  3LEL B;  1P3G A;  3AL0 C;  3BRM A;  2JE5 A;  4JXV A;  4XZQ A;  3B0D C;  4WEL A;  5BO0 A;  5CPK C;  1PIO A;  4HGA C;  2EXA A;  3AZI D;  3A3I A;  3BFE A;  3B6G A;  4FH4 A;  3M2K A;  5FUG B;  4KZ6 A;  3AZM A;  1T3U A;  2ZLY A;  5CPI B;  1P3A B;  5B1L D;  3PBQ A;  5HAI A;  5DNM A;  2Y2K A;  3LZ1 B;  3X1U B;  1BUL A;  3AFA A;  1ZG4 A;  3B0C W;  3AZL B;  3OCL A;  1F1E A;  3W4P A;  1BLP A;  5GT3 A;  5B2I A;  3C4O A;  3RXW A;  2V1Z A;  4ZJ1 A;  2Y2O A;  1P3I D;  1YMX A;  5G49 A;  2IO5 B;  4NE6 A;  4P6B A;  5GSU D;  2EX9 A;  1H3O A;  2BG1 A;  4JF6 A;  1MBL A;  5KSH A;  1P3K C;  1BH9 B;  3P5J B;  3UT9 A;  1TZY C;  1RP5 A;  3MNN D;  4H9P A;  1LI9 A;  3C1C D;  2F8N A;  2ZM0 A;  3AV2 A;  3UDX A;  2ZM8 A;  4GNU A;  2PU4 A;  3BEC A;  2HIO C;  4UUZ B;  3BFC A;  3MGS C;  3IXG A;  3BEB A;  2XD5 A;  4S2N C;  1ID3 A;  4ZBE A;  1M6K A;  4N92 A;  3W99 B;  1CK3 A;  1CI8 A;  2XD1 A;  1TDG A;  3VP1 A;  3VH6 A;  4CPK A;  3UTB D;  4NZ3 A;  3C1B D;  3PBS A;  2HDR A;  3MXS A;  3NCK A;  3BFG A;  3G30 A;  2WKE A;  1XX2 A;  1KE3 A;  1BFM A;  3KUY C;  1YLJ A;  4IJE A;  3W96 D;  4KZ9 A;  3AZK A;  5DNN C;  1P34 C;  2ZC6 B;  4WU9 D;  5EOE A;  3ZG8 B;  3NQJ A;  2ZY5 A;  4H9Q A;  1KE4 A;  3FKV A;  3NY4 A;  2GDN A;  1H8Z A;  4OOL A;  1AOI D;  4X69 A;  1KX4 C;  3MZD A;  5AV9 C;  1JFI B;  3LJA A;  1I2S A;  4U0X A;  4JF5 A;  3ZNY A;  5HW3 A;  3REK A;  1PWD A;  5E2G A;  5GXQ B;  3REL B;  4BEN A;  4XUJ A;  3W98 C;  3PBR A;  3SH7 A;  3BLM A;  2Y2H A;  2EFU A;  1P3M C;  1RCJ A;  5CHU A;  4KZ7 A;  2DCF A;  1M40 A;  1HTA A;  1P3A C;  1P3O A;  4NYY A;  2ZC5 B;  1W2E A;  5AVB C;  4P0M A;  3S1Y A;  3OCN A;  5GT0 C;  3AZJ A;  5CPK A;  3VOY A;  2J7V A;  2XGN A;  1ESI A;  1S32 D;  4P87 A;  1NY0 A;  3WA9 C;  4O7D A;  2XFS A;  1P3B C;  3AV1 D;  3V5M A;  4J8W B;  5GLA A;  1M19 C;  1GCE A;  4K91 A;  4MEZ A;  4GHA A;  1LL9 A;  4NK3 A;  4WMC D;  5BS7 C;  3WTP D;  5KDM A;  3IWQ A;  1FSY A;  4E6X A;  4OVD A;  2WAE A;  2CWE A;  3ZG7 B;  4MBF A;  4OLG A;  4YM6 B;  4GH9 A;  4GDN A;  4R4R A;  2DF4 C;  1P3F D;  3ZG9 B;  1Z2C B;  1PWG A;  3AYW A;  3X1T A;  4OP8 A;  3MGP B;  1K56 A;  3G2Y A;  1PW1 A;  3CG5 A;  1P3L D;  4OQ0 A;  1BLS A;  4XXR A;  4Z66 A;  4E3L A;  3REI B;  1TZY A;  5EVI B;  2NQB D;  4PMA A;  1KGE A;  4QY5 A;  1MXO A;  5KSC A;  1SCW A;  4J8V D;  2IWD A;  2Y2L