2Y2LA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e06)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
489
structure length
472
Chain Sequence
ISEITYSDGTVIASIESRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 162
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2lA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2lA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2lA02
1KVLA 3SS3A 2WKEA 4Y0OA 5DF7A 5IHVA 5CRFA 3VFFA 5M18A 2XQZA 1GHIA 3VSLA 2Q9MA 4UA9A 2HP9A 2PBYA 1SDNA 1L2SA 4OQGA 3UPPA 5M19A 1Q2QA 3G34A 1TEMA 5GLCA 1YMXA 3HLDA 4UHUA 1NRFA 2ZM0A 4KQQA 4DXBA 5HAPA 4U0TA 5AQBA 3WS0A 3RXWA 4GN2A 3IF6B 5A91A 2DRWA 1BLPA 2HP5A 3PAEA 2ZC7A 4R3JA 4UA7A 4RA7A 3G35A 2XLNA 4XUZA 2I72A 3ZNTA 5E2GA 3WS4A 2XFSA 1HZOA 3EQUA 3GQZA 1YM1A 3TOIA 3ZFZA 1WYCA 4S2KA 4KZBA 3WRZA 3V3RA 3IWQA 3GVBA 4K0WA 1GA0A 4OPQA 4B88A 1FCNA 3Q1FA 3BEBA 2C5WB 4MBFA 2G2WA 1MBLA 3WS1A 3NC8A 1ESIA 3ISGA 4IEDA 1K54C 5A92A 5GHXA 1IKGA 2BG1A 3HUMA 4N1XA 1BSGA 1KDWA 3W4PA 3BYDA 2Y2NA 1E4DA 3PBQA 2OLUA 3TSGA 4OQHA 4WZ5C 4EWFA 5EOOA 2J8YA 3A3IA 3O3VA 1YLPA 3IT9A 5FQKA 4WZ4A 1IYPA 3BLSA 4MLLA 1DY6A 4IVKA 1L0DA 3UE1A 5CGXA 4DDSA 3HUOA 1Z6FA 2VGJA 1K6RA 3M6HA 4OP5A 5DTSA 1YQSA 3G4PA 3MKFA 5CTNA 3LO7A 1QMFA 2WGWA 4FSFA 3A3FA 5HX9A 1DJCA 2IWDA 3MZDA 1WE4A 3IHBA 1IYQA 5FI7A 2XDMA 3G31A 1ALQA 3IF6C 3MKEA 2WADA 1O07A 1PWCA 2HDRA 4N92A 1XP4A 3W4OA 4FD8A 4E3IA 3FZCA 1CI9A 3BECA 1W79A 3ITBA 4X56A 4OQ0A 5HL1A 1RGZA 2Y91A 4JXGA 3RJUA 3IH8A 3WWXA 4QU3A 4OVDA 5GLDA 1LLBA 1M6KA 1XKZA 1K25A 2V20A 3BLMA 1MWTA 3ITAA 3SOIA 5JYPA 4RVAA 3GR2A 4S2PA 4X55A 4GKUA 2XH9A 2WAEA 4KZ5A 2OV5A 3S4XA 5KSHA 3IWIA 2Y4AA 3E2LA 1ONGA 4JXWA 3LY3A 2WAFA 1NZOA 3NBLA 3B3XA 4JF4A 2Y2OA 2WZZA 3V39A 4EV4A 5FAPA 4JKTA 5BOHA 4MBHA 4XUXA 3OPRA 3I7JA 2V2FF 1KGEA 1MXOA 1SDEA 1PI4A 4Y0UA 1WYBA 2XK1A 3FYZA 2EX9A 3SH7A 2ZLYA 3ZG7B 2Y59A 1PW1A 3PBNA 3D4FA 4L0LA 4R0QA 4O7DA 3UY6A 1KE0A 4OOMA 1JWVA 2ZC4B 3MBZA 5EVLA 4B4XA 4R3BA 3JYIA 2QZ6A 3BM6A 1PZPA 5CHJA 1IYSA 2EFXA 1BLSA 1NY0A 1K38A 3A3JA 4DF6A 1JTDA 3QNCA 2ZM8A 3FV7A 2XFTA 5FQQA 1W8YA 3ZGAB 4WELA 4BQMA 3MZEA 3HUNA 1J9MA 5DTTA 3UE0A 4LV3A 1FQGA 3IXHA 3GMWA 5FI6A 4JLFA 3VSKA 4BD0A 1K6SA 4LCMA 4ZDXA 2XD5A 2JBFA 1E3UD 4NK3A 4OP8A 3V5MA 4F94A 1K54A 4N9LA 4PM5A 3VOYA 2WZXA 2Y2PA 2C6WB 1DJBA 1G6AA 3PAGA 5CGSA 4WMCD 5EVID 3AGEA 2WKHA 3HLEA 1IELA 1FCOA 4QHCA 4WZ5A 1HD8A 3ZCZA 1AXBA 1KE4A 1K57C 2ZQDA 5CECA 3OPLA 4ZJ3A 4GZBA 2B5RA 2Y55A 2OLVA 2Y2GA 4LENA 5HAIA 1KVMA 3BFEA 3NDGA 2H10A 3UDFA 4KZAA 3P09A 4XXRA 3C4OA 3VMAA 4P85A 4ZJ1A 1CEGA 3A3EA 3WS5A 1LI9A 4GD6A 3W4QA 5DF9A 4QJGA 4OH0A 3NCKA 2R9WA 1LL5A 1IKIA 2A3UA 3MXSA 3IF6A 1FCMA 2PU2A 4CJNA 4MEZA 1EI5A 2VGKA 4BJPA 4KQRA 2ZC3B 4DE2A 4WBGA 2Y2QA 2RL3A 1XXMA 3GSGA 4KZ6A 1MWSA 3UE3A 1XX2A 4OKPA 1ZC2A 1BULA 1L0FA 1XGIA 1PIOA 2WUQA 2QPNA 3LY4A 3HBRA 3OZHA 2QMIA 1GCEA 2ZJ9A 1KDSA 3CMZA 3MZFA 3EQVA 4E3LA 2ZQ7A 5HW3A 5A93A 4LV1A 5GL9A 1GHMA 5CXWA 3ZG0A 1ERQA 3G2ZA 1K4EA 2V1ZA 5JYOA 5KZHA 5D3OA 4JBFA 3NI9A 4OQIA 3FWLA 5FQMA 3HVFA 1NJ4A 4ZJ2A 4BL3A 1K56A 1L0EA 1XGJA 2Q9NA 2DCFA 1VM1A 4EUZA 5FASA 4R1GA 1GA9A 4GDNA 5EOEA 3VP1A 1CI8A 1MWRA 3PBTA 3ZVWA 4YINA 1YMSA 2J7VA 2HDUA 3IWOA 3TG9A 2HDSA 4PM8A 2Y2MA 1E25A 4MBKA 2Y2IA 5I94A 1ESUA 5FDHA 4OPZA 4DE0A 5FATA 3HLCA 5FSRA 5DTKA 1H5XA 3HLGA 5CHMA 3MXRA 4RX2A 4LV0A 5DF8A 1HVBA 1YLJA 5CERA 1ZG4A 3PBOA 4UA6A 1PZOA 3A3DA 1EROA 2ZQ8A 1FOFA 3GTCA 4X68A 2HP6A 4FH2A 3ZHHA 1Y54A 4B4ZA 4PPRA 2HDQA 3ZG9B 3N8SA 1BUEA 5L2FA 1EWZA 3M2KA 4S2NC 1LL9A 2XGNA 5CHUA 4DE1A 1BTLA 1L0GA 1YT4A 2WYXA 3OCNA 5FQ9A 3UN7A 1TVFA 2RCXA 2WGVA 1K57A 4Z9QA 2Z2MB 3IF5A 4DE3A 2X71A 1FR6A 2J9PA 3HL9A 4KQOA 3AGDA 5GLBA 4KZ7A 1FR1A 1BZAA 1IYOA 4K91A 3ZG8B 5KMWA 2ZM2A 3BFCA 3S22A 3VOZA 4GNUA 1K55C 3UPNA 1YLYA 3UO9A 5EPHA 1LHYA 5A90A 4C6YA 4E3JA 3G32A 5F83A 4Q8IA 1N9BA 4Y0TA 1ES5A 1ONHA 4EBPA 2P9VB 4GOGA 1H8YA 3IXGA 1JVJA 3SS4A 4S2JA 5GHYA 1ES4A 1RCJA 5TR7A 2ZQ9A 5CGWA 4JF6A 4N1HA 3N4IA 3QNBA 4FCFA 4H8RA 4U3TA 3O87A 3HLBA 2CC1A 3S1YA 5EVIB 5E2FA 1RP5A 5EE8A 4X53A 2EX2A 3Q7VB 4P6BA 5CTMA 4C75A 4HBUA 4HBTA 1JWPA 1FSYA 4WYYA 5TFQA 4BENA 4D2OA 3BFDA 4OOLA 3UDIA 4QY5A 2ZQCA 1S6RA 4PMAA 3SH8A 3PTEA 2FFFB 1YLWA 3DW0A 5HFOA 4C3QA 2JCHA 2IWCA 2XD1A 1YLZA 3LCEA 4KZ4A 1FSWA 2H0YA 1LI0A 4U0XA 1ZG6A 3VP0A 3PBSA 3ZNYA 4DXCA 4E6WA 1JWZA 3HLWA 3ZVTA 1PYYA 3FKVA 4RYEA 5FQJA 1RGYA 3V3SA 3UPOA 5DVAA 1PWGA 3CJMA 3OC2A 2XEPA 4OPYA 3WRTA 3G30A 1PW8A 4IBRA 2EFUA 1KGFA 1BT5A 3BFFA 4K0XA 1PWDA 3NDEA 1GHPA 2ZQAA 3VFHA 3HREA 4BLMA 5E43A 2Y2HA 1NZUA 4GD8A 4PM6A 4JXVA 3SH9A 3ZDJA 4IBXA 1M40A 1I5QA 1NXYA 3PBRA 5CEBA 3OCLA 5FA7A 2X01A 3IHAA 5GHZA 3Q7ZA 1NYYA 2XR0A 3IH9A 3OPPA 2H5SA 4OLDA 4OLGA 4PM7A 4P87A 4WEJA 1KGGA 5FAQA 2EX6A 3V50A 5EVIC 4S2MA 2BLSA 3OPHA 3NIAA 1NYMA 2FFYA 4NETA 4S2OA 5F1FA 4S2NA 3IQAA 4EBLA 4QD4A 3O86A 4DDYA 1O7EA 4ZTKA 3N7WA 1XA7A 4ZAMA 4N9KA 4ZBEA 4HEFA 4R4SA 5J8XA 4A5RA 3E2KA 5F1GA 2HPBA 4DKIA 4PM9A 3SS5A 2UWXA 4Y7PA 5F82A 4EBNA 1K4FA 2H0TA 1W5DA 4ID4A 4WM9A 1IEMA 5U47A 4OOYA 2Y2LA 4X69A 5FQIA 1K55A 4CPKA 3Q82A 1TDLA 2DNSA 3CZDA 3DWKA 3MFDA 2WGWB 5EUAA 4KZ9A 2ZC5B 4GDBA 2Y2KA 1ES3A 3M6BA 4HESA 4LV2A 4BL2A 3C7UA 1K56D 4JF5A 4IVIA 1PI5A 2JE5A 2OSUA 4E3NA 4E6XA 1U60A 2WKIA 2J9OA 4M3KA 4X6TA 3ZG5A 5HAQA 1CK3A 2JC7A 1BLHA 5E2HA 3IXDA 3WS2A 1ES2A 4JXSA 2EXBA 4OPRA 4WEKA 4BD1A 1I2SA 3FKWA 3LEZA 4QY6A 2X02A 1W7FA 3QHYA 2R9XA 3Q81A 1BLCA 5TGFA 3VP4A 4JPMA 2PU4A 3RXXA 1N4OA 4MNRA 4KG6A 3GRJA 3W8KA 5CEDA 4R23A 1W8QA 2Y2JA 1I2WA 1ERMA 3UNWA 4QB8A 5EECA 2EX8A 3AGFA 2G2UA 5KSCA 3HLFA 1JTGA 1OMEA 3BRMA 1XPBA 4LCLA 4EQIA 1G68A 1CEFA 3M2JA 2E8IA 1TDGA 3NY4A 2GDNA 4KG5A 2Z2LB 1MY8A 5GLAA 1SCWA 5M1AA 3UDXA 3C5AA 3N8RA 4R4RA 5HARA 1MKIA 1SHVA 2WK0A 2ZC6B 4S2LA 2P74A 2EXAA 4S2IA 1VQQA 5AQ9A 1KE3A 3N8LA 4P0MA 1MWUA 4DRTA 2ZMAA 3O88A 4E3OA 4KENB 4E3MA 1S0WA 4YFMA 4OONA 3CG5A 2A49A 4UAAA 1H8ZA 5G18A 1C3BA 1Q2PA 5AQAA 1SKFA 3IXBA 4KG2A 3G2YA 2P9VA 2XF3A 4KZ3A 1E3UA 2WGIA 2IWBA 4KZ8A 4FH4A 3DWZA 3P98A 3VP2A 4E3KA 3VP3A 1MPLA 4RX3A 5FAOA 3Q07A 1YLTA 1XA1A 5EVIA 4WMCA 1QMEA 3BFGA 1DJAA 3N6IA 4GB7A 3Q7VA 1ZKJA 3C4PA 2ZD8A 1HTZA 3C7VA 5E2EA 5AQ7A 5FI2A 3DTMA 3GV9A
chains in the Genus database with same CATH superfamily
1KVLA 4DRAA 3AFAB 2W3GA 4FUWA 1ZLAC 4WU8C 3VSLA 4UA9A 1SDNA 1Q2QA 3G34A 4H9PA 4CLCB 3N3FA 2FH5A 1W63Q 3H7WB 4XT2A 5AVBA 3RXWA 3U4LP 5KIZA 4OJOA 1LSVA 1L6JA 3PAEA 2HIOB 4GHLA 2ZC7A 3L2AA 4HHDA 1G28A 2I72A 3FPWA 3ZNTA 2CWEA 2R78A 3TOIA 1SKOA 1AOIB 3V3RA 1VETB 4E44A 3IWQA 2BASA 1S66L 4EO5C 1A7WA 4B88A 1YU1A 3Q1FA 4ETXA 3EPHA 2LB5A 3NC8A 5DNNC 1AOIA 4ESPA 5CPIA 3TU4A 2VJWA 3WKJA 3HUMA 3MXQA 4N1XA 3W4PA 1P3AA 1P3IA 3REJD 3PBQA 2JKGA 5EOOA 3A3IA 4KHAB 1VHMA 2CV5C 1YLPA 3X1VD 5CGXA 3W97B 3HUOA 3M6HA 5DTSA 3A1KA 4X23C 2WGWA 4G3WA 5HX9A 1LSXA 4KHAA 2JKRI 1WE4A 3LZ1C 4LD9D 2HJ9C 4ETZA 3G31A 5EFWA 5B31C 4KGCA 2WADA 3UB5P 1O07A 2MJ6A 1PWCA 1XP4A 3REHA 1Y28A 4FD8A 1CI9A 3BECA 3F6TA 5HL1A 1P3LC 1RGZA 1XJ2A 4JXGA 4CAYA 4OVDA 5B33D 1XKZA 2V20A 3SOIA 5GXQC 2IO5C 1ACFA 1U35B 2OV5A 3IWIA 3E2LA 5AV6A 4Y15A 5B24D 5GT3B 1P3KB 1P3MD 3VE3A 2Y2OA 2FN2A 4JKTA 5BOHA 1P3OB 3I7JA 5G4YA 1P0ZA 3MGPC 5B2JC 1OGGA 1U35A 2ZLYA 3ZG7B 2Y59A 3KYEA 2YFVA 2QHKA 3MF0A 4O7DA 1KOUA 2F8NB 2J3TC 4OOMA 3MBZA 4R3BA 1P3OA 2VA0A 3JYIA 3C1BB 2NUTC 3BM6A 5CHJA 1J3WA 3UTAD 1JTDA 3FC7A 2XFTA 4PAUA 5DNMB 4OJ6A 4WZSB 4BQMA 4J8XD 3AZKC 4HOIA 5HSQA 5DFYA 3MGRB 4WU9B 3WD3A 3IXHA 4JLFA 3PR6A 5B0YB 1M1AC 4OP8A 3WD4A 3NOUC 3VOYA 2K2NA 1OTAA 1CXWA 3O5YA 3PAGA 2V9AA 2NQBB 1IELA 4H9NA 5CP6B 3OPLA 4HQAA 3F1NB 2B5RA 3NECA 2JKFA 5HAIA 2VZWA 3P09A 4XXRA 5CP6A 2LB9A 1ID3B 2G5HC 2P08A 4I3AA 4ZJ1A 3R45A 2M7VA 3F1NA 1M19D 3NOPC 3NCKA 2R9WA 3MXSA 3LJAD 2PU2A 2HF6A 1LL8A 2VGKA 3NHQA 4J8UD 1ID3A 4KQRA 1P3FC 4NE5A 3BY8A 1T1BA 2Y2QA 2RL3A 3UE3A 3WAAB 3GSGA 1XX2A 3EEAA 4EETB 3X1UD 4JJND 4NXGA 1PIOA 2FJ7B 4I5SA 3CLOA 5AV9D 2YFWA 3GECA 1W1PA 4E3LA 1P3GA 4O8GA 2V1AA 4NZ3A 1ERQA 3AYWB 4Q0JA 2VV7A 2BYMB 3LELB 1R4VA 5FQMA 4ZJ2A 3SW1A 3JVVA 3AZGD 2DCFA 2PBDP 3B47A 4EUZA 4R1GA 3VP1A 3PBTA 3ZVWA 5B0ZD 3TG9A 4PM8A 1E25A 2Y2IA 2W0NA 1ESUA 4IJEA 4DE0A 4HGAC 3HLCA 3REIA 5FSRA 5DTKA 3KWQA 5CHMA 3S7QA 4H9RA 4LV0A 5DF8A 3L7HA 5FUGB 4JGQA 5CERA 4UA6A 3WTPB 4R8PA 5JRGB 1EW0A 3PHYA 4FTXA 4Z66B 1DRMA 3T4KA 1FOFA 2L4RA 3ZHHA 5CPKB 5HDSA 1XJ3A 2VGLM 2HDQA 4PPRA 3ZG9B 5B1MD 2D01A 5L2FA 4S2NC 2BYKB 1LL9A 4HJ4A 1BTLA 1YT4A 4Z66A 3UN7A 5AV5B 2PT7A 3X1VC 3IF5A 5CPKA 5F99A 3MSHA 2BYKA 3T4LA 3S22A 5AV5A 1K55C 4LD9C 1YLYA 4LFUA 3C38A 3UPNA 3V9RA 2PR5A 3UO9A 1Z09A 3G32A 4P6ZM 1JFIB 3B6GB 1ONHA 1P34B 2P9VB 4GOGA 4DQYB 4UUZA 5GHYA 2ZQ9A 3F1OA 1DP6A 4N1HA 5CGWA 4FCFA 3O87A 3HLBA 4XZQA 5B33C 5EVIB 1RP5A 2HZ5A 1TAFB 4MN7A 5CTMA 4HBUA 4WYYA 3TRCA 3UDIA 2ZQCA 5B24C 1S6RA 1P3MC 1CQAA 2IWCA 4H6JB 3KS8A 3LIDA 2PD7A 1F66D 2H0YA 1LI0A 2DQNC 1ZG6A 3VP0A 3VH6T 5C3IC 4IBKA 2VK3A 4HMCA 4E6WA 4JGRA 1NWZA 3OOVA 2O9CA 1TZYD 3V3SA 1ZTUA 5DVAA 1PWGA 3WRTA 4OPYA 2FZ0A 4Z2GA 3UTAC 3G30A 4IBRA 1Z2CB 3BFFA 4J8XC 3VFHA 1EQZD 5E43A 4GD8A 2LY8A 4PM6A 3KS4A 1NXYA 1XFNA 3PBRA 3NQJB 5HDCA 5FA7A 5GHZA 1NYYA 2XR0A 3IH9A 4PM7A 4WEJA 1KX5D 5CPJB 3IX4A 3V50A 4XUJA 3V67A 3OPHA 1ODVA 1WWSA 3AV1D 3N7WA 1T1CA 5HD5A 4HEFA 3ZYTA 5B2ID 3AZIA 3KXBA 3A6NA 5B32D 2HPBA 2UWXA 4Y7PA 4EBNA 3LZ0B 2H0TA 4WM9A 3EPLA 5EM1A 1M19C 1DP8A 3AZHD 5AV8A 1EAKA 2DNSA 5E5AB 3MFDA 3B42A 3L29A 3LJAC 4KZ9A 3M6BA 2RVQD 1K56D 4J8UC 1WWIA 5HL6A 4KUDD 2J9OA 3AZJA 3W98A 5AVCB 3MMHA 3ICYA 3X1UC 4JJNC 1PRQA 5E5AA 3K3DA 1M18D 2EXBA 4WEKA 3LR3A 2Z6DA 3W96D 4GW9A 1TS6A 3AZLD 3FKWA 2W1TA 2AVXA 4WL9A 4QY6A 1BLCA 5TGFA 3UMEA 2PU4A 1ZLAB 3GRJA 5GT0D 4R23A 4OJPA 2A24B 2Y2JA 1I2WA 1HQ3C 5EECA 3AZGC 3HLFA 4EEPA 3FG8A 3NY4A 2HUEC 2XROA 