A;  4G92 B;  5GLD A;  5B40 D;  5B33 B;  4E3K A;  3BFF A;  2HIO A;  4OOY A;  5I94 A;  5AV6 C;  4KQR A;  5D3O A;  3IWI A;  4IBB A;  3B6F C;  5BNV B;  1XP4 A;  1P3P C;  5CEC A;  2FJ7 C;  5E5A D;  4WU8 B;  5B24 D;  1KX5 C;  4OP5 A;  2PYO A;  1IYQ A;  4P85 A;  2ZC3 B;  4IBJ A;  3X1V C;  5CPJ C;  2VGJ A;  3EG5 B;  4XZQ B;  5BO0 B;  4WNN A;  1O7E A;  3B6G B;  5B2J D;  2A3U A;  3MGQ D;  4LD9 A;  3AZM B;  3O86 A;  3MXR A;  1P34 A;  3Q07 A;  5CHJ A;  4R3J A;  4Y7P A;  3WWX A;  2ZQA A;  3PTE A;  4NZ5 A;  5JRG C;  1NYY A;  3A6N C;  1KX4 A;  5AV9 A;  4XUZ A;  3WTP E;  4KZ4 A;  3O62 C;  4EO5 B;  2WGV A;  5B31 G;  3LEL D;  3WS5 A;  3F6T A;  3UDF A;  3KXB B;  5B2I B;  2WKI A;  4G91 B;  4AWL C;  3V3S A;  3GVB A;  5AV8 A;  3UPN A;  5FQM A;  1M1A C;  3W98 A;  1WWI A;  5G49 B;  4WYY A;  4YS3 C;  1P3M A;  3B3X A;  3PBT A;  1NJ4 A;  4S2P A;  3ZDJ A;  3R45 B;  2HDQ A;  5AVB A;  1KX3 A;  3AZE C;  2WYX A;  3REJ C;  2G5I C;  3W97 C;  3TU4 B;  5CPI D;  5GT0 A;  1P3A D;  3UTA A;  3OPR A;  2UWX A;  3UT9 B;  3FDD A;  1HQ3 C;  2Z2M B;  2WAF A;  2F8N B;  5B0Z B;  3SH8 A;  5AVC A;  2OLU A;  3AV2 B;  1VM1 A;  3HBR A;  1YU3 A;  3LZ1 D;  1TAF B;  1ES3 A;  1M19 A;  3X1U D;  4IED A;  2R9W A;  4KGC B;  3AZL D;  4LV3 A;  4CSR B;  5A90 A;  1NRF A;  3AN2 C;  4S2O A;  4C3Q A;  1BT5 A;  3CJM A;  4WV4 B;  4UA6 A;  1NZU A;  1BLC A;  1M18 B;  1G68 A;  1ONG A;  1N1J A;  4QNL A;  4IBD A;  2WUQ A;  1IKI A;  4KG2 A;  3L28 A;  1HZO A;  5TGF A;  4H9Q B;  3AZI C;  2X01 A;  3OPP A;  3NDE A;  3LZ0 A;  1YLZ A;  3MGR B;  5AV5 A;  5B32 G;  4M3K A;  3UO9 A;  4QLC A;  5B1L C;  5AV6 A;  4OJ5 A;  3Q7Z A;  3W99 D;  4OQH A;  4IJF A;  3REK B;  3AZH A;  4XUJ B;  3B6F A;  5AQB A;  3VH6 T;  3B0B A;  1P3P A;  2XDM A;  2ZY2 A;  4NE5 A;  1KX5 A;  4Z2M H;  4GOG A;  1KDS A;  5BT1 D;  3WAA A;  3X1V A;  1P3O B;  3AZF A;  4J8X A;  1RGY A;  5CPJ A;  1ALQ A;  3AZJ B;  1U35 B;  4H9N B;  4JJN B;  1K57 C;  2WGW A;  2BLS A;  3KWQ B;  4IBF A;  1JWV A;  3NIA A;  3WRT A;  5GSU C;  4JBF A;  5B0Y B;  3AZN B;  3MKF A;  2V20 A;  3G2Z A;  3MNN C;  3A6N A;  4PM7 A;  4S2L A;  4KZ5 A;  1ZKJ A;  5GXQ D;  3REL D;  2HP6 A;  3AGE A;  5BNX A;  1PWC A;  3O62 A;  5F83 A;  3FZC A;  4NFT A;  3HON A;  4WEK A;  3OPL A;  5DF7 A;  4KZB A;  3VSL A;  3MVD B;  4GHL A;  1M1A A;  2JBF A;  3AYW B;  3X1T B;  1BH8 B;  4YS3 