4MB3A 5B0ZC 1MY8A 1CK7A 5M1AA 1KX4A 1D1JA 1SHVA 2ZC6B 3WX7A 5F68A 4S2LA 1YKDA 3WA9B 3W99D 4IBBA 4P0MA 4DRTA 2PYOA 3MQQA 4E3MA 1DP9A 5BS7C 2YKFA 3O62A 3UB7A 5B40D 4IBDA 5AQAA 1SKFA 3IXBA 1N1JB 3WA9A 1E3UA 5B1LD 3B6FD 3DWZA 3P98A 4Q0HA 3VP3A 2AROD 5B1MC 1MPLA 5DNNB 3X1SA 1DJAA 3C1CA 2ZD8A 5J7EA 3T4TA 3KSGA 3DBAA 4HMDA 3VFFA 5M18A 2XQZA 3EGDC 4YWZA 3REKC 2CV5B 3IS2A 1T1AA 2HP9A 1YSQA 2NZDD 4GCZA 3RELA 2UV0E 3UPPA 3VE4A 4HP4A 4E04A 3T4QA 2ZM0A 4KQQA 4X23B 2CV5A 3MGQD 4EXOA 4OUIA 4HH3A 3VH5T 3AZFD 4GN2A 5A91A 5B31B 2HP5A 2ZOHA 3H0MC 4R3JA 4BBTA 2WKPA 3LZ1D 5FDSA 3WS4A 2XFSA 4EU0A 5GSUD 1V9YA 3ZFZA 4S2KA 3KO6A 3KUYD 5GXQB 1H0MA 4MBFA 1F66C 3UTBD 3T4OA 2Y8HA 4Z1WA 5A92A 2V1BA 2BG1A 5GXQA 1W1YA 1BSGA 4ZRRA 1XJ4A 3AN2A 3BYDA 3MGPB 5B2JB 1E4DA 1TZYC 2OLUA 3TSGA 2GNXA 4EWFA 1TS8A 4WZ5C 2J8YA 4L9GA 3SZTA 4CQHA 4ZUXA 3EOIA 3BLSA 3UE1A 4EESA 1EQZC 1Z6FA 5B2JA 5DJUA 4YM6A 3MKFA 3MJQA 4FOFA 4QLCD 2V5OA 5CTNA 3LO7A 3L26A 2IWDA 1E15A 3MZDA 3AZKB 2XDMA 3IF6C 1KX5C 2VEAA 3MKEA 4OJLA 3AZMA 1GSWA 1M1AB 3FZCA 5HPIA 1W79A 3AV1C 4X56A 4OQ0A 3RJUA 4WV4B 4QU3A 3MGSD 5JYPA 3KSFA 5B2IC 4GS9A 4WUJA 5B32C 4X55A 2GZAA 2XH9A 1M1AA 4QNLA 1P3BC 4J8WD 3OBFA 4JXWA 1ONGA 4H9QB 1S32A 5JA4B 3X1TD 3LY3A 1ULYA 3NBLA 3AZHC 2BTFP 3B0CW 4MBHA 4IBCA 3MS6A 1OT6A 1SDEA 3FYZA 2XK1A 2EX9A 5TBMA 4KUDC 4L0LA 4AWLC 4R0QA 1NLZA 4Z5TA 4J8VB 3FKEA 4Z2JA 1M18C 2ZY5A 3UT9A 2VKSA 1E6NA 1PZPA 3W96C 1BLSA 3AZLC 1P3FB 5J3WA 3MVDA 3AZEA 3C8CA 3QNCA 2P04A 4YS3A 1G5UA 5FQQA 1P9WA 1P3PB 1W8YA 4WELA 3MZEA 4J8VA 1J9MA 4WJ3C 2D49A 4LV3A 2G5IC 4TX8A 3AV2A 3W2ZA 1K6SA 4LCMA 4ZDXA 2XD5A 4H9OA 3NQUA 1P3PA 4MB5A 2JBFA 4NK3A 4F94A 1K54A 4PM5A 5BNXB 5AY8D 3U2AA 3AZND 1DJBA 5CGSA 4DJ2A 2ZBBA 2WKHA 1FCOA 3AFAA 1HD8A 1AXBA 1T18A 3BWLA 5CECA 2M7UA 3T1QB 3W99C 2E8JA 1ZHHB 2V0UA 4CLCA 1OPXA 3BFEA 4Y13A 4HGAB 3C4OA 1NRJA 5B40C 3WS5A 3H7WA 1LI9A 3W4QA 2V0WA 5B1LC 4OH0A 3B6FC 5BO0B 1LL5A 1IKIA 2V8FA 2AROC 1FCMA 5AVBD 2HIOA 3ULFA 5KDMB 4HNBA 3EPKA 3LIFA 3REJB 1ZC2A 1L0FA 2WUQA 4H9SA 1VETA 4I38A 2Z6CA 3HBRA 2QMIA 2ZY4A 3UB6A 4AFIA 3X1VB 2NZDC 1KDSA 2YKHA 3CMZA 3EQVA 4X1LA 4Z2KA 3REJA 3TJZC 5CXWA 3LI9A 2XA7M 1JNUA 4CSRB 2V1ZA 5KZHA 3TE8A 3MGQC 4OQIA 1AOID 4LD9B 3HVFA 2JKTM 5DJTA 5CPID 3TU4D 3AZFC 3LI8A 3WKJD 3MNNB 5FASA 5EOEA 4GDNA 5LBRA 1P3AD 1P3ID 1CI8A 1MWRA 4B93A 1YMSA 5L07A 2JKTI 3IWOA 2HDSA 4NE6A 2Y2MA 2IOUA 4K08A 5GSUC 3W97A 4MBKA 4D60A 4GH9A 5B33B 3KUYC 3MNNA 1BFMA 3HLGA 5HPFA 3A3DA 5B24B 3UTBC 1E6RA 1P3MB 1EROA 2ZQ8A 5MC7A 4LPZA 4KGCD 1YU2A 4B4ZA 3REHD 3K2NA 3LGOA 3E4OA 4NZ1A 4DE1A 2ZOIA 5C3IB 5FQ9A 1K57A 2Z2MB 1FR6A 5GLBA 3AGDA 5GT3A 3UTAB 1P3KA 1FR1A 1QO6A 4QLCC 1BZAA 3CUEA 5AV6D 4J8XB 4F3LB 2QJ7A 3K3CA 5EPHA 4G91C 4Q8IA 4QWOA 1X0OA 4Y0TA 2J8PA 2VX8A 2JSSA 2L5AA 2F8NA 1L3LA 3DTIA 2K7SA 3SS4A 4S2JA 3C1BA 4PHTA 4JF6A 2INWA 3CPTB 4H8RA 3MGSC 3HJKA 5E2FA 4LRZE 5DNMA 2EX2A 4P6BA 3EEHA 4BENA 3UE6A 2ZL1B 3MGRA 4J8WC 4WU9A 4OOLA 3CPTA 3X1TC 1VEUB 3VH6W 4NZ4A 5B0YA 2I9VA 3DW0A 4YOFA 4C3QA 3DTKA 3WD2A 3PYPA 4II7A 2XD1A 1M19B 2ZL1A 2PYPA 1FSWA 4KZ4A 2W3EA 4I39A 5IS1A 2NQBA 1S67L 2PHYA 1VEUA 3PBSA 4DXCA 3LJAB 1PYYA 3BQAA 1W1VA 3UPOA 4J8UB 2ZM5A 2RIQA 3OC2A 2XEPA 4R38A 4NYUA 2EWVA 2J3WA 2JN7A 4JJNB 1KGFA 4K0XA 3HREA 2Y2HA 5AV9B 4JXVA 2B02A 4IBXA 3DTEA 5CEBA 3KYZA 3H82B 2X01A 3IHAA 3Q7ZA 4OLDA 4P87A 1TD5A 5EV0A 5FAQA 1HTAA 5AY8C 5G4ZA 3AZNC 1W2EA 5AV9A 3WAAA 2PR6A 1OGBA 2M1CA 5F1FA 4S2OA 2Y79A 4QD4A 4DDYA 1O7EA 2FJ7A 3KX0X 1HQ3D 4N9KA 4ZBEA 4Y3IA 5B0ZB 4R4SA 4A5RA 3AYWA 1P3GD 5F82A 2BYMA 1W5DA 3LELA 4ID4A 1IEMA 2Y2LA 2L0WA 4CPKA 5F69A 3A0SA 5EUAA 5AVBC 5F5YA 4GDBA 1ES3A 3EG5B 4HESA 5IU1A 4JF5A 4IVIA 2JE5A 5HWVA 2WKIA 4X6TA 1YU3A 2JC7A 3IXDA 5B1MB 4JXSA 1F5MA 1I2SA 3UB8A 1OJ5A 2KOIA 3REID 5FUGA 3L9KA 1W7FA 3WTPA 2R9XA 5JRGA 3KWQD 4IJGA 4OJ5A 1YU0A 5CX7A 3L28A 1D06A 5CEDA 4R8PD 1BYWA 3E0YA 1ERMA 1AOIC 5CPIC 2EX8A 3TU4C 2G2UA 2B95A 4Z2HA 3REKD 3WKJC 1OMEA 3HCYA 1P3AC 1P3IC 2OAQ1 5BT1D 3B33A 2GDNA 2Z2LB 5GLAA 3L25A 3C5AA 1SZVA 1OJGA 3E4QA 5HARA 1MKIA 4S2IA 4HP9A 5CPKD 2EXAA 5F99D 3N8LA 3LR0A 4YFMA 5AV5D 1JFIA 3B6GA 2A49A 5B31G 1P34A 1C3BA 3G2YA 2P9VA 2PD8A 2WGIA 4KGCC 4FH4A 4IJFA 3REHC 1F66B 4RX3A 1S4SA 5FAOA 1YLTA 1XA1A 1GOIA 4WMCA 5EVIA 1UR9A 2GX5A 3BFGA 1TAFA 3N6IA 4GB7A 3C7VA 5FI2A 4XZQD 2O9BA 5I5LA 4E45A 2W3FA 3GV9A 3R4KA 3SS3A 1P97A 5IHVA 5CRFA 1W1TA 3T12B 5AV6C 4H6JA 4IUHA 4OQGA 3VH5W 1EQZB 1YMXA 3HLDA 3CITA 5HAPA 4U0TA 5AQBA 1U35C 3P5JB 1KX3D 5TJJA 3WS0A 3IF6B 1KX5B 1BLPA 4ARZB 2XA7S 1P3OC 5BNVB 4UA7A 2KLIA 5E2GA 3AV1B 3KYQA 3GQZA 4KZBA 2DF4C 5B2IB 3NQJA 5DKKA 3QP8A 5B32B 4K0WA 4UQIS 4MN6A 1OTEA 1FCNA 3S7NA 5CPJA 1MBLA 5HDDA 3WS1A 1ESIA 3ISGA 3AZHB 4IEDA 3UMDA 1IKGA 1P3BD 1KDWA 4XUJD 2Y2NA 4EUVA 4QPRA 4KUDB 2J80A 4AWLB 3O3VA 3AZHA 5FQKA 4WZ4A 1IYPA 4EEUA 4MLLA 2V8CA 1M18B 1L0DA 4IVKA 4DDSA 3LZ0A 3AZID 3KXBD 3A6ND 3W96B 4OP5A 3AZLB 3E4PA 1YQSA 3G4PA 2QKPA 4M4XA 1TS0A 1QMFA 4FSFA 1BH9B 1DJCA 3IHBA 1IYQA 5AV8D 5GT0B 1FILA 3C2WA 1AWIA 5AVCA 4N92A 2DMWA 3W4OA 3R7WB 4E3IA 3AZJD 4WU8B 3W98D 5BPVA 5GT0A 1LLBA 1M6KA 3ITAA 3BLMA 1MWTA 5L10A 1ZLAA 4KZ5A 1P3GC 3S4XA 4WU8A 5KSHA 2A24A 2Y4AA 3W99B 4KUOA 1NZOA 2WZZA 4I3JA 1LSWA 5FEFA 4XUXA 2V2FF 5B40B 1WYBA 4LRYC 3SH7A 5B1LB 3B6FB 1H0GA 4NKPA 4IBEA 2ZC4B 5EVLA 4B4XA 1KX4D 3L27A 2QZ6A 4GLQA 4EO5B 2EFXA 3D72A 1K38A 4DMZA 1GPFA 3S7PA 1O6IA 1N9LA 3FV7A 4Q0IA 3REIC 2OWHA 4WF0A 2QWSA 4HI4A 4Z2IA 3KWQC 3HUNA 2PYOD 3LIAA 3D3OA 3P7NA 1N1JA 4R8PC 2NZDB 3O62D 1FQGA 3GMWA 5FI6A 3VSKA 4BD0A 5A8BA 1H3OB 1E3UD 5DNNA 5C5KA 3V5MA 5BT1C 2Y2PA 3MGQB 4MMNA 1Q9CA 3X1SD 3C1CD 3AZFB 4Z66C 3ZCZA 1YSPA 3KFUG 1KE4A 2ZQDA 3NOTC 3LUQA 4ZJ3A 5EVEA 5CPKC 5F99C 3LZ1B 2PAVP 2OLVA 3T1XA 1F9IA 4LENA 1KVMA 3NDGA 2H10A 3UDFA 1N9NA 5G49B 3RELD 5AV5C 3KUYB 5L09A 4X23A 2W1RA 3T4JA 1P3LB 3LZ1A 5DF9A 2A3UA 5B31A 3F1PB 4MEZA 3UTBB 3QP2A 3DAVA 4BJPA 4UPKA 2IO5B 4NXFA 2ZC3B 1KS0A 4KZ6A 1XXMA 4XZQC 1P3LA 2P7JA 2QPNA 4MDZA 3LY4A 3LYXA 3WD0A 3MZFA 2ZQ7A 4G92C 5GL9A 3QP1A 4QLCB 5D3OA 1KX3C 3NI9A 2IA2A 3BQ8A 3FWLA 3MGPA 1NJ4A 1L0EA 2Q9NA 4G91B 3B0DC 1GA9A 3AN2D 2KX6A 2W8SA 1VB6A 2J7VA 2HDUA 1OTIA 1UWNX 3AL0C 1NLYA 4CLCE 4ZUXD 5FDHA 4KQDA 3MGSB 3MQOA 5FATA 2HGVA 1H5XA 4YM6D 3AZKA 3MXRA 4RX2A 4RQ9A 2Q0OA 1HVBA 1YLJA 1UR8A 1ZG4A 4J8WB 3PBOA 1PZOA 2WKQA 3BW6A 4HIAA 3X1TB 4DJ3A 3GTCA 4X68A 4FH2A 4XUJC 1Y54A 2K31A 1E6ZA 3AZMD 1EWZA 5CHUA 2WYXA 3QP5A 4HJ6A 2OAP1 2WGVA 2RCXA 4GHIB 4DE3A 2X71A 3RFBA 3AZIC 3KXBC 3A6NC 2J9PA 3HL9A 4H9QA 5JA4A 3A1IA 1IYOA 4HY8A 3ZG8B 2ZM2A 3BFCA 3T50A 1S32D 4GNUA 4O01A 5AV8C 4GHIA 5A90A 5F83A 3UB9A 4EBPA 5J4EA 1ES4A 3AZJC 1RCJA 5TR7A 3W98C 4Z2MH 1P3FA 4Z5TD 5AY8B 4U3TA 3AZNB 3LIBA 2CC1A 3S1YA 3UT9D 3VH6A 4YNRA 5EE8A 4X53A 3MVDD 3Q7VB 2B18A 4C75A 3AZED 1JWPA 4YS3D 1FSYA 5TFQA 3BFDA 3KSHA 4J8VD 3SH8A 3PTEA 2FFFB 2VQRA 5HFOA 2JCHA 3AV2D 5BNXA 1P3PD 3LCEA 4U0XA 1D7EA 3ZNYA 1GXDA 1WA9A 4XT2B 3HLWA 5AVBB 3ZVTA 3FKVA 1P9RA 4RYEA 1KX4C 3MR0A 1OT9A 3AFAD 1A0KA 1PW8A 4GJ4A 1PWDA 3NDEA 1GHPA 2ZQAA 2PYOC 2RTSA 4CLCD 1XFQA 1SKOB 3EGXC 3O62C 1I5QA 5BO0A 1YUEA 3WA9C 2H5SA 4OLGA 3HJIA 5KDMA 2HIOD 2BLSA 3X1SC 5CPIB 3NIAA 3TU4B 3C1CC 1YPRA 2FFYA 4NEED 4NETA 4S2NA 3IQAA 3WKJB 1W63M 3O86A 1P3AB 1P3IB 1T3UA 4BWIA 4ZAMA 3X1VA 3H0LC 4Y17A 5J8XA 3VOLA 5L8MA 3RELC 5AVEA 4CSRA 2PYRA 2ZMFA 4UQIM 3KSIA 4X69A 5FQIA 1K55A 4LD9A 3Q82A 1TDLA 3M7PA 3CZDA 2WGWB 2ZC5B 2Y2KA 4LV2A 4BL2A 3C7UA 2O0YA 2JKRM 1PI5A 4E3NA 4E6XA 4KGCB 2F8NK 4M3KA 4PKYG 3ZG5A 1CK3A 5E2HA 3C30A 3REHB 4NXEA 3WS2A 1ES2A 4BD1A 5B33A 4R6LA 3W97D 4R3AA 4CAYB 3MNND 2X02A 1S1YA 3QHYA 5B24A 3RXXA 1P3MA 1N4OA 4MNRA 4KG6A 3W8KA 5AV6B 3UNWA 4QB8A 4DRBA 1K0KA 1STZA 2QYBA 5KSCA 2W27A 5HD3A 2F2AC 3AN2C 1XPBA 4LCLA 4EQIA 1CEFA 5K5BA 1TDGA 4WNNB 1SCWA 4EW7A 1J7MA 2YFVB 4R4RA 4ZUXC 4BMWA 4L9EA 3UTAA 2WK0A 2PRFA 1TS7A 2ZMVA 1U35D 5AQ9A 2O99A 1H8PA 5GT3D 4YM6C 4J8XA 1P3KD 1MWUA 4F3LA 4WNNA 4E3OA 1P3OD 3BY9A 4OONA 3B0CT 3CG5A 1H8ZA 4O0PA 1GSXA 2XF3A 4G3VA 4KZ8A 2F8ND 3AZMC 4LRXC 3Q07A 2OWJA 2ZY2A 4M6BA 3C1BD 1BH8B 3NULA 3NJAA 3MQ0A 3C4PA 5AQ7A 4HMEA 5B32G 5DNMD 3VH5A 3WTPE 4H9NB 2WKEA 4Y0OA 4LLOB 5DF7A 1GHIA 1BH8A 3MGRD 2Q9MA 4WU9D 2PBYA 1S32C 1L2SA 5M19A 5FL3A 5B0YD 1TEMA 5GLCA 4UHUA 2HJEA 1M19A 1NRFA 4HJ3A 4DXBA 3X1UB 2PDRA 3R45B 3LJAA 4ZBJC 2NQBD 4J8UA 2W3DA 5CP6D 2DRWA 4Z5TC 2A2LA 3UT9C 4RA7A 3X1UA 4JJNA 2XLNA 3G35A 4XUZA 4BBVA 4EERA 3MVDC 3AZEC 2O9AA 1HZOA 4YS3C 4G3KA 1PDCA 3EQUA 1YM1A 1HQ3B 4LGWA 1F98A 1WYCA 3WRZA 4J8VC 1ID3D 3AZGB 3GVBA 3H82A 1GA0A 2YFWB 4OPQA 5IT5A 3BEBA 2HUEB 3AV2C 1P3GB 2C5WB 5DFXA 2G2WA 4Z2MG 1HQ3A 1P3PC 3OLOA 3RTYA 4WN5A 1K54C 5GHXA 3AZGA 2QJ5A 3WAAD 4OQHA 3AFAC 5B0ZA 2FJ7D 3IT9A 1DY6A 2VGJA 1K6RA 4CLCC 1XJ6A 3AYWD 3REIB 3LELD 3A3FA 3TW8A 5BS7A 3KWQB 4H9RB 3IX3A 5FI7A 1ALQA 4R8PB 4R70A 2D02A 2HIOC 2HDRA 5B1MA 3H0RC 3REKB 3ITBA 3QP6A 2Y91A 3IH8A 3WWXA 5GLDA 4H9SC 1K25A 1ED7A 4RVAA 3GR2A 4S2PA 4GKUA 2WAEA 3REKA 2H28A 5F99B 3WTPD 5JRGD 3REJC 2WAFA 3B3XA 4Z66D 4JF4A 3V39A 1AIWA 4EV4A 2JHEA 5FAPA 2CMNA 3BJNA 3OPRA 4IBJA 1KGEA 1MXOA 1PI4A 2OOLA 3V9RB 4Y0UA 4Z2LA 1GSVA 1PW1A 3PBNA 3D4FA 3S7OA 3UY6A 1KE0A 1JWVA 4UUZB 3W97C 3F1OB 1IYSA 3LR4A 4PKYA 1NY0A 3A3JA 4MCWA 4DF6A 4XZQB 2ZM8A 3MNNC 3JVUA 3EPJA 2W3HA 3ZGAB 5DTTA 3UE0A 4GHAA 3VV4A 1TZYB 3B6GD 1P34D 1F66A 5HWTA 4G92B 4N9LA 1KX3B 2WZXA 2C6WB 1G6AA 5EVID 4WMCD 4MB4A 1TZYA 3AGEA 3HLEA 4QHCA 4WZ5A 4IUKA 1K57C 5HWWA 3B0DB 4GZBA 2Y55A 4NFTA 5GT3C 1P3KC 1KX3A 2Y2GA 1EQZA 5CHLB 4I3IA 3CUEC 4KZAA 3T1SA 3VMAA 4P85A 1CEGA 3A3EA 2F8NH 4GD6A 3G6OA 4QJGA 3CHWP 3IF6A 1KX5A 3E98A 4ARZA 4CJNA 3FDDA 1EI5A 5BNVA 3C1BC 1PNEA 3LEQA 2XSSA 4DE2A 4WBGA 3AV1A 1P3BB 4LG2A 3PXPA 4XUJB 1MWSA 4OKPA 1Y4OA 5DNMC 1BULA 1XGIA 3IBJA 2HV1A 3B0BA 5B2IA 3OZHA 5B32A 