A;  3UTB C;  3C1B C;  3M2J A;  1SHV A;  4J8W D;  3CMZ A;  4J8U B;  3QNB A;  4Z66 B;  3DWK A;  2H10 A;  1SKF A;  1S0W A;  2VGK A;  3GR2 A;  4E3M A;  1ONH A;  3REH B;  4H9O A;  2ARO A;  2L5A A;  1SDE A;  2J9O A;  3W96 C;  1OME A;  4DXB A;  4ZUX B;  4WU9 C;  5CGS A;  4FD8 A;  5CP6 A;  3GMW A;  5F99 A;  5B31 A;  2CV5 C;  1AOI C;  3CZD A;  4WZS B;  4YM6 D;  3AN2 A;  4FCF A;  3AZG B;  3EPL A;  2QMI A;  2ZC7 A;  1CI9 A;  1PW8 A;  3MGP D;  4WZ4 A;  4KUD B;  2JC7 A;  1XXM A;  4ZJ2 A;  1XGI A;  3REI D;  5EVI D;  4GZB A;  5FQK A;  3VFH A;  1ES2 A;  1YLT A;  4LD9 B;  1L0F A;  1FQG A;  3SS3 A;  1JTG A;  5B33 D;  5AY8 B;  1FCO A;  1S32 C;  3MKE A;  1EQZ A;  1ERO A;  3AV1 C;  1ZLA A;  4R1G A;  4EQI A;  1YUE A;  1TEM A;  3Q82 A;  1DJA A;  2Y2P A;  5B1L A;  1MWU A;  4WU8 D;  1K55 A;  5CHM A;  1PI5 A;  5AV8 B;  4YIN A;  5DTS A;  3WTP C;  3IF6 A;  4XZQ D;  3KWQ C;  5FQQ A;  5CTM A;  4H9S C;  4DXC A;  3B6G D;  4R8P B;  1I5Q A;  3AZM D;  5F1G A;  1KX3 B;  1P3F C;  1P3I A;  3L26 A;  1K57 A;  4DRB A;  3IHA A;  3H0L C;  1P3L C;  5AVC B;  5B32 A;  3A3D A;  2J8P A;  2ZQ8 A;  2HUE B;  3M6B A;  3W4O A;  2NQB C;  4R0Q A;  1HTZ A;  4LV0 A;  4JXG A;  3QNC A;  3KXB D;  3C1C A;  5B1M B;  4J8V C;  5TFQ A;  5B2I D;  3MZF A;  5B40 C;  4NYU A;  4E44 A;  4KG6 A;  3WS2 A;  4OOM A;  1IYS A;  4X23 A;  1MKI A;  5BOH A;  2CC1 A;  5E5A C;  5B24 C;  3TU4 D;  3UT9 D;  4OPY A;  4WZ5 C;  4H9R A;  1YT4 A;  4ZAM A;  3G32 A;  2F2A C;  1F66 B;  3UTB A;  2F8N D;  5B0Z D;  3C1B A;  3LY4 A;  3WS0 A;  3AV2 D;  5GLB A;  5B2J C;  4KGC D;  3SS5 A;  5CEB A;  3LZ0 B;  1O07 A;  3MGQ C;  3W96 A;  4OJO A;  5AV5 B;  1K54 C;  2OLV A;  3C5A A;  3HLE A;  4WU9 A;  3I7J A;  4QLC B;  4Z2M G;  3HUN A;  1AOI A;  2Y2G A;  3EPJ A;  3AZH B;  2CV5 D;  4E3N A;  1M18 D;  3IH8 A;  4OPZ A;  4JPM A;  5GHY A;  4DF6 A;  1XA1 A;  5M18 A;  2B5R A;  3LEL C;  3B0C T;  4U3T A;  3WAA B;  3AZF B;  4S2K A;  4J8X B;  3AGD A;  3KS8 A;  3FWL A;  1LHY A;  1BZA A;  1ZC2 A;  1W7F A;  5DTK A;  3WKJ A;  5CED A;  4RYE A;  1KVL A;  3GTC A;  3MGR D;  1YMS A;  2YFW A;  5CPI C;  2NZD B;  3EQU A;  5A91 A;  5JA4 A;  1JVJ A;  3QHY A;  3REK D;  3A3F A;  1W8Y A;  1PZP A;  4XUJ D;  4LCL A;  5BNX B;  3LZ1 C;  3UPP A;  4A5R A;  3X1U C;  1WYB A;  3X1S B;  3AZL C;  4WMC A;  3NQU A;  5F82 A;  4FH2 A;  5E43 A;  2F8N H;  1P3O