1GCEA 3MGRC 2ZJ9A 4WU9C 1P3BA 5B0YC 3KXBB 3A6NB 3AZIB 1YAXA 5HW3A 5A93A 4LV1A 1GHMA 3ZG0A 1HLUP 3G2ZA 1K4EA 4UEYA 5JYOA 5CPJD 1S1ZA 4JBFA 5AV8B 4BL3A 2NQBC 1K56A 4X25A 1XGJA 2VV6A 1VM1A 5CP6C 3P01A 4KUDA 1F1EA 3LR5A 1N9OA 4YINA 2VLGA 1M18A 3AZJB 3W98B 1CF0A 3W96A 3HONA 5I94A 3AZLA 4OPZA 2L1MA 1ID3C 3LZ0D 1BH9A 2W1TB 1PFLA 3CAXA 1S4RA 5E5AD 3A0VA 1LT0A 3R7WA 2HP6A 1TF1A 5AV9C 3WAAC 5AVCD 2XRNA 3HSHA 3N8SA 1BUEA 3M2KA 2XGNA 1L0GA 2FJ7C 3OCNA 1TVFA 1YU4A 4Z9QA 1V9ZA 1KX4B 4BBUA 4JGPA 4KQOA 3W99A 3IBRA 4KZ7A 3KSYA 1ZLAD 2AROB 3AYWC 4WU8D 4K91A 5KMWA 1IOUA 3LELC 3VOZA 3JPUA 2PYOB 4NXBA 5B40A 5AVFA 1LHYA 4C6YA 4E3JA 1FIKA 1N9BA 4IBGA 5B1LA 3O62B 3B6FA 1ES5A 2AROA 1CJFA 1H8YA 3IXGA 1JVJA 4Y2FA 3EWKA 2NUPC 3N4IA 2GJ3A 3IX8A 3QNBA 3X1SB 3WA9D 3C1CB 4HH2A 4HBTA 4D2OA 3CI6A 3WTPC 5JRGC 2NZDA 4QY5A 4PMAA 4Y5FA 3T4SA 3IS2B 1H3OA 1YLWA 4NG2A 4X1MA 3RELB 1YLZA 1E6PA 3MGQA 4MN5A 5GSUB 5DNND 2VV8A 3AZFA 5AJGA 1JWZA 4ME4A 5FQJA 5EM0A 1RGYA 3CJMA 4IHQA 4KUKA 5GSUA 2CV5D 3MQLA 2EFUA 1BT5A 5G49A 3KUYA 4BLMA 1NZUA 3ZQ5A 3SH9A 3ZDJA 1M40A 3B6GC 4X23D 1P34C 5FEGA 3OCLA 3F1PA 3UTBA 3OPPA 1F2KA 3LICA 1KGGA 5B31D 2EX6A 5EVIC 4S2MA 1NYMA 4EBLA 1KU5A 2ACGA 3AN2B 1P3LD 4ZTKA 1XA7A 1OTBA 5DKLA 3E2KA 5F1GA 5GXQD 4ZUXB 4DKIA 1IFQA 4PM9A 3SS5A 3WD1A 4QLCA 4NYYA 1T19A 5HZHA 1K4FA 3FPVA 3GDIA 5U47A 4OOYA 2EWWA 4YM6B 4DN0A 3A0RA 3DWKA 3D9YA 3H9WA 3MGPD 5B2JD 3IP4C 4NY2A 2VGLS 2OSUA 2KDKA 1U60A 3QP4A 5HAQA 4NE3A 1BLHA 2J3TD 1OTDA 3AZMB 4OPRA 3MGSA 4EQ1A 2F8NG 3LEZA 4GS9B 4J8WA 3Q81A 3VP4A 3AZKD 3X1TA 4JPMA 3CWFA 3RH8B 1W8QA 5CPJC 1S32B 2WKRA 4NZ5A 1B6WA 4P6ZS 4JGOA 1H8MA 3T1RA 3AGFA 1M1AD 5F6AA 1JTGA 1H0IA 3BRMA 4WLAA 1G68A 3M2JA 2E8IA 3MFXA 4ZBJB 4KG5A 5TBMB 1UGUA 4L9FA 3UDXA 3N8RA 1UWPX 1PZRA 4Z5TB 3LIEA 3UT9B 3LFVA 2P74A 2EA9A 1H3QA 3LZ0C 1VQQA 1KE3A 1E8BA 2RVQC 3MVDB 3AZEB 2ZMAA 4YS3B 3O88A 5E5AC 4KENB 4IBFA 1S0WA 4UAAA 5G18A 1MKMA 1Q2PA 4KG2A 4KZ3A 2IWBA 2ZY3A 4B9OA 5AVCC 3AV2B 4IBIA 3VP2A 4E3KA 1MZUA 4H9OB 5AY8A 3NQUB 3AZNA 1B67A 1QMEA 1E88A 1P3FD 3Q7VA 5GT0C 1G6OA 1MC0A 4H9PB 1HTZA 1ZKJA 2G7UA 5E2EA 3DTMA
chains in the Genus database with same CATH topology
1KVLA 4DRAA 3AFAB 1ZLAC 4WU8C 3VSLA 4UA9A 1SDNA 1Q2QA 3G34A 4H9PA 3N3FA 5AVBA 3RXWA 4OJOA 3PAEA 2HIOB 4GHLA 2ZC7A 3L2AA 2I72A 3ZNTA 2CWEA 3TOIA 1AOIB 3V3RA 4E44A 3IWQA 4EO5C 1A7WA 4B88A 1YU1A 3Q1FA 3EPHA 3NC8A 5DNNC 1AOIA 5CPIA 3TU4A 3WKJA 3HUMA 4N1XA 3W4PA 1P3AA 1P3IA 3REJD 3PBQA 5EOOA 3A3IA 4KHAB 1YLPA 2CV5C 3X1VD 5CGXA 3W97B 3HUOA 3M6HA 5DTSA 3A1KA 4X23C 2WGWA 5HX9A 4KHAA 1WE4A 3LZ1C 4LD9D 3G31A 5B31C 4KGCA 2WADA 1O07A 1PWCA 1XP4A 3REHA 4FD8A 1CI9A 3BECA 3F6TA 5HL1A 1P3LC 1RGZA 4JXGA 4CAYA 4OVDA 5B33D 1XKZA 2V20A 3SOIA 5GXQC 2IO5C 1U35B 2OV5A 3IWIA 3E2LA 5AV6A 5B24D 5GT3B 1P3KB 1P3MD 2Y2OA 4JKTA 5BOHA 1P3OB 3I7JA 3MGPC 5B2JC 1U35A 2ZLYA 3ZG7B 2Y59A 2YFVA 4O7DA 2F8NB 4OOMA 3MBZA 4R3BA 1P3OA 3JYIA 3C1BB 3BM6A 5CHJA 3UTAD 1JTDA 2XFTA 5DNMB 4OJ6A 4WZSB 4BQMA 4J8XD 3AZKC 3MGRB 4WU9B 3IXHA 4JLFA 5B0YB 1M1AC 4OP8A 3VOYA 3PAGA 2NQBB 1IELA 4H9NA 5CP6B 3OPLA 2B5RA 5HAIA 3P09A 4XXRA 5CP6A 1ID3B 2G5HC 4ZJ1A 3R45A 1M19D 3NCKA 2R9WA 3MXSA 3LJAD 2PU2A 2VGKA 4J8UD 1ID3A 4KQRA 1P3FC 4NE5A 2Y2QA 2RL3A 3UE3A 3WAAB 3GSGA 1XX2A 3X1UD 4JJND 1PIOA 2FJ7B 5AV9D 2YFWA 4E3LA 1P3GA 4NZ3A 1ERQA 3AYWB 2BYMB 3LELB 1R4VA 5FQMA 4ZJ2A 3AZGD 2DCFA 4EUZA 4R1GA 3VP1A 3PBTA 3ZVWA 5B0ZD 3TG9A 4PM8A 1E25A 2Y2IA 1ESUA 4IJEA 4DE0A 4HGAC 3HLCA 3REIA 5FSRA 5DTKA 3KWQA 5CHMA 4H9RA 4LV0A 5DF8A 5CERA 5FUGB 4UA6A 3WTPB 4R8PA 5JRGB 4Z66B 1FOFA 3ZHHA 5CPKB 4PPRA 2HDQA 3ZG9B 5B1MD 5L2FA 4S2NC 2BYKB 1LL9A 1BTLA 1YT4A 4Z66A 3UN7A 5AV5B 3X1VC 3IF5A 5CPKA 5F99A 2BYKA 3S22A 5AV5A 1K55C 4LD9C 1YLYA 3UPNA 3V9RA 3UO9A 3G32A 1JFIB 3B6GB 1ONHA 1P34B 2P9VB 4GOGA 4DQYB 4UUZA 5GHYA 2ZQ9A 5CGWA 4N1HA 4FCFA 3O87A 3HLBA 4XZQA 5B33C 5EVIB 1RP5A 1TAFB 5CTMA 4HBUA 4WYYA 3UDIA 2ZQCA 5B24C 1S6RA 1P3MC 2IWCA 3KS8A 1F66D 2H0YA 1LI0A 2DQNC 1ZG6A 3VP0A 3VH6T 5C3IC 4IBKA 4E6WA 1TZYD 3V3SA 5DVAA 1PWGA 3WRTA 4OPYA 3UTAC 3G30A 4IBRA 1Z2CB 3BFFA 4J8XC 3VFHA 1EQZD 5E43A 4GD8A 2LY8A 4PM6A 3KS4A 1NXYA 3PBRA 3NQJB 5FA7A 5GHZA 1NYYA 2XR0A 3IH9A 4PM7A 4WEJA 1KX5D 5CPJB 3V50A 4XUJA 3OPHA 1WWSA 3AV1D 3N7WA 4HEFA 5B2ID 3AZIA 3KXBA 3A6NA 5B32D 2HPBA 2UWXA 4Y7PA 4EBNA 3LZ0B 2H0TA 4WM9A 3EPLA 1M19C 3AZHD 5AV8A 2DNSA 5E5AB 3MFDA 3L29A 3LJAC 4KZ9A 3M6BA 2RVQD 1K56D 4J8UC 1WWIA 4KUDD 2J9OA 3AZJA 3W98A 5AVCB 3X1UC 4JJNC 5E5AA 1M18D 2EXBA 4WEKA 3W96D 3AZLD 3FKWA 4QY6A 1BLCA 5TGFA 2PU4A 1ZLAB 3GRJA 5GT0D 4R23A 4OJPA 2Y2JA 1I2WA 1HQ3C 5EECA 3AZGC 3HLFA 3NY4A 2HUEC 5B0ZC 1MY8A 5M1AA 1KX4A 1SHVA 2ZC6B 3WX7A 4S2LA 3WA9B 3W99D 4IBBA 4P0MA 4DRTA 2PYOA 4E3MA 5BS7C 3O62A 5B40D 4IBDA 5AQAA 1SKFA 3IXBA 1N1JB 3WA9A 1E3UA 5B1LD 3B6FD 3DWZA 3P98A 3VP3A 2AROD 5B1MC 1MPLA 5DNNB 3X1SA 1DJAA 3C1CA 2ZD8A 3VFFA 5M18A 2XQZA 3REKC 2CV5B 2HP9A 2NZDD 3RELA 3UPPA 2ZM0A 4KQQA 4X23B 2CV5A 3MGQD 4OUIA 3VH5T 3AZFD 4GN2A 5A91A 5B31B 2HP5A 3H0MC 4R3JA 3LZ1D 3WS4A 2XFSA 5GSUD 3ZFZA 4S2KA 3KUYD 5GXQB 4MBFA 1F66C 3UTBD 5A92A 2BG1A 5GXQA 1BSGA 3AN2A 3BYDA 3MGPB 5B2JB 1E4DA 1TZYC 2OLUA 3TSGA 4EWFA 4WZ5C 2J8YA 4ZUXA 3BLSA 3UE1A 1EQZC 1Z6FA 5B2JA 4YM6A 3MKFA 4QLCD 5CTNA 3LO7A 3L26A 2IWDA 3MZDA 3AZKB 2XDMA 3IF6C 1KX5C 3MKEA 4OJLA 3AZMA 1M1AB 3FZCA 1W79A 3AV1C 4X56A 4OQ0A 3RJUA 4WV4B 4QU3A 3MGSD 5JYPA 5B2IC 5B32C 4X55A 2XH9A 1M1AA 4QNLA 1P3BC 4J8WD 4JXWA 1ONGA 4H9QB 1S32A 3LY3A 5JA4B 3X1TD 1ULYA 3NBLA 3AZHC 3B0CW 4MBHA 4IBCA 1SDEA 3FYZA 2XK1A 2EX9A 4KUDC 4L0LA 4AWLC 4R0QA 4Z5TA 4J8VB 3FKEA 1M18C 2ZY5A 3UT9A 1PZPA 3W96C 1BLSA 3AZLC 1P3FB 3MVDA 3AZEA 3QNCA 4YS3A 5FQQA 1P3PB 1W8YA 4WELA 3MZEA 4J8VA 1J9MA 4WJ3C 4LV3A 2G5IC 3AV2A 1K6SA 4LCMA 4ZDXA 2XD5A 4H9OA 3NQUA 1P3PA 2JBFA 4NK3A 4F94A 1K54A 4PM5A 5BNXB 5AY8D 3AZND 1DJBA 5CGSA 2WKHA 1FCOA 3AFAA 1HD8A 1AXBA 5CECA 3W99C 3BFEA 4HGAB 3C4OA 5B40C 3WS5A 1LI9A 3W4QA 5B1LC 4OH0A 3B6FC 5BO0B 1LL5A 1IKIA 2AROC 1FCMA 5AVBD 2HIOA 5KDMB 3EPKA 3REJB 1ZC2A 1L0FA 2WUQA 4H9SA 3HBRA 2QMIA 2ZY4A 3X1VB 2NZDC 1KDSA 3CMZA 3EQVA 3REJA 5CXWA 4CSRB 2V1ZA 5KZHA 3MGQC 4OQIA 1AOID 4LD9B 3HVFA 5CPID 3TU4D 3AZFC 3WKJD 3MNNB 5FASA 5EOEA 4GDNA 1P3AD 1P3ID 1CI8A 1MWRA 1YMSA 3IWOA 2HDSA 4NE6A 2Y2MA 2IOUA 4MBKA 5GSUC 3W97A 4GH9A 5B33B 3KUYC 3MNNA 1BFMA 3HLGA 3A3DA 5B24B 3UTBC 1P3MB 1EROA 2ZQ8A 4KGCD 1YU2A 4B4ZA 3REHD 4NZ1A 4DE1A 5C3IB 5FQ9A 1K57A 2Z2MB 1FR6A 5GLBA 3AGDA 5GT3A 3UTAB 1P3KA 1FR1A 4QLCC 1BZAA 5AV6D 4J8XB 5EPHA 4G91C 4Q8IA 4Y0TA 2J8PA 2JSSA 2L5AA 2F8NA 3SS4A 4S2JA 3C1BA 4JF6A 4H8RA 3MGSC 5E2FA 5DNMA 2EX2A 4P6BA 4BENA 3MGRA 4J8WC 4WU9A 4OOLA 3X1TC 3VH6W 4NZ4A 5B0YA 3DW0A 4C3QA 2XD1A 1M19B 4KZ4A 1FSWA 2NQBA 3PBSA 4DXCA 3LJAB 1PYYA 3UPOA 4J8UB 2ZM5A 2RIQA 3OC2A 2XEPA 4NYUA 4JJNB 1KGFA 4K0XA 3HREA 2Y2HA 5AV9B 4JXVA 4IBXA 5CEBA 2X01A 3IHAA 3Q7ZA 4OLDA 4P87A 5FAQA 1HTAA 5AY8C 3AZNC 1W2EA 5AV9A 3WAAA 5F1FA 4S2OA 4QD4A 4DDYA 1O7EA 2FJ7A 1HQ3D 4N9KA 4ZBEA 5B0ZB 4R4SA 4A5RA 3AYWA 1P3GD 5F82A 2BYMA 1W5DA 3LELA 4ID4A 1IEMA 2Y2LA 4CPKA 5EUAA 5AVBC 4GDBA 1ES3A 3EG5B 4HESA 4JF5A 4IVIA 2JE5A 2WKIA 4X6TA 1YU3A 2JC7A 3IXDA 5B1MB 4JXSA 1I2SA 3REID 5FUGA 1W7FA 3WTPA 2R9XA 5JRGA 3KWQD 4OJ5A 1YU0A 3L28A 5CEDA 4R8PD 1ERMA 1AOIC 5CPIC 2EX8A 3TU4C 2G2UA 3REKD 3WKJC 1OMEA 1P3AC 1P3IC 5BT1D 2GDNA 2Z2LB 5GLAA 3L25A 3C5AA 5HARA 1MKIA 4S2IA 5CPKD 2EXAA 5F99D 3N8LA 4YFMA 5AV5D 1JFIA 3B6GA 2A49A 5B31G 1P34A 1C3BA 3G2YA 2P9VA 2WGIA 4KGCC 4FH4A 4IJFA 3REHC 1F66B 4RX3A 5FAOA 1YLTA 1XA1A 5EVIA 4WMCA 3BFGA 1TAFA 3N6IA 4GB7A 3C7VA 5FI2A 4XZQD 3GV9A 4E45A 3SS3A 5IHVA 5CRFA 5AV6C 4OQGA 3VH5W 1EQZB 1YMXA 3HLDA 5HAPA 4U0TA 5AQBA 1U35C 3P5JB 1KX3D 3WS0A 3IF6B 1KX5B 1BLPA 1P3OC 5BNVB 4UA7A 5E2GA 3AV1B 3GQZA 4KZBA 2DF4C 5B2IB 3NQJA 5B32B 4K0WA 1FCNA 5CPJA 1MBLA 3WS1A 1ESIA 3ISGA 3AZHB 4IEDA 1IKGA 1P3BD 1KDWA 4XUJD 2Y2NA 4KUDB 4AWLB 3O3VA 3AZHA 5FQKA 4WZ4A 1IYPA 4MLLA 1M18B 1L0DA 4IVKA 4DDSA 3LZ0A 3AZID 3KXBD 3A6ND 3W96B 4OP5A 3AZLB 1YQSA 3G4PA 1QMFA 4FSFA 1BH9B 1DJCA 3IHBA 1IYQA 5AV8D 5GT0B 5AVCA 4N92A 3W4OA 4E3IA 3AZJD 4WU8B 3W98D 5BPVA 5GT0A 1LLBA 1M6KA 3ITAA 3BLMA 1MWTA 1ZLAA 4KZ5A 1P3GC 3S4XA 4WU8A 5KSHA 2Y4AA 3W99B 1NZOA 2WZZA 4XUXA 2V2FF 5B40B 1WYBA 3SH7A 5B1LB 3B6FB 4IBEA 2ZC4B 5EVLA 4B4XA 1KX4D 3L27A 2QZ6A 4EO5B 2EFXA 1K38A 3FV7A 3REIC 3KWQC 3HUNA 2PYOD 1N1JA 4R8PC 2NZDB 3O62D 1FQGA 3GMWA 5FI6A 3VSKA 4BD0A 1H3OB 1E3UD 5DNNA 3V5MA 5BT1C 2Y2PA 3MGQB 1Q9CA 3X1SD 3C1CD 3AZFB 4Z66C 3ZCZA 3KFUG 1KE4A 2ZQDA 4ZJ3A 5CPKC 5F99C 3LZ1B 2OLVA 4LENA 1KVMA 3NDGA 2H10A 3UDFA 5G49B 3RELD 5AV5C 3KUYB 4X23A 1P3LB 3LZ1A 5DF9A 2A3UA 5B31A 4MEZA 3UTBB 4BJPA 4UPKA 2IO5B 2ZC3B 4KZ6A 1XXMA 4XZQC 1P3LA 2QPNA 3LY4A 3MZFA 2ZQ7A 4G92C 5GL9A 4QLCB 5D3OA 1KX3C 3NI9A 3FWLA 3MGPA 1NJ4A 1L0EA 2Q9NA 4G91B 3B0DC 1GA9A 3AN2D 2W8SA 2J7VA 2HDUA 3AL0C 4ZUXD 5FDHA 3MGSB 5FATA 1H5XA 4YM6D 3AZKA 3MXRA 4RX2A 1HVBA 1YLJA 1ZG4A 4J8WB 3PBOA 1PZOA 3X1TB 3GTCA 4X68A 4FH2A 4XUJC 1Y54A 3AZMD 1EWZA 5CHUA 2WYXA 2WGVA 2RCXA 4DE3A 2X71A 3AZIC 3KXBC 3A6NC 2J9PA 3HL9A 4H9QA 5JA4A 3A1IA 1IYOA 3ZG8B 2ZM2A 3BFCA 1S32D 4GNUA 5AV8C 5A90A 5F83A 4EBPA 1ES4A 3AZJC 1RCJA 5TR7A 3W98C 4Z2MH 1P3FA 4Z5TD 5AY8B 4U3TA 3AZNB 3S1YA 2CC1A 3UT9D 3VH6A 5EE8A 4X53A 3MVDD 3Q7VB 4C75A 3AZED 1JWPA 4YS3D 1FSYA 5TFQA 3BFDA 4J8VD 3SH8A 3PTEA 2FFFB 2VQRA 5HFOA 2JCHA 3AV2D 5BNXA 1P3PD 3LCEA 4U0XA 3ZNYA 3HLWA 5AVBB 3ZVTA 3FKVA 4RYEA 1KX4C 3AFAD 1PW8A 1PWDA 3NDEA 1GHPA 2ZQAA 2PYOC 3O62C 1I5QA 5BO0A 1YUEA 3WA9C 2H5SA 4OLGA 5KDMA 2HIOD 2BLSA 3X1SC 5CPIB 3NIAA 3TU4B 3C1CC 2FFYA 4NETA 4S2NA 3IQAA 3WKJB 3O86A 1P3AB 1P3IB 1T3UA 4ZAMA 3X1VA 3H0LC 5J8XA 3RELC 4CSRA 4X69A 5FQIA 1K55A 4LD9A 3Q82A 1TDLA 3CZDA 2WGWB 2ZC5B 2Y2KA 4LV2A 4BL2A 3C7UA 4E6XA 1PI5A 4E3NA 