D;  4CAY A;  3WTP A;  5E2H A;  4Z5T B;  4UPK A;  1YU2 A;  3RJU A;  3AZJ D;  4IBX A;  3UNW A;  2XK1 A;  2IO5 C;  1U35 D;  2HP9 A;  4JJN D;  3UY6 A;  4H9S A;  4GD8 A;  3KWQ D;  3IT9 A;  1L2S A;  5B0Y D;  3AZN D;  1E3U A;  4OUI A;  4ZJ3 A;  4H9O B;  2ARO B;  4JKT A;  3VSK A;  1PYY A;  3VH5 W;  5CP6 B;  4HBT A;  5F99 B;  5EOO A;  3HLF A;  1P3K A;  3IXB A;  3VOZ A;  1FCM A;  5B40 A;  2Y91 A;  3MVD D;  1YQS A;  1W79 A;  5E2E A;  2Y2I A;  1SDN A;  3X1T D;  3AYW D;  3W99 C;  4KEN B;  3MGS A;  5FI2 A;  4OLD A;  4S2N A;  4J8U D;  2ZD8 A;  4Z66 D;  5E5A A;  5M19 A;  3GQZ A;  4X6T A;  1GA0 A;  4HBU A;  3REH D;  3KS4 A;  3ISG A;  1BLH A;  5BT1 C;  1NXY A;  2H5S A;  4Y0O A;  1P3G B;  1XPB A;  4ZUX D;  3V3R A;  1FOF A;  2H0T A;  2A49 A;  1EQZ B;  5B2J A;  1AXB A;  5JYP A;  1ZLA B;  5AQ7 A;  4ZTK A;  3KUY A;  1GHP A;  2EFX A;  3ZFZ A;  5DNN A;  3AZG D;  2BYM A;  2E8I A;  5A92 A;  3V9R A;  3AGF A;  3ITA A;  2QZ6 A;  5DNM B;  4K0X A;  5GXQ C;  3REL C;  4KUD D;  2ZC4 B;  1TVF A;  3IF6 B;  3ZVT A;  3AFA B;  4K0W A;  4YFM A;  5GT3 B;  4LD9 D;  5KMW A;  5J8X A;  5AY8 D;  4LV2 A;  4QHC A;  1KGG A;  3S22 A;  5FUG A;  5B32 B;  4J8W C;  4GB7 A;  2OSU A;  1H3O B;  4DRA A;  5CPI A;  1P3A A;  4KG5 A;  4OJ6 A;  2XF3 A;  3WA9 A;  4H9P B;  1YLP A;  5AV8 D;  1P3B A;  1K4E A;  3X1U A;  4KZA A;  3KFU G;  5FAT A;  2X02 A;  3AZL A;  3UDI A;  4X23 B;  1MPL A;  1JWZ A;  4R8P D;  3A1K A;  3O88 A;  2WAD A;  4YM6 C;  1KX3 D;  5BS7 A;  4UA9 A;  4X56 A;  3DWZ A;  2XH9 A;  2OV5 A;  1ID3 B;  4UA7 A;  1I2W A;  4H9R B;  3MGP C;  4WJ3 C;  5AVC D;  2I72 A;  4WEJ A;  1ES4 A;  3VMA A;  1BH9 A;  3REI C;  5EVI C;  4MBK A;  1KE0 A;  5B1M D;  3HUM A;  4G92 C;  5EEC A;  5B33 C;  3AZK B;  4IVK A;  2VQR A;  3NQJ B;  1H5X A;  4NE3 A;  1YM1 A;  1ESU A;  4D2O A;  4EBN A;  5AQ9 A;  4WU8 C;  3LJA B;  3KSY A;  4LCM A;  3ZG5 A;  5CRF A;  4X53 A;  1IYO A;  1F66 D;  2PU2 A;  4WBG A;  3PBN A;  1ERQ A;  4XZQ C;  5DF8 A;  1YLY A;  2FJ7 A;  2Q9M A;  3WKJ B;  3PBO A;  3B6G C;  3E2K A;  5DF9 A;  3LZ0 D;  5AV5 D;  3AZM C;  2DNS A;  4QLC D;  2WZZ A;  2FFF B;  5JA4 B;  1LI0 A;  3HSH A;  3B0D B;  5CPK B;  5FSR A;  4HGA B;  3HLG A;  2J9P A;  5DNM C;  5FAO A;  2G2W A;  3V39 A;  2F8N G;  3Q81 A;  4E3I A;  3AZH D;  1CEG A;  3P98 A;  5KZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...