4KGCB 2F8NK 4M3KA 3ZG5A 1CK3A 5E2HA 3REHB 3WS2A 1ES2A 4BD1A 5B33A 3W97D 4CAYB 3MNND 2X02A 3QHYA 5B24A 3RXXA 1P3MA 1N4OA 4MNRA 4KG6A 3W8KA 5AV6B 3UNWA 4QB8A 4DRBA 5KSCA 2F2AC 3AN2C 1XPBA 4LCLA 4EQIA 1CEFA 1TDGA 4WNNB 1SCWA 2YFVB 4R4RA 4ZUXC 3UTAA 2WK0A 1U35D 5AQ9A 5GT3D 4YM6C 4J8XA 1P3KD 1MWUA 4WNNA 4E3OA 1P3OD 4OONA 3B0CT 3CG5A 1H8ZA 2XF3A 4KZ8A 2F8ND 3AZMC 3Q07A 2ZY2A 4M6BA 3C1BD 1BH8B 3C4PA 5AQ7A 5B32G 5DNMD 3VH5A 3WTPE 4H9NB 2WKEA 4Y0OA 5DF7A 1GHIA 1BH8A 3MGRD 2Q9MA 4WU9D 2PBYA 1S32C 1L2SA 5M19A 5B0YD 1TEMA 5GLCA 4UHUA 1M19A 1NRFA 4DXBA 3X1UB 3R45B 3LJAA 4ZBJC 2NQBD 4J8UA 5CP6D 2DRWA 4Z5TC 3UT9C 4RA7A 3X1UA 4JJNA 2XLNA 3G35A 4XUZA 3MVDC 3AZEC 1HZOA 4YS3C 3EQUA 1YM1A 1HQ3B 1WYCA 3WRZA 4J8VC 1ID3D 3AZGB 3GVBA 1GA0A 2YFWB 4OPQA 3BEBA 2HUEB 3AV2C 1P3GB 2C5WB 2G2WA 4Z2MG 1HQ3A 1P3PC 1K54C 5GHXA 3AZGA 3WAAD 4OQHA 3AFAC 5B0ZA 2FJ7D 3IT9A 1DY6A 2VGJA 1K6RA 3AYWD 3REIB 3LELD 3A3FA 5BS7A 3KWQB 4H9RB 5FI7A 1ALQA 4R8PB 2HIOC 2HDRA 5B1MA 3H0RC 3REKB 3ITBA 2Y91A 3IH8A 3WWXA 5GLDA 4H9SC 1K25A 4RVAA 3GR2A 4S2PA 4GKUA 2WAEA 3REKA 5F99B 3WTPD 5JRGD 3REJC 2WAFA 3B3XA 4Z66D 4JF4A 3V39A 4EV4A 5FAPA 3OPRA 4IBJA 1KGEA 1MXOA 1PI4A 3V9RB 4Y0UA 1PW1A 3PBNA 3D4FA 3UY6A 1KE0A 1JWVA 4UUZB 3W97C 1IYSA 1NY0A 3A3JA 4DF6A 4XZQB 2ZM8A 3MNNC 3EPJA 3ZGAB 5DTTA 3UE0A 4GHAA 1TZYB 3B6GD 1P34D 1F66A 4G92B 4N9LA 1KX3B 2WZXA 2C6WB 1G6AA 5EVID 4WMCD 1TZYA 3AGEA 3HLEA 4QHCA 4WZ5A 1K57C 3B0DB 4GZBA 2Y55A 4NFTA 5GT3C 1P3KC 1KX3A 2Y2GA 1EQZA 5CHLB 4KZAA 3VMAA 4P85A 1CEGA 3A3EA 2F8NH 4GD6A 4QJGA 3IF6A 1KX5A 4CJNA 3FDDA 1EI5A 5BNVA 3C1BC 4DE2A 4WBGA 3AV1A 1P3BB 4LG2A 4XUJB 1MWSA 4OKPA 5DNMC 1BULA 1XGIA 3B0BA 5B2IA 3OZHA 5B32A 1GCEA 3MGRC 2ZJ9A 4WU9C 1P3BA 5B0YC 3KXBB 3A6NB 3AZIB 5HW3A 5A93A 4LV1A 1GHMA 3ZG0A 3G2ZA 1K4EA 5JYOA 5CPJD 4JBFA 5AV8B 4BL3A 2NQBC 1K56A 1XGJA 1VM1A 5CP6C 4KUDA 1F1EA 4YINA 1M18A 3AZJB 3W98B 3W96A 3HONA 5I94A 3AZLA 4OPZA 1ID3C 3LZ0D 1BH9A 5E5AD 2HP6A 5AV9C 3WAAC 5AVCD 3HSHA 3N8SA 1BUEA 3M2KA 2XGNA 1L0GA 2FJ7C 3OCNA 1TVFA 1YU4A 4Z9QA 1KX4B 4KQOA 3W99A 4KZ7A 3KSYA 1ZLAD 2AROB 3AYWC 4WU8D 4K91A 5KMWA 3LELC 3VOZA 2PYOB 5B40A 1LHYA 4C6YA 4E3JA 1N9BA 4IBGA 5B1LA 3O62B 3B6FA 1ES5A 2AROA 1H8YA 3IXGA 1JVJA 3N4IA 3QNBA 3X1SB 3WA9D 3C1CB 4HBTA 4D2OA 3WTPC 5JRGC 2NZDA 4QY5A 4PMAA 1H3OA 1YLWA 3RELB 1YLZA 3MGQA 5GSUB 5DNND 3AZFA 1JWZA 5FQJA 1RGYA 3CJMA 5GSUA 2CV5D 2EFUA 1BT5A 5G49A 3KUYA 4BLMA 1NZUA 3SH9A 3ZDJA 1M40A 3B6GC 4X23D 1P34C 3OCLA 3UTBA 3OPPA 1KGGA 5B31D 2EX6A 5EVIC 4S2MA 1NYMA 4EBLA 1KU5A 3AN2B 1P3LD 4ZTKA 1XA7A 3E2KA 5F1GA 5GXQD 4ZUXB 4DKIA 4PM9A 3SS5A 4QLCA 4NYYA 1K4FA 5U47A 4OOYA 4YM6B 3DWKA 3MGPD 5B2JD 3IP4C 4NY2A 2OSUA 1U60A 5HAQA 4NE3A 1BLHA 3AZMB 4OPRA 3MGSA 2F8NG 3LEZA 4J8WA 3Q81A 3VP4A 3AZKD 3X1TA 4JPMA 1W8QA 5CPJC 1S32B 4NZ5A 1B6WA 3AGFA 1M1AD 1JTGA 3BRMA 1G68A 3M2JA 2E8IA 4ZBJB 4KG5A 3UDXA 3N8RA 1PZRA 4Z5TB 3UT9B 2P74A 1VQQA 3LZ0C 1KE3A 2RVQC 3MVDB 3AZEB 2ZMAA 4YS3B 3O88A 5E5AC 4KENB 4IBFA 1S0WA 4UAAA 5G18A 1Q2PA 4KG2A 4KZ3A 2IWBA 2ZY3A 5AVCC 3AV2B 4IBIA 3VP2A 4E3KA 4H9OB 5AY8A 3NQUB 3AZNA 1B67A 1QMEA 1P3FD 3Q7VA 5GT0C 1ZKJA 5E2EA 4H9PB 1HTZA 3DTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  3SS3 A;  2WKE A;  4Y0O A;  5DF7 A;  5IHV A;  5CRF A;  3VFF A;  5M18 A;  2XQZ A;  1GHI A;  3VSL A;  2Q9M A;  4UA9 A;  2HP9 A;  2PBY A;  1SDN A;  1L2S A;  4OQG A;  3UPP A;  5M19 A;  1Q2Q A;  3G34 A;  1TEM A;  5GLC A;  1YMX A;  3HLD A;  4UHU A;  1NRF A;  2ZM0 A;  4KQQ A;  4DXB A;  5HAP A;  4U0T A;  5AQB A;  3WS0 A;  3RXW A;  4GN2 A;  3IF6 B;  5A91 A;  2DRW A;  1BLP A;  2HP5 A;  3PAE A;  2ZC7 A;  4R3J A;  4UA7 A;  4RA7 A;  3G35 A;  2XLN A;  4XUZ A;  2I72 A;  3ZNT A;  5E2G A;  3WS4 A;  2XFS A;  1HZO A;  3EQU A;  3GQZ A;  1YM1 A;  3TOI A;  3ZFZ A;  1WYC A;  4S2K A;  4KZB A;  3WRZ A;  3V3R A;  3IWQ A;  3GVB A;  4K0W A;  1GA0 A;  4OPQ A;  4B88 A;  1FCN A;  3Q1F A;  3BEB A;  2C5W B;  4MBF A;  2G2W A;  1MBL A;  3WS1 A;  3NC8 A;  1ESI A;  3ISG A;  4IED A;  1K54 C;  5A92 A;  5GHX A;  1IKG A;  2BG1 A;  3HUM A;  4N1X A;  1BSG A;  1KDW A;  3W4P A;  3BYD A;  2Y2N A;  1E4D A;  3PBQ A;  2OLU A;  3TSG A;  4OQH A;  4WZ5 C;  4EWF A;  5EOO A;  2J8Y A;  3A3I A;  3O3V A;  1YLP A;  3IT9 A;  5FQK A;  4WZ4 A;  1IYP A;  3BLS A;  4MLL A;  1DY6 A;  4IVK A;  1L0D A;  3UE1 A;  5CGX A;  4DDS A;  3HUO A;  1Z6F A;  2VGJ A;  1K6R A;  3M6H A;  4OP5 A;  5DTS A;  1YQS A;  3G4P A;  3MKF A;  5CTN A;  3LO7 A;  1QMF A;  2WGW A;  4FSF A;  3A3F A;  5HX9 A;  1DJC A;  2IWD A;  3MZD A;  1WE4 A;  3IHB A;  1IYQ A;  5FI7 A;  2XDM A;  3G31 A;  1ALQ A;  3IF6 C;  3MKE A;  2WAD A;  1O07 A;  1PWC A;  2HDR A;  4N92 A;  1XP4 A;  3W4O A;  4FD8 A;  4E3I A;  3FZC A;  1CI9 A;  3BEC A;  1W79 A;  3ITB A;  4X56 A;  4OQ0 A;  5HL1 A;  1RGZ A;  2Y91 A;  4JXG A;  3RJU A;  3IH8 A;  3WWX A;  4QU3 A;  4OVD A;  5GLD A;  1LLB A;  1M6K A;  1XKZ A;  1K25 A;  2V20 A;  3BLM A;  1MWT A;  3ITA A;  3SOI A;  5JYP A;  4RVA A;  3GR2 A;  4S2P A;  4X55 A;  4GKU A;  2XH9 A;  2WAE A;  4KZ5 A;  2OV5 A;  3S4X A;  5KSH A;  3IWI A;  2Y4A A;  3E2L A;  1ONG A;  4JXW A;  3LY3 A;  2WAF A;  1NZO A;  3NBL A;  3B3X A;  4JF4 A;  2Y2O A;  2WZZ A;  3V39 A;  4EV4 A;  5FAP A;  4JKT A;  5BOH A;  4MBH A;  4XUX A;  3OPR A;  3I7J A;  2V2F F;  1KGE A;  1MXO A;  1SDE A;  1PI4 A;  4Y0U A;  1WYB A;  2XK1 A;  3FYZ A;  2EX9 A;  3SH7 A;  2ZLY A;  3ZG7 B;  2Y59 A;  1PW1 A;  3PBN A;  3D4F A;  4L0L A;  4R0Q A;  4O7D A;  3UY6 A;  1KE0 A;  4OOM A;  1JWV A;  2ZC4 B;  3MBZ A;  5EVL A;  4B4X A;  4R3B A;  3JYI A;  2QZ6 A;  3BM6 A;  1PZP A;  5CHJ A;  1IYS A;  2EFX A;  1BLS A;  1NY0 A;  1K38 A;  3A3J A;  4DF6 A;  1JTD A;  3QNC A;  2ZM8 A;  3FV7 A;  2XFT A;  5FQQ A;  1W8Y A;  3ZGA B;  4WEL A;  4BQM A;  3MZE A;  3HUN A;  1J9M A;  5DTT A;  3UE0 A;  4LV3 A;  1FQG A;  3IXH A;  3GMW A;  5FI6 A;  4JLF A;  3VSK A;  4BD0 A;  1K6S A;  4LCM A;  4ZDX A;  2XD5 A;  2JBF A;  1E3U D;  4NK3 A;  4OP8 A;  3V5M A;  4F94 A;  1K54 A;  4N9L A;  4PM5 A;  3VOY A;  2WZX A;  2Y2P A;  2C6W B;  1DJB A;  1G6A A;  3PAG A;  5CGS A;  4WMC D;  5EVI D;  3AGE A;  2WKH A;  3HLE A;  1IEL A;  1FCO A;  4QHC A;  4WZ5 A;  1HD8 A;  3ZCZ A;  1AXB A;  1KE4 A;  1K57 C;  2ZQD A;  5CEC A;  3OPL A;  4ZJ3 A;  4GZB A;  2B5R A;  2Y55 A;  2OLV A;  2Y2G A;  4LEN A;  5HAI A;  1KVM A;  3BFE A;  3NDG A;  2H10 A;  3UDF A;  4KZA A;  3P09 A;  4XXR A;  3C4O A;  3VMA A;  4P85 A;  4ZJ1 A;  1CEG A;  3A3E A;  3WS5 A;  1LI9 A;  4GD6 A;  3W4Q A;  5DF9 A;  4QJG A;  4OH0 A;  3NCK A;  2R9W A;  1LL5 A;  1IKI A;  2A3U A;  3MXS A;  3IF6 A;  1FCM A;  2PU2 A;  4CJN A;  4MEZ A;  1EI5 A;  2VGK A;  4BJP A;  4KQR A;  2ZC3 B;  4DE2 A;  4WBG A;  2Y2Q A;  2RL3 A;  1XXM A;  3GSG A;  4KZ6 A;  1MWS A;  3UE3 A;  1XX2 A;  4OKP A;  1ZC2 A;  1BUL A;  1L0F A;  1XGI A;  1PIO A;  2WUQ A;  2QPN A;  3LY4 A;  3HBR A;  3OZH A;  2QMI A;  1GCE A;  2ZJ9 A;  1KDS A;  3CMZ A;  3MZF A;  3EQV A;  4E3L A;  2ZQ7 A;  5HW3 A;  5A93 A;  4LV1 A;  5GL9 A;  1GHM A;  5CXW A;  3ZG0 A;  1ERQ A;  3G2Z A;  1K4E A;  2V1Z A;  5JYO A;  5KZH A;  5D3O A;  4JBF A;  3NI9 A;  4OQI A;  3FWL A;  5FQM A;  3HVF A;  1NJ4 A;  4ZJ2 A;  4BL3 A;  1K56 A;  1L0E A;  1XGJ A;  2Q9N A;  2DCF A;  1VM1 A;  4EUZ A;  5FAS A;  4R1G A;  1GA9 A;  4GDN A;  5EOE A;  3VP1 A;  1CI8 A;  1MWR A;  3PBT A;  3ZVW A;  4YIN A;  1YMS A;  2J7V A;  2HDU A;  3IWO A;  3TG9 A;  2HDS A;  4PM8 A;  2Y2M A;  1E25 A;  4MBK A;  2Y2I A;  5I94 A;  1ESU A;  5FDH A;  4OPZ A;  4DE0 A;  5FAT A;  3HLC A;  5FSR A;  5DTK A;  1H5X A;  3HLG A;  5CHM A;  3MXR A;  4RX2 A;  4LV0 A;  5DF8 A;  1HVB A;  1YLJ A;  5CER A;  1ZG4 A;  3PBO A;  4UA6 A;  1PZO A;  3A3D A;  1ERO A;  2ZQ8 A;  1FOF A;  3GTC A;  4X68 A;  2HP6 A;  4FH2 A;  3ZHH A;  1Y54 A;  4B4Z A;  4PPR A;  2HDQ A;  3ZG9 B;  3N8S A;  1BUE A;  5L2F A;  1EWZ A;  3M2K A;  4S2N C;  1LL9 A;  2XGN A;  5CHU A;  4DE1 A;  1BTL A;  1L0G A;  1YT4 A;  2WYX A;  3OCN A;  5FQ9 A;  3UN7 A;  1TVF A;  2RCX A;  2WGV A;  1K57 A;  4Z9Q A;  2Z2M B;  3IF5 A;  4DE3 A;  2X71 A;  1FR6 A;  2J9P A;  3HL9 A;  4KQO A;  3AGD A;  5GLB A;  4KZ7 A;  1FR1 A;  1BZA A;  1IYO A;  4K91 A;  3ZG8 B;  5KMW A;  2ZM2 A;  3BFC A;  3S22 A;  3VOZ A;  4GNU A;  1K55 C;  3UPN A;  1YLY A;  3UO9 A;  5EPH A;  1LHY A;  5A90 A;  4C6Y A;  4E3J A;  3G32 A;  5F83 A;  4Q8I A;  1N9B A;  4Y0T A;  1ES5 A;  1ONH A;  4EBP A;  2P9V B;  4GOG A;  1H8Y A;  3IXG A;  1JVJ A;  3SS4 A;  4S2J A;  5GHY A;  1ES4 A;  1RCJ A;  5TR7 A;  2ZQ9 A;  5CGW A;  4JF6 A;  4N1H A;  3N4I A;  3QNB A;  4FCF A;  4H8R A;  4U3T A;  3O87 A;  3HLB A;  2CC1 A;  3S1Y A;  5EVI B;  5E2F A;  1RP5 A;  5EE8 A;  4X53 A;  2EX2 A;  3Q7V B;  4P6B A;  5CTM A;  4C75 A;  4HBU A;  4HBT A;  1JWP A;  1FSY A;  4WYY A;  5TFQ A;  4BEN A;  4D2O A;  3BFD A;  4OOL A;  3UDI A;  4QY5 A;  2ZQC A;  1S6R A;  4PMA A;  3SH8 A;  3PTE A;  2FFF B;  1YLW A;  3DW0 A;  5HFO A;  4C3Q A;  2JCH A;  2IWC A;  2XD1 A;  1YLZ A;  3LCE A;  4KZ4 A;  1FSW A;  2H0Y A;  1LI0 A;  4U0X A;  1ZG6 A;  3VP0 A;  3PBS A;  3ZNY A;  4DXC A;  4E6W A;  1JWZ A;  3HLW A;  3ZVT A;  1PYY A;  3FKV A;  4RYE A;  5FQJ A;  1RGY A;  3V3S A;  3UPO A;  5DVA A;  1PWG A;  3CJM A;  3OC2 A;  2XEP A;  4OPY A;  3WRT A;  3G30 A;  1PW8 A;  4IBR A;  2EFU A;  1KGF A;  1BT5 A;  3BFF A;  4K0X A;  1PWD A;  3NDE A;  1GHP A;  2ZQA A;  3VFH A;  3HRE A;  4BLM A;  5E43 A;  2Y2H A;  1NZU A;  4GD8 A;  4PM6 A;  4JXV A;  3SH9 A;  3ZDJ A;  4IBX A;  1M40 A;  1I5Q A;  1NXY A;  3PBR A;  5CEB A;  3OCL A;  5FA7 A;  2X01 A;  3IHA A;  5GHZ A;  3Q7Z A;  1NYY A;  2XR0 A;  3IH9 A;  3OPP A;  2H5S A;  4OLD A;  4OLG A;  4PM7 A;  4P87 A;  4WEJ A;  1KGG A;  5FAQ A;  2EX6 A;  3V50 A;  5EVI C;  4S2M A;  2BLS A;  3OPH A;  3NIA A;  1NYM A;  2FFY A;  4NET A;  4S2O A;  5F1F A;  4S2N A;  3IQA A;  4EBL A;  4QD4 A;  3O86 A;  4DDY A;  1O7E A;  4ZTK A;  3N7W A;  1XA7 A;  4ZAM A;  4N9K A;  4ZBE A;  4HEF A;  4R4S A;  5J8X A;  4A5R A;  3E2K A;  5F1G A;  2HPB A;  4DKI A;  4PM9 A;  3SS5 A;  2UWX A;  4Y7P A;  5F82 A;  4EBN A;  1K4F A;  2H0T A;  1W5D A;  4ID4 A;  4WM9 A;  1IEM A;  5U47 A;  4OOY A;  2Y2L A;  4X69 A;  5FQI A;  1K55 A;  4CPK A;  3Q82 A;  1TDL A;  2DNS A;  3CZD A;  3DWK A;  3MFD A;  2WGW B;  5EUA A;  4KZ9 A;  2ZC5 B;  4GDB A;  2Y2K A;  1ES3 A;  3M6B A;  4HES A;  4LV2 A;  4BL2 A;  3C7U A;  1K56 D;  4JF5 A;  4IVI A;  1PI5 A;  2JE5 A;  2OSU A;  4E3N A;  4E6X A;  1U60 A;  2WKI A;  2J9O A;  4M3K A;  4X6T A;  3ZG5 A;  5HAQ A;  1CK3 A;  2JC7 A;  1BLH A;  5E2H A;  3IXD A;  3WS2 A;  1ES2 A;  4JXS A;  2EXB A;  4OPR A;  4WEK A;  4BD1 A;  1I2S A;  3FKW A;  3LEZ A;  4QY6 A;  2X02 A;  1W7F A;  3QHY A;  2R9X A;  3Q81 A;  1BLC A;  5TGF A;  3VP4 A;  4JPM A;  2PU4 A;  3RXX A;  1N4O A;  4MNR A;  4KG6 A;  3GRJ A;  3W8K A;  5CED A;  4R23 A;  1W8Q A;  2Y2J A;  1I2W A;  1ERM A;  3UNW A;  4QB8 A;  5EEC A;  2EX8 A;  3AGF A;  2G2U A;  5KSC A;  3HLF A;  1JTG A;  1OME A;  3BRM A;  1XPB A;  4LCL A;  4EQI A;  1G68 A;  1CEF A;  3M2J A;  2E8I A;  1TDG A;  3NY4 A;  2GDN A;  4KG5 A;  2Z2L B;  1MY8 A;  5GLA A;  1SCW A;  5M1A A;  3UDX A;  3C5A A;  3N8R A;  4R4R A;  5HAR A;  1MKI A;  1SHV A;  2WK0 A;  2ZC6 B;  4S2L A;  2P74 A;  2EXA A;  4S2I A;  1VQQ A;  5AQ9 A;  1KE3 A;  3N8L A;  4P0M A;  1MWU A;  4DRT A;  2ZMA A;  3O88 A;  4E3O A;  4KEN B;  4E3M A;  1S0W A;  4YFM A;  4OON A;  3CG5 A;  2A49 A;  4UAA A;  1H8Z A;  5G18 A;  1C3B A;  1Q2P A;  5AQA A;  1SKF A;  3IXB A;  4KG2 A;  3G2Y A;  2P9V A;  2XF3 A;  4KZ3 A;  1E3U A;  2WGI A;  2IWB A;  4KZ8 A;  4FH4 A;  3DWZ A;  3P98 A;  3VP2 A;  4E3K A;  3VP3 A;  1MPL A;  4RX3 A;  5FAO A;  3Q07 A;  1YLT A;  1XA1 A;  5EVI A;  4WMC A;  1QME A;  3BFG A;  1DJA A;  3N6I A;  4GB7 A;  3Q7V A;  1ZKJ A;  3C4P A;  2ZD8 A;  1HTZ A;  3C7V A;  5E2E A;  5AQ7 A;  5FI2 A;  3DTM A;  3GV9 A; 
#chains in the Genus database with same CATH topology
 1KVL A;  4DRA A;  3AFA B;  2W3G A;  4FUW A;  1ZLA C;  4WU8 C;  3VSL A;  4UA9 A;  1SDN A;  1Q2Q A;  3G34 A;  4H9P A;  4CLC B;  3N3F A;  2FH5 A;  1W63 Q;  3H7W B;  4XT2 A;  5AVB A;  3RXW A;  3U4L P;  5KIZ A;  4OJO A;  1LSV A;  1L6J A;  3PAE A;  2HIO B;  4GHL A;  2ZC7 A;  3L2A A;  4HHD A;  1G28 A;  2I72 A;  3FPW A;  3ZNT A;  2CWE A;  2R78 A;  3TOI A;  1SKO A;  1AOI B;  3V3R A;  1VET B;  4E44 A;  3IWQ A;  2BAS A;  1S66 L;  4EO5 C;  1A7W A;  4B88 A;  1YU1 A;  3Q1F A;  4ETX A;  3EPH A;  2LB5 A;  3NC8 A;  5DNN C;  1AOI A;  4ESP A;  5CPI A;  3TU4 A;  2VJW A;  3WKJ A;  3HUM A;  3MXQ A;  4N1X A;  3W4P A;  1P3A A;  1P3I A;  3REJ D;  3PBQ A;  2JKG A;  5EOO A;  3A3I A;  4KHA B;  1VHM A;  2CV5 C;  1YLP A;  3X1V D;  5CGX A;  3W97 B;  3HUO A;  3M6H A;  5DTS A;  3A1K A;  4X23 C;  2WGW A;  4G3W A;  5HX9 A;  1LSX A;  4KHA A;  2JKR I;  1WE4 A;  3LZ1 C;  4LD9 D;  2HJ9 C;  4ETZ A;  3G31 A;  5EFW A;  5B31 C;  4KGC A;  2WAD A;  3UB5 P;  1O07 A;  2MJ6 A;  1PWC A;  1XP4 A;  3REH A;  1Y28 A;  4FD8 A;  1CI9 A;  3BEC A;  3F6T A;  5HL1 A;  1P3L C;  1RGZ A;  1XJ2 A;  4JXG A;  4CAY A;  4OVD A;  5B33 D;  1XKZ A;  2V20 A;  3SOI A;  5GXQ C;  2IO5 C;  1ACF A;  1U35 B;  2OV5 A;  3IWI A;  3E2L A;  5AV6 A;  4Y15 A;  5B24 D;  5GT3 B;  1P3K B;  1P3M D;  3VE3 A;  2Y2O A;  2FN2 A;  4JKT A;  5BOH A;  1P3O B;  3I7J A;  5G4Y A;  1P0Z A;  3MGP C;  5B2J C;  1OGG A;  1U35 A;  2ZLY A;  3ZG7 B;  2Y59 A;  3KYE A;  2YFV A;  2QHK A;  3MF0 A;  4O7D A;  1KOU A;  2F8N B;  2J3T C;  4OOM A;  3MBZ A;  4R3B A;  1P3O A;  2VA0 A;  3JYI A;  3C1B B;  2NUT C;  3BM6 A;  5CHJ A;  1J3W A;  3UTA D;  1JTD A;  3FC7 A;  2XFT A;  4PAU A;  5DNM B;  4OJ6 A;  4WZS B;  4BQM A;  4J8X D;  3AZK C;  4HOI A;  5HSQ A;  5DFY A;  3MGR B;  4WU9 B;  3WD3 A;  3IXH A;  4JLF A;  3PR6 A;  5B0Y B;  1M1A C;  4OP8 A;  3WD4 A;  3NOU C;  3VOY A;  2K2N A;  1OTA A;  1CXW A;  3O5Y A;  3PAG A;  2V9A A;  2NQB B;  1IEL A;  4H9N A;  5CP6 B;  3OPL A;  4HQA A;  3F1N B;  2B5R A;  3NEC A;  2JKF A;  5HAI A;  2VZW A;  3P09 A;  4XXR A;  5CP6 A;  2LB9 A;  1ID3 B;  2G5H C;  2P08 A;  4I3A A;  4ZJ1 A;  3R45 A;  2M7V A;  3F1N A;  1M19 D;  3NOP C;  3NCK A;  2R9W A;  3MXS A;  3LJA D;  2PU2 A;  2HF6 A;  1LL8 A;  2VGK A;  3NHQ A;  4J8U D;  1ID3 A;  4KQR A;  1P3F C;  4NE5 A;  3BY8 A;  1T1B A;  2Y2Q A;  2RL3 A;  3UE3 A;  3WAA B;  3GSG A;  1XX2 A;  3EEA A;  4EET B;  3X1U D;  4JJN D;  4NXG A;  1PIO A;  2FJ7 B;  4I5S A;  3CLO A;  5AV9 D;  2YFW A;  3GEC A;  1W1P A;  4E3L A;  1P3G A;  4O8G A;  2V1A A;  4NZ3 A;  1ERQ A;  3AYW B;  4Q0J A;  2VV7 A;  2BYM B;  3LEL B;  1R4V A;  5FQM A;  4ZJ2 A;  3SW1 A;  3JVV A;  3AZG D;  2DCF A;  2PBD P;  3B47 A;  4EUZ A;  4R1G A;  3VP1 A;  3PBT A;  3ZVW A;  5B0Z D;  3TG9 A;  4PM8 A;  1E25 A;  2Y2I A;  2W0N A;  1ESU A;  4IJE A;  4DE0 A;  4HGA C;  3HLC A;  3REI A;  5FSR A;  5DTK A;  3KWQ A;  5CHM A;  3S7Q A;  4H9R A;  4LV0 A;  5DF8 A;  3L7H A;  5FUG B;  4JGQ A;  5CER A;  4UA6 A;  3WTP B;  4R8P A;  5JRG B;  1EW0 A;  3PHY A;  4FTX A;  4Z66 B;  1DRM A;  3T4K A;  1FOF A;  2L4R A;  3ZHH A;  5CPK B;  5HDS A;  1XJ3 A;  2VGL M;  2HDQ A;  4PPR A;  3ZG9 B;  5B1M D;  2D01 A;  5L2F A;  4S2N C;  2BYK B;  1LL9 A;  4HJ4 A;  1BTL A;  1YT4 A;  4Z66 A;  3UN7 A;  5AV5 B;  2PT7 A;  3X1V C;  3IF5 A;  5CPK A;  5F99 A;  3MSH A;  2BYK A;  3T4L A;  3S22 A;  5AV5 A;  1K55 C;  4LD9 C;  1YLY A;  4LFU A;  3C38 A;  3UPN A;  3V9R A;  2PR5 A;  3UO9 A;  1Z09 A;  3G32 A;  4P6Z M;  1JFI B;  3B6G B;  1ONH A;  1P34 B;  2P9V B;  4GOG A;  4DQY B;  4UUZ A;  5GHY A;  2ZQ9 A;  3F1O A;  1DP6 A;  4N1H A;  5CGW A;  4FCF A;  3O87 A;  3HLB A;  4XZQ A;  5B33 C;  5EVI B;  1RP5 A;  2HZ5 A;  1TAF B;  4MN7 A;  5CTM A;  4HBU A;  4WYY A;  3TRC A;  3UDI A;  2ZQC A;  5B24 C;  1S6R A;  1P3M C;  1CQA A;  2IWC A;  4H6J B;  3KS8 A;  3LID A;  2PD7 A;  1F66 D;  2H0Y A;  1LI0 A;  2DQN C;  1ZG6 A;  3VP0 A;  3VH6 T;  5C3I C;  4IBK A;  2VK3 A;  4HMC A;  4E6W A;  4JGR A;  1NWZ A;  3OOV A;  2O9C A;  1TZY D;  3V3S A;  1ZTU A;  5DVA A;  1PWG A;  3WRT A;  4OPY A;  2FZ0 A;  4Z2G A;  3UTA C;  3G30 A;  4IBR A;  1Z2C B;  3BFF A;  4J8X C;  3VFH A;  1EQZ D;  5E43 A;  4GD8 A;  2LY8 A;  4PM6 A;  3KS4 A;  1NXY A;  1XFN A;  3PBR A;  3NQJ B;  5HDC A;  5FA7 A;  5GHZ A;  1NYY A;  2XR0 A;  3IH9 A;  4PM7 A;  4WEJ A;  1KX5 D;  5CPJ B;  3IX4 A;  3V50 A;  4XUJ A;  3V67 A;  3OPH A;  1ODV A;  1WWS A;  3AV1 D;  3N7W A;  1T1C A;  5HD5 A;  4HEF A;  3ZYT A;  5B2I D;  3AZI A;  3KXB A;  3A6N A;  5B32 D;  2HPB A;  2UWX A;  4Y7P A;  4EBN A;  3LZ0 B;  2H0T A;  4WM9 A;  3EPL A;  5EM1 A;  1M19 C;  1DP8 A;  3AZH D;  5AV8 A;  1EAK A;  2DNS A;  5E5A B;  3MFD A;  3B42 A;  3L29 A;  3LJA C;  4KZ9 A;  3M6B A;  2RVQ D;  1K56 D;  4J8U C;  1WWI A;  5HL6 A;  4KUD D;  2J9O A;  3AZJ A;  3W98 A;  5AVC B;  3MMH A;  3ICY A;  3X1U C;  4JJN C;  1PRQ A;  5E5A A;  3K3D A;  1M18 D;  2EXB A;  4WEK A;  3LR3 A;  2Z6D A;  3W96 D;  4GW9 A;  1TS6 A;  3AZL D;  3FKW A;  2W1T A;  2AVX A;  4WL9 A;  4QY6 A;  1BLC A;  5TGF A;  3UME A;  2PU4 A;  1ZLA B;  3GRJ A;  5GT0 D;  4R23 A;  4OJP A;  2A24 B;  2Y2J A;  1I2W A;  1HQ3 C;  5EEC A;  3AZG C;  3HLF A;  4EEP A;  3FG8 A;  3NY4 A;  2HUE C;  2XRO A;  4MB3 A;  5B0Z C;  1MY8 A;  1CK7 A;  5M1A A;  1KX4 A;  1D1J A;  1SHV A;  2ZC6 B;  3WX7 A;  5F68 A;  4S2L A;  1YKD A;  3WA9 B;  3W99 D;  4IBB A;  4P0M A;  4DRT A;  2PYO A;  3MQQ A;  4E3M A;  1DP9 A;  5BS7 C;  2YKF A;  3O62 A;  3UB7 A;  5B40 D;  4IBD A;  5AQA A;  1SKF A;  3IXB A;  1N1J B;  3WA9 A;  1E3U A;  5B1L D;  3B6F D;  3DWZ A;  3P98 A;  4Q0H A;  3VP3 A;  2ARO D;  5B1M C;  1MPL A;  5DNN B;  3X1S A;  1DJA A;  3C1C A;  2ZD8 A;  5J7E A;  3T4T A;  3KSG A;  3DBA A;  4HMD A;  3VFF A;  5M18 A;  2XQZ A;  3EGD C;  4YWZ A;  3REK C;  2CV5 B;  3IS2 A;  1T1A A;  2HP9 A;  1YSQ A;  2NZD D;  4GCZ A;  3REL A;  2UV0 E;  3UPP A;  3VE4 A;  4HP4 A;  4E04 A;  3T4Q A;  2ZM0 A;  4KQQ A;  4X23 B;  2CV5 A;  3MGQ D;  4EXO A;  4OUI A;  4HH3 A;  3VH5 T;  3AZF D;  4GN2 A;  5A91 A;  5B31 B;  2HP5 A;  2ZOH A;  3H0M C;  4R3J A;  4BBT A;  2WKP A;  3LZ1 D;  5FDS A;  3WS4 A;  2XFS A;  4EU0 A;  5GSU D;  1V9Y A;  3ZFZ A;  4S2K A;  3KO6 A;  3KUY D;  5GXQ B;  1H0M A;  4MBF A;  1F66 C;  3UTB D;  3T4O A;  2Y8H A;  4Z1W A;  5A92 A;  2V1B A;  2BG1 A;  5GXQ A;  1W1Y A;  1BSG A;  4ZRR A;  1XJ4 A;  3AN2 A;  3BYD A;  3MGP B;  5B2J B;  1E4D A;  1TZY C;  2OLU A;  3TSG A;  2GNX A;  4EWF A;  1TS8 A;  4WZ5 C;  2J8Y A;  4L9G A;  3SZT A;  4CQH A;  4ZUX A;  3EOI A;  3BLS A;  3UE1 A;  4EES A;  1EQZ C;  1Z6F A;  5B2J A;  5DJU A;  4YM6 A;  3MKF A;  3MJQ A;  4FOF A;  4QLC D;  2V5O A;  5CTN A;  3LO7 A;  3L26 A;  2IWD A;  1E15 A;  3MZD A;  3AZK B;  2XDM A;  3IF6 C;  1KX5 C;  2VEA A;  3MKE A;  4OJL A;  3AZM A;  1GSW A;  1M1A B;  3FZC A;  5HPI A;  1W79 A;  3AV1 C;  4X56 A;  4OQ0 A;  3RJU A;  4WV4 B;  4QU3 A;  3MGS D;  5JYP A;  3KSF A;  5B2I C;  4GS9 A;  4WUJ A;  5B32 C;  4X55 A;  2GZA A;  2XH9 A;  1M1A A;  4QNL A;  1P3B C;  4J8W D;  3OBF A;  4JXW A;  1ONG A;  4H9Q B;  1S32 A;  5JA4 B;  3X1T D;  3LY3 A;  1ULY A;  3NBL A;  3AZH C;  2BTF P;  3B0C W;  4MBH A;  4IBC A;  3MS6 A;  1OT6 A;  1SDE A;  3FYZ A;  2XK1 A;  2EX9 A;  5TBM A;  4KUD C;  4L0L A;  4AWL C;  4R0Q A;  1NLZ A;  4Z5T A;  4J8V B;  3FKE A;  4Z2J A;  1M18 C;  2ZY5 A;  3UT9 A;  2VKS A;  1E6N A;  1PZP A;  3W96 C;  1BLS A;  3AZL C;  1P3F B;  5J3W A;  3MVD A;  3AZE A;  3C8C A;  3QNC A;  2P04 A;  4YS3 A;  1G5U A;  5FQQ A;  1P9W A;  1P3P B;  1W8Y A;  4WEL A;  3MZE A;  4J8V A;  1J9M A;  4WJ3 C;  2D49 A;  4LV3 A;  2G5I C;  4TX8 A;  3AV2 A;  3W2Z A;  1K6S A;  4LCM A;  4ZDX A;  2XD5 A;  4H9O A;  3NQU A;  1P3P A;  4MB5 A;  2JBF A;  4NK3 A;  4F94 A;  1K54 A;  4PM5 A;  5BNX B;  5AY8 D;  3U2A A;  3AZN D;  1DJB A;  5CGS A;  4DJ2 A;  2ZBB A;  2WKH A;  1FCO A;  3AFA A;  1HD8 A;  1AXB A;  1T18 A;  3BWL A;  5CEC A;  2M7U A;  3T1Q B;  3W99 C;  2E8J A;  1ZHH B;  2V0U A;  4CLC A;  1OPX A;  3BFE A;  4Y13 A;  4HGA B;  3C4O A;  1NRJ A;  5B40 C;  3WS5 A;  3H7W A;  1LI9 A;  3W4Q A;  2V0W A;  5B1L C;  4OH0 A;  3B6F C;  5BO0 B;  1LL5 A;  1IKI A;  2V8F A;  2ARO C;  1FCM A;  5AVB D;  2HIO A;  3ULF A;  5KDM B;  4HNB A;  3EPK A;  3LIF A;  3REJ B;  1ZC2 A;  1L0F A;  2WUQ A;  4H9S A;  1VET A;  4I38 A;  2Z6C A;  3HBR A;  2QMI A;  2ZY4 A;  3UB6 A;  4AFI A;  3X1V B;  2NZD C;  1KDS A;  2YKH A;  3CMZ A;  3EQV A;  4X1L A;  4Z2K A;  3REJ A;  3TJZ C;  5CXW A;  3LI9 A;  2XA7 M;  1JNU A;  4CSR B;  2V1Z A;  5KZH A;  3TE8 A;  3MGQ C;  4OQI A;  1AOI D;  4LD9 B;  3HVF A;  2JKT M;  5DJT A;  5CPI D;  3TU4 D;  3AZF C;  3LI8 A;  3WKJ D;  3MNN B;  5FAS A;  5EOE A;  4GDN A;  5LBR A;  1P3A D;  1P3I D;  1CI8 A;  1MWR A;  4B93 A;  1YMS A;  5L07 A;  2JKT I;  3IWO A;  2HDS A;  4NE6 A;  2Y2M A;  2IOU A;  4K08 A;  5GSU C;  3W97 A;  4MBK A;  4D60 A;  4GH9 A;  5B33 B;  3KUY C;  3MNN A;  1BFM A;  3HLG A;  5HPF A;  3A3D A;  5B24 B;  3UTB C;  1E6R A;  1P3M B;  1ERO A;  2ZQ8 A;  5MC7 A;  4LPZ A;  4KGC D;  1YU2 A;  4B4Z A;  3REH D;  3K2N A;  3LGO A;  3E4O A;  4NZ1 A;  4DE1 A;  2ZOI A;  5C3I B;  5FQ9 A;  1K57 A;  2Z2M B;  1FR6 A;  5GLB A;  3AGD A;  5GT3 A;  3UTA B;  1P3K A;  1FR1 A;  1QO6 A;  4QLC C;  1BZA A;  3CUE A;  5AV6 D;  4J8X B;  4F3L B;  2QJ7 A;  3K3C A;  5EPH A;  4G91 C;  4Q8I A;  4QWO A;  1X0O A;  4Y0T A;  2J8P A;  2VX8 A;  2JSS A;  2L5A A;  2F8N A;  1L3L A;  3DTI A;  2K7S A;  3SS4 A;  4S2J A;  3C1B A;  4PHT A;  4JF6 A;  2INW A;  3CPT B;  4H8R A;  3MGS C;  3HJK A;  5E2F A;  4LRZ E;  5DNM A;  2EX2 A;  4P6B A;  3EEH A;  4BEN A;  3UE6 A;  2ZL1 B;  3MGR A;  4J8W C;  4WU9 A;  4OOL A;  3CPT A;  3X1T C;  1VEU B;  3VH6 W;  4NZ4 A;  5B0Y A;  2I9V A;  3DW0 A;  4YOF A;  4C3Q A;  3DTK A;  3WD2 A;  3PYP A;  4II7 A;  2XD1 A;  1M19 B;  2ZL1 A;  2PYP A;  1FSW A;  4KZ4 A;  2W3E A;  4I39 A;  5IS1 A;  2NQB A;  1S67 L;  2PHY A;  1VEU A;  3PBS A;  4DXC A;  3LJA B;  1PYY A;  3BQA A;  1W1V A;  3UPO A;  4J8U B;  2ZM5 A;  2RIQ A;  3OC2 A;  2XEP A;  4R38 A;  4NYU A;  2EWV A;  2J3W A;  2JN7 A;  4JJN B;  1KGF A;  4K0X A;  3HRE A;  2Y2H A;  5AV9 B;  4JXV A;  2B02 A;  4IBX A;  3DTE A;  5CEB A;  3KYZ A;  3H82 B;  2X01 A;  3IHA A;  3Q7Z A;  4OLD A;  4P87 A;  1TD5 A;  5EV0 A;  5FAQ A;  1HTA A;  5AY8 C;  5G4Z A;  3AZN C;  1W2E A;  5AV9 A;  3WAA A;  2PR6 A;  1OGB A;  2M1C A;  5F1F A;  4S2O A;  2Y79 A;  4QD4 A;  4DDY A;  1O7E A;  2FJ7 A;  3KX0 X;  1HQ3 D;  4N9K A;  4ZBE A;  4Y3I A;  5B0Z B;  4R4S A;  4A5R A;  3AYW A;  1P3G D;  5F82 A;  2BYM A;  1W5D A;  3LEL A;  4ID4 A;  1IEM A;  2Y2L A;  2L0W A;  4CPK A;  5F69 A;  3A0S A;  5EUA A;  5AVB C;  5F5Y A;  4GDB A;  1ES3 A;  3EG5 B;  4HES A;  5IU1 A;  4JF5 A;  4IVI A;  2JE5 A;  5HWV A;  2WKI A;  4X6T A;  1YU3 A;  2JC7 A;  3IXD A;  5B1M B;  4JXS A;  1F5M A;  1I2S A;  3UB8 A;  1OJ5 A;  2KOI A;  3REI D;  5FUG A;  3L9K A;  1W7F A;  3WTP A;  2R9X A;  5JRG A;  3KWQ D;  4IJG A;  4OJ5 A;  1YU0 A;  5CX7 A;  3L28 A;  1D06 A;  5CED A;  4R8P D;  1BYW A;  3E0Y A;  1ERM A;  1AOI C;  5CPI C;  2EX8 A;  3TU4 C;  2G2U A;  2B95 A;  4Z2H A;  3REK D;  3WKJ C;  1OME A;  3HCY A;  1P3A C;  1P3I C;  2OAQ 1;  5BT1 D;  3B33 A;  2GDN A;  2Z2L B;  5GLA A;  3L25 A;  3C5A A;  1SZV A;  1OJG A;  3E4Q A;  5HAR A;  1MKI A;  4S2I A;  4HP9 A;  5CPK D;  2EXA A;  5F99 D;  3N8L A;  3LR0 A;  4YFM A;  5AV5 D;  1JFI A;  3B6G A;  2A49 A;  5B31 G;  1P34 A;  1C3B A;  3G2Y A;  2P9V A;  2PD8 A;  2WGI A;  4KGC C;  4FH4 A;  4IJF A;  3REH C;  1F66 B;  4RX3 A;  1S4S A;  5FAO A;  1YLT A;  1XA1 A;  1GOI A;  4WMC A;  5EVI A;  1UR9 A;  2GX5 A;  3BFG A;  1TAF A;  3N6I A;  4GB7 A;  3C7V A;  5FI2 A;  4XZQ D;  2O9B A;  5I5L A;  4E45 A;  2W3F A;  3GV9 A;  3R4K A;  3SS3 A;  1P97 A;  5IHV A;  5CRF A;  1W1T A;  3T12 B;  5AV6 C;  4H6J A;  4IUH A;  4OQG A;  3VH5 W;  1EQZ B;  1YMX A;  3HLD A;  3CIT A;  5HAP A;  4U0T A;  5AQB A;  1U35 C;  3P5J B;  1KX3 D;  5TJJ A;  3WS0 A;  3IF6 B;  1KX5 B;  1BLP A;  4ARZ B;  2XA7 S;  1P3O C;  5BNV B;  4UA7 A;  2KLI A;  5E2G A;  3AV1 B;  3KYQ A;  3GQZ A;  4KZB A;  2DF4 C;  5B2I B;  3NQJ A;  5DKK A;  3QP8 A;  5B32 B;  4K0W A;  4UQI S;  4MN6 A;  1OTE A;  1FCN A;  3S7N A;  5CPJ A;  1MBL A;  5HDD A;  3WS1 A;  1ESI A;  3ISG A;  3AZH B;  4IED A;  3UMD A;  1IKG A;  1P3B D;  1KDW A;  4XUJ D;  2Y2N A;  4EUV A;  4QPR A;  4KUD B;  2J80 A;  4AWL B;  3O3V A;  3AZH A;  5FQK A;  4WZ4 A;  1IYP A;  4EEU A;  4MLL A;  2V8C A;  1M18 B;  1L0D A;  4IVK A;  4DDS A;  3LZ0 A;  3AZI D;  3KXB D;  3A6N D;  3W96 B;  4OP5 A;  3AZL B;  3E4P A;  1YQS A;  3G4P A;  2QKP A;  4M4X A;  1TS0 A;  1QMF A;  4FSF A;  1BH9 B;  1DJC A;  3IHB A;  1IYQ A;  5AV8 D;  5GT0 B;  1FIL A;  3C2W A;  1AWI A;  5AVC A;  4N92 A;  2DMW A;  3W4O A;  3R7W B;  4E3I A;  3AZJ D;  4WU8 B;  3W98 D;  5BPV A;  5GT0 A;  1LLB A;  1M6K A;  3ITA A;  3BLM A;  1MWT A;  5L10 A;  1ZLA A;  4KZ5 A;  1P3G C;  3S4X A;  4WU8 A;  5KSH A;  2A24 A;  2Y4A A;  3W99 B;  4KUO A;  1NZO A;  2WZZ A;  4I3J A;  1LSW A;  5FEF A;  4XUX A;  2V2F F;  5B40 B;  1WYB A;  4LRY C;  3SH7 A;  5B1L B;  3B6F B;  1H0G A;  4NKP A;  4IBE A;  2ZC4 B;  5EVL A;  4B4X A;  1KX4 D;  3L27 A;  2QZ6 A;  4GLQ A;  4EO5 B;  2EFX A;  3D72 A;  1K38 A;  4DMZ A;  1GPF A;  3S7P A;  1O6I A;  1N9L A;  3FV7 A;  4Q0I A;  3REI C;  2OWH A;  4WF0 A;  2QWS A;  4HI4 A;  4Z2I A;  3KWQ C;  3HUN A;  2PYO D;  3LIA A;  3D3O A;  3P7N A;  1N1J A;  4R8P C;  2NZD B;  3O62 D;  1FQG A;  3GMW A;  5FI6 A;  3VSK A;  4BD0 A;  5A8B A;  1H3O B;  1E3U D;  5DNN A;  5C5K A;  3V5M A;  5BT1 C;  2Y2P A;  3MGQ B;  4MMN A;  1Q9C A;  3X1S D;  3C1C D;  3AZF B;  4Z66 C;  3ZCZ A;  1YSP A;  3KFU G;  1KE4 A;  2ZQD A;  3NOT C;  3LUQ A;  4ZJ3 A;  5EVE A;  5CPK C;  5F99 C;  3LZ1 B;  2PAV P;  2OLV A;  3T1X A;  1F9I A;  4LEN A;  1KVM A;  3NDG A;  2H10 A;  3UDF A;  1N9N A;  5G49 B;  3REL D;  5AV5 C;  3KUY B;  5L09 A;  4X23 A;  2W1R A;  3T4J A;  1P3L B;  3LZ1 A;  5DF9 A;  2A3U A;  5B31 A;  3F1P B;  4MEZ A;  3UTB B;  3QP2 A;  3DAV A;  4BJP A;  4UPK A;  2IO5 B;  4NXF A;  2ZC3 B;  1KS0 A;  4KZ6 A;  1XXM A;  4XZQ C;  1P3L A;  2P7J A;  2QPN A;  4MDZ A;  3LY4 A;  3LYX A;  3WD0 A;  3MZF A;  2ZQ7 A;  4G92 C;  5GL9 A;  3QP1 A;  4QLC B;  5D3O A;  1KX3 C;  3NI9 A;  2IA2 A;  3BQ8 A;  3FWL A;  3MGP A;  1NJ4 A;  1L0E A;  2Q9N A;  4G91 B;  3B0D C;  1GA9 A;  3AN2 D;  2KX6 A;  2W8S A;  1VB6 A;  2J7V A;  2HDU A;  1OTI A;  1UWN X;  3AL0 C;  1NLY A;  4CLC E;  4ZUX D;  5FDH A;  4KQD A;  3MGS B;  3MQO A;  5FAT A;  2HGV A;  1H5X A;  4YM6 D;  3AZK A;  3MXR A;  4RX2 A;  4RQ9 A;  2Q0O A;  1HVB A;  1YLJ A;  1UR8 A;  1ZG4 A;  4J8W B;  3PBO A;  1PZO A;  2WKQ A;  3BW6 A;  4HIA A;  3X1T B;  4DJ3 A;  3GTC A;  4X68 A;  4FH2 A;  4XUJ C;  1Y54 A;  2K31 A;  1E6Z A;  3AZM D;  1EWZ A;  5CHU A;  2WYX A;  3QP5 A;  4HJ6 A;  2OAP 1;  2WGV A;  2RCX A;  4GHI B;  4DE3 A;  2X71 A;  3RFB A;  3AZI C;  3KXB C;  3A6N C;  2J9P A;  3HL9 A;  4H9Q A;  5JA4 A;  3A1I A;  1IYO A;  4HY8 A;  3ZG8 B;  2ZM2 A;  3BFC A;  3T50 A;  1S32 D;  4GNU A;  4O01 A;  5AV8 C;  4GHI A;  5A90 A;  5F83 A;  3UB9 A;  4EBP A;  5J4E A;  1ES4 A;  3AZJ C;  1RCJ A;  5TR7 A;  3W98 C;  4Z2M H;  1P3F A;  4Z5T D;  5AY8 B;  4U3T A;  3AZN B;  3LIB A;  2CC1 A;  3S1Y A;  3UT9 D;  3VH6 A;  4YNR A;  5EE8 A;  4X53 A;  3MVD D;  3Q7V B;  2B18 A;  4C75 A;  3AZE D;  1JWP A;  4YS3 D;  1FSY A;  5TFQ A;  3BFD A;  3KSH A;  4J8V D;  3SH8 A;  3PTE A;  2FFF B;  2VQR A;  5HFO A;  2JCH A;  3AV2 D;  5BNX A;  1P3P D;  3LCE A;  4U0X A;  1D7E A;  3ZNY A;  1GXD A;  1WA9 A;  4XT2 B;  3HLW A;  5AVB B;  3ZVT A;  3FKV A;  1P9R A;  4RYE A;  1KX4 C;  3MR0 A;  1OT9 A;  3AFA D;  1A0K A;  1PW8 A;  4GJ4 A;  1PWD A;  3NDE A;  1GHP A;  2ZQA A;  2PYO C;  2RTS A;  4CLC D;  1XFQ A;  1SKO B;  3EGX C;  3O62 C;  1I5Q A;  5BO0 A;  1YUE A;  3WA9 C;  2H5S A;  4OLG A;  3HJI A;  5KDM A;  2HIO D;  2BLS A;  3X1S C;  5CPI B;  3NIA A;  3TU4 B;  3C1C C;  1YPR A;  2FFY A;  4NEE D;  4NET A;  4S2N A;  3IQA A;  3WKJ B;  1W63 M;  3O86 A;  1P3A B;  1P3I B;  1T3U A;  4BWI A;  4ZAM A;  3X1V A;  3H0L C;  4Y17 A;  5J8X A;  3VOL A;  5L8M A;  3REL C;  5AVE A;  4CSR A;  2PYR A;  2ZMF A;  4UQI M;  3KSI A;  4X69 A;  5FQI A;  1K55 A;  4LD9 A;  3Q82 A;  1TDL A;  3M7P A;  3CZD A;  2WGW B;  2ZC5 B;  2Y2K A;  4LV2 A;  4BL2 A;  3C7U A;  2O0Y A;  2JKR M;  1PI5 A;  4E3N A;  4E6X A;  4KGC B;  2F8N K;  4M3K A;  4PKY G;  3ZG5 A;  1CK3 A;  5E2H A;  3C30 A;  3REH B;  4NXE A;  3WS2 A;  1ES2 A;  4BD1 A;  5B33 A;  4R6L A;  3W97 D;  4R3A A;  4CAY B;  3MNN D;  2X02 A;  1S1Y A;  3QHY A;  5B24 A;  3RXX A;  1P3M A;  1N4O A;  4MNR A;  4KG6 A;  3W8K A;  5AV6 B;  3UNW A;  4QB8 A;  4DRB A;  1K0K A;  1STZ A;  2QYB A;  5KSC A;  2W27 A;  5HD3 A;  2F2A C;  3AN2 C;  1XPB A;  4LCL A;  4EQI A;  1CEF A;  5K5B A;  1TDG A;  4WNN B;  1SCW A;  4EW7 A;  1J7M A;  2YFV B;  4R4R A;  4ZUX C;  4BMW A;  4L9E A;  3UTA A;  2WK0 A;  2PRF A;  1TS7 A;  2ZMV A;  1U35 D;  5AQ9 A;  2O99 A;  1H8P A;  5GT3 D;  4YM6 C;  4J8X A;  1P3K D;  1MWU A;  4F3L A;  4WNN A;  4E3O A;  1P3O D;  3BY9 A;  4OON A;  3B0C T;  3CG5 A;  1H8Z A;  4O0P A;  1GSX A;  2XF3 A;  4G3V A;  4KZ8 A;  2F8N D;  3AZM C;  4LRX C;  3Q07 A;  2OWJ A;  2ZY2 A;  4M6B A;  3C1B D;  1BH8 B;  3NUL A;  3NJA A;  3MQ0 A;  3C4P A;  5AQ7 A;  4HME A;  5B32 G;  5DNM D;  3VH5 A;  3WTP E;  4H9N B;  2WKE A;  4Y0O A;  4LLO B;  5DF7 A;  1GHI A;  1BH8 A;  3MGR D;  2Q9M A;  4WU9 D;  2PBY A;  1S32 C;  1L2S A;  5M19 A;  5FL3 A;  5B0Y D;  1TEM A;  5GLC A;  4UHU A;  2HJE A;  1M19 A;  1NRF A;  4HJ3 A;  4DXB A;  3X1U B;  2PDR A;  3R45 B;  3LJA A;  4ZBJ C;  2NQB D;  4J8U A;  2W3D A;  5CP6 D;  2DRW A;  4Z5T C;  2A2L A;  3UT9 C;  4RA7 A;  3X1U A;  4JJN A;  2XLN A;  3G35 A;  4XUZ A;  4BBV A;  4EER A;  3MVD C;  3AZE C;  2O9A A;  1HZO A;  4YS3 C;  4G3K A;  1PDC A;  3EQU A;  1YM1 A;  1HQ3 B;  4LGW A;  1F98 A;  1WYC A;  3WRZ A;  4J8V C;  1ID3 D;  3AZG B;  3GVB A;  3H82 A;  1GA0 A;  2YFW B;  4OPQ A;  5IT5 A;  3BEB A;  2HUE B;  3AV2 C;  1P3G B;  2C5W B;  5DFX A;  2G2W A;  4Z2M G;  1HQ3 A;  1P3P C;  3OLO A;  3RTY A;  4WN5 A;  1K54 C;  5GHX A;  3AZG A;  2QJ5 A;  3WAA D;  4OQH A;  3AFA C;  5B0Z A;  2FJ7 D;  3IT9 A;  1DY6 A;  2VGJ A;  1K6R A;  4CLC C;  1XJ6 A;  3AYW D;  3REI B;  3LEL D;  3A3F A;  3TW8 A;  5BS7 A;  3KWQ B;  4H9R B;  3IX3 A;  5FI7 A;  1ALQ A;  4R8P B;  4R70 A;  2D02 A;  2HIO C;  2HDR A;  5B1M A;  3H0R C;  3REK B;  3ITB A;  3QP6 A;  2Y91 A;  3IH8 A;  3WWX A;  5GLD A;  4H9S C;  1K25 A;  1ED7 A;  4RVA A;  3GR2 A;  4S2P A;  4GKU A;  2WAE A;  3REK A;  2H28 A;  5F99 B;  3WTP D;  5JRG D;  3REJ C;  2WAF A;  3B3X A;  4Z66 D;  4JF4 A;  3V39 A;  1AIW A;  4EV4 A;  2JHE A;  5FAP A;  2CMN A;  3BJN A;  3OPR A;  4IBJ A;  1KGE A;  1MXO A;  1PI4 A;  2OOL A;  3V9R B;  4Y0U A;  4Z2L A;  1GSV A;  1PW1 A;  3PBN A;  3D4F A;  3S7O A;  3UY6 A;  1KE0 A;  1JWV A;  4UUZ B;  3W97 C;  3F1O B;  1IYS A;  3LR4 A;  4PKY A;  1NY0 A;  3A3J A;  4MCW A;  4DF6 A;  4XZQ B;  2ZM8 A;  3MNN C;  3JVU A;  3EPJ A;  2W3H A;  3ZGA B;  5DTT A;  3UE0 A;  4GHA A;  3VV4 A;  1TZY B;  3B6G D;  1P34 D;  1F66 A;  5HWT A;  4G92 B;  4N9L A;  1KX3 B;  2WZX A;  2C6W B;  1G6A A;  5EVI D;  4WMC D;  4MB4 A;  1TZY A;  3AGE A;  3HLE A;  4QHC A;  4WZ5 A;  4IUK A;  1K57 C;  5HWW A;  3B0D B;  4GZB A;  2Y55 A;  4NFT A;  5GT3 C;  1P3K C;  1KX3 A;  2Y2G A;  1EQZ A;  5CHL B;  4I3I A;  3CUE C;  4KZA A;  3T1S A;  3VMA A;  4P85 A;  1CEG A;  3A3E A;  2F8N H;  4GD6 A;  3G6O A;  4QJG A;  3CHW P;  3IF6 A;  1KX5 A;  3E98 A;  4ARZ A;  4CJN A;  3FDD A;  1EI5 A;  5BNV A;  3C1B C;  1PNE A;  3LEQ A;  2XSS A;  4DE2 A;  4WBG A;  3AV1 A;  1P3B B;  4LG2 A;  3PXP A;  4XUJ B;  1MWS A;  4OKP A;  1Y4O A;  5DNM C;  1BUL A;  1XGI A;  3IBJ A;  2HV1 A;  3B0B A;  5B2I A;  3OZH A;  5B32 A;  1GCE A;  3MGR C;  2ZJ9 A;  4WU9 C;  1P3B A;  5B0Y C;  3KXB B;  3A6N B;  3AZI B;  1YAX A;  5HW3 A;  5A93 A;  4LV1 A;  1GHM A;  3ZG0 A;  1HLU P;  3G2Z A;  1K4E A;  4UEY A;  5JYO A;  5CPJ D;  1S1Z A;  4JBF A;  5AV8 B;  4BL3 A;  2NQB C;  1K56 A;  4X25 A;  1XGJ A;  2VV6 A;  1VM1 A;  5CP6 C;  3P01 A;  4KUD A;  1F1E A;  3LR5 A;  1N9O A;  4YIN A;  2VLG A;  1M18 A;  3AZJ B;  3W98 B;  1CF0 A;  3W96 A;  3HON A;  5I94 A;  3AZL A;  4OPZ A;  2L1M A;  1ID3 C;  3LZ0 D;  1BH9 A;  2W1T B;  1PFL A;  3CAX A;  1S4R A;  5E5A D;  3A0V A;  1LT0 A;  3R7W A;  2HP6 A;  1TF1 A;  5AV9 C;  3WAA C;  5AVC D;  2XRN A;  3HSH A;  3N8S A;  1BUE A;  3M2K A;  2XGN A;  1L0G A;  2FJ7 C;  3OCN A;  1TVF A;  1YU4 A;  4Z9Q A;  1V9Z A;  1KX4 B;  4BBU A;  4JGP A;  4KQO A;  3W99 A;  3IBR A;  4KZ7 A;  3KSY A;  1ZLA D;  2ARO B;  3AYW C;  4WU8 D;  4K91 A;  5KMW A;  1IOU A;  3LEL C;  3VOZ A;  3JPU A;  2PYO B;  4NXB A;  5B40 A;  5AVF A;  1LHY A;  4C6Y A;  4E3J A;  1FIK A;  1N9B A;  4IBG A;  5B1L A;  3O62 B;  3B6F A;  1ES5 A;  2ARO A;  1CJF A;  1H8Y A;  3IXG A;  1JVJ A;  4Y2F A;  3EWK A;  2NUP C;  3N4I A;  2GJ3 A;  3IX8 A;  3QNB A;  3X1S B;  3WA9 D;  3C1C B;  4HH2 A;  4HBT A;  4D2O A;  3CI6 A;  3WTP C;  5JRG C;  2NZD A;  4QY5 A;  4PMA A;  4Y5F A;  3T4S A;  3IS2 B;  1H3O A;  1YLW A;  4NG2 A;  4X1M A;  3REL B;  1YLZ A;  1E6P A;  3MGQ A;  4MN5 A;  5GSU B;  5DNN D;  2VV8 A;  3AZF A;  5AJG A;  1JWZ A;  4ME4 A;  5FQJ A;  5EM0 A;  1RGY A;  3CJM A;  4IHQ A;  4KUK A;  5GSU A;  2CV5 D;  3MQL A;  2EFU A;  1BT5 A;  5G49 A;  3KUY A;  4BLM A;  1NZU A;  3ZQ5 A;  3SH9 A;  3ZDJ A;  1M40 A;  3B6G C;  4X23 D;  1P34 C;  5FEG A;  3OCL A;  3F1P A;  3UTB A;  3OPP A;  1F2K A;  3LIC A;  1KGG A;  5B31 D;  2EX6 A;  5EVI C;  4S2M A;  1NYM A;  4EBL A;  1KU5 A;  2ACG A;  3AN2 B;  1P3L D;  4ZTK A;  1XA7 A;  1OTB A;  5DKL A;  3E2K A;  5F1G A;  5GXQ D;  4ZUX B;  4DKI A;  1IFQ A;  4PM9 A;  3SS5 A;  3WD1 A;  4QLC A;  4NYY A;  1T19 A;  5HZH A;  1K4F A;  3FPV A;  3GDI A;  5U47 A;  4OOY A;  2EWW A;  4YM6 B;  4DN0 A;  3A0R A;  3DWK A;  3D9Y A;  3H9W A;  3MGP D;  5B2J D;  3IP4 C;  4NY2 A;  2VGL S;  2OSU A;  2KDK A;  1U60 A;  3QP4 A;  5HAQ A;  4NE3 A;  1BLH A;  2J3T D;  1OTD A;  3AZM B;  4OPR A;  3MGS A;  4EQ1 A;  2F8N G;  3LEZ A;  4GS9 B;  4J8W A;  3Q81 A;  3VP4 A;  3AZK D;  3X1T A;  4JPM A;  3CWF A;  3RH8 B;  1W8Q A;  5CPJ C;  1S32 B;  2WKR A;  4NZ5 A;  1B6W A;  4P6Z S;  4JGO A;  1H8M A;  3T1R A;  3AGF A;  1M1A D;  5F6A A;  1JTG A;  1H0I A;  3BRM A;  4WLA A;  1G68 A;  3M2J A;  2E8I A;  3MFX A;  4ZBJ B;  4KG5 A;  5TBM B;  1UGU A;  4L9F A;  3UDX A;  3N8R A;  1UWP X;  1PZR A;  4Z5T B;  3LIE A;  3UT9 B;  3LFV A;  2P74 A;  2EA9 A;  1H3Q A;  3LZ0 C;  1VQQ A;  1KE3 A;  1E8B A;  2RVQ C;  3MVD B;  3AZE B;  2ZMA A;  4YS3 B;  3O88 A;  5E5A C;  4KEN B;  4IBF A;  1S0W A;  4UAA A;  5G18 A;  1MKM A;  1Q2P A;  4KG2 A;  4KZ3 A;  2IWB A;  2ZY3 A;  4B9O A;  5AVC C;  3AV2 B;  4IBI A;  3VP2 A;  4E3K A;  1MZU A;  4H9O B;  5AY8 A;  3NQU B;  3AZN A;  1B67 A;  1QME A;  1E88 A;  1P3F D;  3Q7V A;  5GT0 C;  1G6O A;  1MC0 A;  4H9P B;  1HTZ A;  1ZKJ A;  2G7U A;  5E2E A;  3DTM A; 
#chains in the Genus database with same CATH homology
 1KVL A;  4DRA A;  3AFA B;  1ZLA C;  4WU8 C;  3VSL A;  4UA9 A;  1SDN A;  1Q2Q A;  3G34 A;  4H9P A;  3N3F A;  5AVB A;  3RXW A;  4OJO A;  3PAE A;  2HIO B;  4GHL A;  2ZC7 A;  3L2A A;  2I72 A;  3ZNT A;  2CWE A;  3TOI A;  1AOI B;  3V3R A;  4E44 A;  3IWQ A;  4EO5 C;  1A7W A;  4B88 A;  1YU1 A;  3Q1F A;  3EPH A;  3NC8 A;  5DNN C;  1AOI A;  5CPI A;  3TU4 A;  3WKJ A;  3HUM A;  4N1X A;  3W4P A;  1P3A A;  1P3I A;  3REJ D;  3PBQ A;  5EOO A;  3A3I A;  4KHA B;  1YLP A;  2CV5 C;  3X1V D;  5CGX A;  3W97 B;  3HUO A;  3M6H A;  5DTS A;  3A1K A;  4X23 C;  2WGW A;  5HX9 A;  4KHA A;  1WE4 A;  3LZ1 C;  4LD9 D;  3G31 A;  5B31 C;  4KGC A;  2WAD A;  1O07 A;  1PWC A;  1XP4 A;  3REH A;  4FD8 A;  1CI9 A;  3BEC A;  3F6T A;  5HL1 A;  1P3L C;  1RGZ A;  4JXG A;  4CAY A;  4OVD A;  5B33 D;  1XKZ A;  2V20 A;  3SOI A;  5GXQ C;  2IO5 C;  1U35 B;  2OV5 A;  3IWI A;  3E2L A;  5AV6 A;  5B24 D;  5GT3 B;  1P3K B;  1P3M D;  2Y2O A;  4JKT A;  5BOH A;  1P3O B;  3I7J A;  3MGP C;  5B2J C;  1U35 A;  2ZLY A;  3ZG7 B;  2Y59 A;  2YFV A;  4O7D A;  2F8N B;  4OOM A;  3MBZ A;  4R3B A;  1P3O A;  3JYI A;  3C1B B;  3BM6 A;  5CHJ A;  3UTA D;  1JTD A;  2XFT A;  5DNM B;  4OJ6 A;  4WZS B;  4BQM A;  4J8X D;  3AZK C;  3MGR B;  4WU9 B;  3IXH A;  4JLF A;  5B0Y B;  1M1A C;  4OP8 A;  3VOY A;  3PAG A;  2NQB B;  1IEL A;  4H9N A;  5CP6 B;  3OPL A;  2B5R A;  5HAI A;  3P09 A;  4XXR A;  5CP6 A;  1ID3 B;  2G5H C;  4ZJ1 A;  3R45 A;  1M19 D;  3NCK A;  2R9W A;  3MXS A;  3LJA D;  2PU2 A;  2VGK A;  4J8U D;  1ID3 A;  4KQR A;  1P3F C;  4NE5 A;  2Y2Q A;  2RL3 A;  3UE3 A;  3WAA B;  3GSG A;  1XX2 A;  3X1U D;  4JJN D;  1PIO A;  2FJ7 B;  5AV9 D;  2YFW A;  4E3L A;  1P3G A;  4NZ3 A;  1ERQ A;  3AYW B;  2BYM B;  3LEL B;  1R4V A;  5FQM A;  4ZJ2 A;  3AZG D;  2DCF A;  4EUZ A;  4R1G A;  3VP1 A;  3PBT A;  3ZVW A;  5B0Z D;  3TG9 A;  4PM8 A;  1E25 A;  2Y2I A;  1ESU A;  4IJE A;  4DE0 A;  4HGA C;  3HLC A;  3REI A;  5FSR A;  5DTK A;  3KWQ A;  5CHM A;  4H9R A;  4LV0 A;  5DF8 A;  5CER A;  5FUG B;  4UA6 A;  3WTP B;  4R8P A;  5JRG B;  4Z66 B;  1FOF A;  3ZHH A;  5CPK B;  4PPR A;  2HDQ A;  3ZG9 B;  5B1M D;  5L2F A;  4S2N C;  2BYK B;  1LL9 A;  1BTL A;  1YT4 A;  4Z66 A;  3UN7 A;  5AV5 B;  3X1V C;  3IF5 A;  5CPK A;  5F99 A;  2BYK A;  3S22 A;  5AV5 A;  1K55 C;  4LD9 C;  1YLY A;  3UPN A;  3V9R A;  3UO9 A;  3G32 A;  1JFI B;  3B6G B;  1ONH A;  1P34 B;  2P9V B;  4GOG A;  4DQY B;  4UUZ A;  5GHY A;  2ZQ9 A;  5CGW A;  4N1H A;  4FCF A;  3O87 A;  3HLB A;  4XZQ A;  5B33 C;  5EVI B;  1RP5 A;  1TAF B;  5CTM A;  4HBU A;  4WYY A;  3UDI A;  2ZQC A;  5B24 C;  1S6R A;  1P3M C;  2IWC A;  3KS8 A;  1F66 D;  2H0Y A;  1LI0 A;  2DQN C;  1ZG6 A;  3VP0 A;  3VH6 T;  5C3I C;  4IBK A;  4E6W A;  1TZY D;  3V3S A;  5DVA A;  1PWG A;  3WRT A;  4OPY A;  3UTA C;  3G30 A;  4IBR A;  1Z2C B;  3BFF A;  4J8X C;  3VFH A;  1EQZ D;  5E43 A;  4GD8 A;  2LY8 A;  4PM6 A;  3KS4 A;  1NXY A;  3PBR A;  3NQJ B;  5FA7 A;  5GHZ A;  1NYY A;  2XR0 A;  3IH9 A;  4PM7 A;  4WEJ A;  1KX5 D;  5CPJ B;  3V50 A;  4XUJ A;  3OPH A;  1WWS A;  3AV1 D;  3N7W A;  4HEF A;  5B2I D;  3AZI A;  3KXB A;  3A6N A;  5B32 D;  2HPB A;  2UWX A;  4Y7P A;  4EBN A;  3LZ0 B;  2H0T A;  4WM9 A;  3EPL A;  1M19 C;  3AZH D;  5AV8 A;  2DNS A;  5E5A B;  3MFD A;  3L29 A;  3LJA C;  4KZ9 A;  3M6B A;  2RVQ D;  1K56 D;  4J8U C;  1WWI A;  4KUD D;  2J9O A;  3AZJ A;  3W98 A;  5AVC B;  3X1U C;  4JJN C;  5E5A A;  1M18 D;  2EXB A;  4WEK A;  3W96 D;  3AZL D;  3FKW A;  4QY6 A;  1BLC A;  5TGF A;  2PU4 A;  1ZLA B;  3GRJ A;  5GT0 D;  4R23 A;  4OJP A;  2Y2J A;  1I2W A;  1HQ3 C;  5EEC A;  3AZG C;  3HLF A;  3NY4 A;  2HUE C;  5B0Z C;  1MY8 A;  5M1A A;  1KX4 A;  1SHV A;  2ZC6 B;  3WX7 A;  4S2L A;  3WA9 B;  3W99 D;  4IBB A;  4P0M A;  4DRT A;  2PYO A;  4E3M A;  5BS7 C;  3O62 A;  5B40 D;  4IBD A;  5AQA A;  1SKF A;  3IXB A;  1N1J B;  3WA9 A;  1E3U A;  5B1L D;  3B6F D;  3DWZ A;  3P98 A;  3VP3 A;  2ARO D;  5B1M C;  1MPL A;  5DNN B;  3X1S A;  1DJA A;  3C1C A;  2ZD8 A;  3VFF A;  5M18 A;  2XQZ A;  3REK C;  2CV5 B;  2HP9 A;  2NZD D;  3REL A;  3UPP A;  2ZM0 A;  4KQQ A;  4X23 B;  2CV5 A;  3MGQ D;  4OUI A;  3VH5 T;  3AZF D;  4GN2 A;  5A91 A;  5B31 B;  2HP5 A;  3H0M C;  4R3J A;  3LZ1 D;  3WS4 A;  2XFS A;  5GSU D;  3ZFZ A;  4S2K A;  3KUY D;  5GXQ B;  4MBF A;  1F66 C;  3UTB D;  5A92 A;  2BG1 A;  5GXQ A;  1BSG A;  3AN2 A;  3BYD A;  3MGP B;  5B2J B;  1E4D A;  1TZY C;  2OLU A;  3TSG A;  4EWF A;  4WZ5 C;  2J8Y A;  4ZUX A;  3BLS A;  3UE1 A;  1EQZ C;  1Z6F A;  5B2J A;  4YM6 A;  3MKF A;  4QLC D;  5CTN A;  3LO7 A;  3L26 A;  2IWD A;  3MZD A;  3AZK B;  2XDM A;  3IF6 C;  1KX5 C;  3MKE A;  4OJL A;  3AZM A;  1M1A B;  3FZC A;  1W79 A;  3AV1 C;  4X56 A;  4OQ0 A;  3RJU A;  4WV4 B;  4QU3 A;  3MGS D;  5JYP A;  5B2I C;  5B32 C;  4X55 A;  2XH9 A;  1M1A A;  4QNL A;  1P3B C;  4J8W D;  4JXW A;  1ONG A;  4H9Q B;  1S32 A;  3LY3 A;  5JA4 B;  3X1T D;  1ULY A;  3NBL A;  3AZH C;  3B0C W;  4MBH A;  4IBC A;  1SDE A;  3FYZ A;  2XK1 A;  2EX9 A;  4KUD C;  4L0L A;  4AWL C;  4R0Q A;  4Z5T A;  4J8V B;  3FKE A;  1M18 C;  2ZY5 A;  3UT9 A;  1PZP A;  3W96 C;  1BLS A;  3AZL C;  1P3F B;  3MVD A;  3AZE A;  3QNC A;  4YS3 A;  5FQQ A;  1P3P B;  1W8Y A;  4WEL A;  3MZE A;  4J8V A;  1J9M A;  4WJ3 C;  4LV3 A;  2G5I C;  3AV2 A;  1K6S A;  4LCM A;  4ZDX A;  2XD5 A;  4H9O A;  3NQU A;  1P3P A;  2JBF A;  4NK3 A;  4F94 A;  1K54 A;  4PM5 A;  5BNX B;  5AY8 D;  3AZN D;  1DJB A;  5CGS A;  2WKH A;  1FCO A;  3AFA A;  1HD8 A;  1AXB A;  5CEC A;  3W99 C;  3BFE A;  4HGA B;  3C4O A;  5B40 C;  3WS5 A;  1LI9 A;  3W4Q A;  5B1L C;  4OH0 A;  3B6F C;  5BO0 B;  1LL5 A;  1IKI A;  2ARO C;  1FCM A;  5AVB D;  2HIO A;  5KDM B;  3EPK A;  3REJ B;  1ZC2 A;  1L0F A;  2WUQ A;  4H9S A;  3HBR A;  2QMI A;  2ZY4 A;  3X1V B;  2NZD C;  1KDS A;  3CMZ A;  3EQV A;  3REJ A;  5CXW A;  4CSR B;  2V1Z A;  5KZH A;  3MGQ C;  4OQI A;  1AOI D;  4LD9 B;  3HVF A;  5CPI D;  3TU4 D;  3AZF C;  3WKJ D;  3MNN B;  5FAS A;  5EOE A;  4GDN A;  1P3A D;  1P3I D;  1CI8 A;  1MWR A;  1YMS A;  3IWO A;  2HDS A;  4NE6 A;  2Y2M A;  2IOU A;  4MBK A;  5GSU C;  3W97 A;  4GH9 A;  5B33 B;  3KUY C;  3MNN A;  1BFM A;  3HLG A;  3A3D A;  5B24 B;  3UTB C;  1P3M B;  1ERO A;  2ZQ8 A;  4KGC D;  1YU2 A;  4B4Z A;  3REH D;  4NZ1 A;  4DE1 A;  5C3I B;  5FQ9 A;  1K57 A;  2Z2M B;  1FR6 A;  5GLB A;  3AGD A;  5GT3 A;  3UTA B;  1P3K A;  1FR1 A;  4QLC C;  1BZA A;  5AV6 D;  4J8X B;  5EPH A;  4G91 C;  4Q8I A;  4Y0T A;  2J8P A;  2JSS A;  2L5A A;  2F8N A;  3SS4 A;  4S2J A;  3C1B A;  4JF6 A;  4H8R A;  3MGS C;  5E2F A;  5DNM A;  2EX2 A;  4P6B A;  4BEN A;  3MGR A;  4J8W C;  4WU9 A;  4OOL A;  3X1T C;  3VH6 W;  4NZ4 A;  5B0Y A;  3DW0 A;  4C3Q A;  2XD1 A;  1M19 B;  4KZ4 A;  1FSW A;  2NQB A;  3PBS A;  4DXC A;  3LJA B;  1PYY A;  3UPO A;  4J8U B;  2ZM5 A;  2RIQ A;  3OC2 A;  2XEP A;  4NYU A;  4JJN B;  1KGF A;  4K0X A;  3HRE A;  2Y2H A;  5AV9 B;  4JXV A;  4IBX A;  5CEB A;  2X01 A;  3IHA A;  3Q7Z A;  4OLD A;  4P87 A;  5FAQ A;  1HTA A;  5AY8 C;  3AZN C;  1W2E A;  5AV9 A;  3WAA A;  5F1F A;  4S2O A;  4QD4 A;  4DDY A;  1O7E A;  2FJ7 A;  1HQ3 D;  4N9K A;  4ZBE A;  5B0Z B;  4R4S A;  4A5R A;  3AYW A;  1P3G D;  5F82 A;  2BYM A;  1W5D A;  3LEL A;  4ID4 A;  1IEM A;  2Y2L A;  4CPK A;  5EUA A;  5AVB C;  4GDB A;  1ES3 A;  3EG5 B;  4HES A;  4JF5 A;  4IVI A;  2JE5 A;  2WKI A;  4X6T A;  1YU3 A;  2JC7 A;  3IXD A;  5B1M B;  4JXS A;  1I2S A;  3REI D;  5FUG A;  1W7F A;  3WTP A;  2R9X A;  5JRG A;  3KWQ D;  4OJ5 A;  1YU0 A;  3L28 A;  5CED A;  4R8P D;  1ERM A;  1AOI C;  5CPI C;  2EX8 A;  3TU4 C;  2G2U A;  3REK D;  3WKJ C;  1OME A;  1P3A C;  1P3I C;  5BT1 D;  2GDN A;  2Z2L B;  5GLA A;  3L25 A;  3C5A A;  5HAR A;  1MKI A;  4S2I A;  5CPK D;  2EXA A;  5F99 D;  3N8L A;  4YFM A;  5AV5 D;  1JFI A;  3B6G A;  2A49 A;  5B31 G;  1P34 A;  1C3B A;  3G2Y A;  2P9V A;  2WGI A;  4KGC C;  4FH4 A;  4IJF A;  3REH C;  1F66 B;  4RX3 A;  5FAO A;  1YLT A;  1XA1 A;  5EVI A;  4WMC A;  3BFG A;  1TAF A;  3N6I A;  4GB7 A;  3C7V A;  5FI2 A;  4XZQ D;  3GV9 A;  4E45 A;  3SS3 A;  5IHV A;  5CRF A;  5AV6 C;  4OQG A;  3VH5 W;  1EQZ B;  1YMX A;  3HLD A;  5HAP A;  4U0T A;  5AQB A;  1U35 C;  3P5J B;  1KX3 D;  3WS0 A;  3IF6 B;  1KX5 B;  1BLP A;  1P3O C;  5BNV B;  4UA7 A;  5E2G A;  3AV1 B;  3GQZ A;  4KZB A;  2DF4 C;  5B2I B;  3NQJ A;  5B32 B;  4K0W A;  1FCN A;  5CPJ A;  1MBL A;  3WS1 A;  1ESI A;  3ISG A;  3AZH B;  4IED A;  1IKG A;  1P3B D;  1KDW A;  4XUJ D;  2Y2N A;  4KUD B;  4AWL B;  3O3V A;  3AZH A;  5FQK A;  4WZ4 A;  1IYP A;  4MLL A;  1M18 B;  1L0D A;  4IVK A;  4DDS A;  3LZ0 A;  3AZI D;  3KXB D;  3A6N D;  3W96 B;  4OP5 A;  3AZL B;  1YQS A;  3G4P A;  1QMF A;  4FSF A;  1BH9 B;  1DJC A;  3IHB A;  1IYQ A;  5AV8 D;  5GT0 B;  5AVC A;  4N92 A;  3W4O A;  4E3I A;  3AZJ D;  4WU8 B;  3W98 D;  5BPV A;  5GT0 A;  1LLB A;  1M6K A;  3ITA A;  3BLM A;  1MWT A;  1ZLA A;  4KZ5 A;  1P3G C;  3S4X A;  4WU8 A;  5KSH A;  2Y4A A;  3W99 B;  1NZO A;  2WZZ A;  4XUX A;  2V2F F;  5B40 B;  1WYB A;  3SH7 A;  5B1L B;  3B6F B;  4IBE A;  2ZC4 B;  5EVL A;  4B4X A;  1KX4 D;  3L27 A;  2QZ6 A;  4EO5 B;  2EFX A;  1K38 A;  3FV7 A;  3REI C;  3KWQ C;  3HUN A;  2PYO D;  1N1J A;  4R8P C;  2NZD B;  3O62 D;  1FQG A;  3GMW A;  5FI6 A;  3VSK A;  4BD0 A;  1H3O B;  1E3U D;  5DNN A;  3V5M A;  5BT1 C;  2Y2P A;  3MGQ B;  1Q9C A;  3X1S D;  3C1C D;  3AZF B;  4Z66 C;  3ZCZ A;  3KFU G;  1KE4 A;  2ZQD A;  4ZJ3 A;  5CPK C;  5F99 C;  3LZ1 B;  2OLV A;  4LEN A;  1KVM A;  3NDG A;  2H10 A;  3UDF A;  5G49 B;  3REL D;  5AV5 C;  3KUY B;  4X23 A;  1P3L B;  3LZ1 A;  5DF9 A;  2A3U A;  5B31 A;  4MEZ A;  3UTB B;  4BJP A;  4UPK A;  2IO5 B;  2ZC3 B;  4KZ6 A;  1XXM A;  4XZQ C;  1P3L A;  2QPN A;  3LY4 A;  3MZF A;  2ZQ7 A;  4G92 C;  5GL9 A;  4QLC B;  5D3O A;  1KX3 C;  3NI9 A;  3FWL A;  3MGP A;  1NJ4 A;  1L0E A;  2Q9N A;  4G91 B;  3B0D C;  1GA9 A;  3AN2 D;  2W8S A;  2J7V A;  2HDU A;  3AL0 C;  4ZUX D;  5FDH A;  3MGS B;  5FAT A;  1H5X A;  4YM6 D;  3AZK A;  3MXR A;  4RX2 A;  1HVB A;  1YLJ A;  1ZG4 A;  4J8W B;  3PBO A;  1PZO A;  3X1T B;  3GTC A;  4X68 A;  4FH2 A;  4XUJ C;  1Y54 A;  3AZM D;  1EWZ A;  5CHU A;  2WYX A;  2WGV A;  2RCX A;  4DE3 A;  2X71 A;  3AZI C;  3KXB C;  3A6N C;  2J9P A;  3HL9 A;  4H9Q A;  5JA4 A;  3A1I A;  1IYO A;  3ZG8 B;  2ZM2 A;  3BFC A;  1S32 D;  4GNU A;  5AV8 C;  5A90 A;  5F83 A;  4EBP A;  1ES4 A;  3AZJ C;  1RCJ A;  5TR7 A;  3W98 C;  4Z2M H;  1P3F A;  4Z5T D;  5AY8 B;  4U3T A;  3AZN B;  3S1Y A;  2CC1 A;  3UT9 D;  3VH6 A;  5EE8 A;  4X53 A;  3MVD D;  3Q7V B;  4C75 A;  3AZE D;  1JWP A;  4YS3 D;  1FSY A;  5TFQ A;  3BFD A;  4J8V D;  3SH8 A;  3PTE A;  2FFF B;  2VQR A;  5HFO A;  2JCH A;  3AV2 D;  5BNX A;  1P3P D;  3LCE A;  4U0X A;  3ZNY A;  3HLW A;  5AVB B;  3ZVT A;  3FKV A;  4RYE A;  1KX4 C;  3AFA D;  1PW8 A;  1PWD A;  3NDE A;  1GHP A;  2ZQA A;  2PYO C;  3O62 C;  1I5Q A;  5BO0 A;  1YUE A;  3WA9 C;  2H5S A;  4OLG A;  5KDM A;  2HIO D;  2BLS A;  3X1S C;  5CPI B;  3NIA A;  3TU4 B;  3C1C C;  2FFY A;  4NET A;  4S2N A;  3IQA A;  3WKJ B;  3O86 A;  1P3A B;  1P3I B;  1T3U A;  4ZAM A;  3X1V A;  3H0L C;  5J8X A;  3REL C;  4CSR A;  4X69 A;  5FQI A;  1K55 A;  4LD9 A;  3Q82 A;  1TDL A;  3CZD A;  2WGW B;  2ZC5 B;  2Y2K A;  4LV2 A;  4BL2 A;  3C7U A;  4E6X A;  1PI5 A;  4E3N A;  4KGC B;  2F8N K;  4M3K A;  3ZG5 A;  1CK3 A;  5E2H A;  3REH B;  3WS2 A;  1ES2 A;  4BD1 A;  5B33 A;  3W97 D;  4CAY B;  3MNN D;  2X02 A;  3QHY A;  5B24 A;  3RXX A;  1P3M A;  1N4O A;  4MNR A;  4KG6 A;  3W8K A;  5AV6 B;  3UNW A;  4QB8 A;  4DRB A;  5KSC A;  2F2A C;  3AN2 C;  1XPB A;  4LCL A;  4EQI A;  1CEF A;  1TDG A;  4WNN B;  1SCW A;  2YFV B;  4R4R A;  4ZUX C;  3UTA A;  2WK0 A;  1U35 D;  5AQ9 A;  5GT3 D;  4YM6 C;  4J8X A;  1P3K D;  1MWU A;  4WNN A;  4E3O A;  1P3O D;  4OON A;  3B0C T;  3CG5 A;  1H8Z A;  2XF3 A;  4KZ8 A;  2F8N D;  3AZM C;  3Q07 A;  2ZY2 A;  4M6B A;  3C1B D;  1BH8 B;  3C4P A;  5AQ7 A;  5B32 G;  5DNM D;  3VH5 A;  3WTP E;  4H9N B;  2WKE A;  4Y0O A;  5DF7 A;  1GHI A;  1BH8 A;  3MGR D;  2Q9M A;  4WU9 D;  2PBY A;  1S32 C;  1L2S A;  5M19 A;  5B0Y D;  1TEM A;  5GLC A;  4UHU A;  1M19 A;  1NRF A;  4DXB A;  3X1U B;  3R45 B;  3LJA A;  4ZBJ C;  2NQB D;  4J8U A;  5CP6 D;  2DRW A;  4Z5T C;  3UT9 C;  4RA7 A;  3X1U A;  4JJN A;  2XLN A;  3G35 A;  4XUZ A;  3MVD C;  3AZE C;  1HZO A;  4YS3 C;  3EQU A;  1YM1 A;  1HQ3 B;  1WYC A;  3WRZ A;  4J8V C;  1ID3 D;  3AZG B;  3GVB A;  1GA0 A;  2YFW B;  4OPQ A;  3BEB A;  2HUE B;  3AV2 C;  1P3G B;  2C5W B;  2G2W A;  4Z2M G;  1HQ3 A;  1P3P C;  1K54 C;  5GHX A;  3AZG A;  3WAA D;  4OQH A;  3AFA C;  5B0Z A;  2FJ7 D;  3IT9 A;  1DY6 A;  2VGJ A;  1K6R A;  3AYW D;  3REI B;  3LEL D;  3A3F A;  5BS7 A;  3KWQ B;  4H9R B;  5FI7 A;  1ALQ A;  4R8P B;  2HIO C;  2HDR A;  5B1M A;  3H0R C;  3REK B;  3ITB A;  2Y91 A;  3IH8 A;  3WWX A;  5GLD A;  4H9S C;  1K25 A;  4RVA A;  3GR2 A;  4S2P A;  4GKU A;  2WAE A;  3REK A;  5F99 B;  3WTP D;  5JRG D;  3REJ C;  2WAF A;  3B3X A;  4Z66 D;  4JF4 A;  3V39 A;  4EV4 A;  5FAP A;  3OPR A;  4IBJ A;  1KGE A;  1MXO A;  1PI4 A;  3V9R B;  4Y0U A;  1PW1 A;  3PBN A;  3D4F A;  3UY6 A;  1KE0 A;  1JWV A;  4UUZ B;  3W97 C;  1IYS A;  1NY0 A;  3A3J A;  4DF6 A;  4XZQ B;  2ZM8 A;  3MNN C;  3EPJ A;  3ZGA B;  5DTT A;  3UE0 A;  4GHA A;  1TZY B;  3B6G D;  1P34 D;  1F66 A;  4G92 B;  4N9L A;  1KX3 B;  2WZX A;  2C6W B;  1G6A A;  5EVI D;  4WMC D;  1TZY A;  3AGE A;  3HLE A;  4QHC A;  4WZ5 A;  1K57 C;  3B0D B;  4GZB A;  2Y55 A;  4NFT A;  5GT3 C;  1P3K C;  1KX3 A;  2Y2G A;  1EQZ A;  5CHL B;  4KZA A;  3VMA A;  4P85 A;  1CEG A;  3A3E A;  2F8N H;  4GD6 A;  4QJG A;  3IF6 A;  1KX5 A;  4CJN A;  3FDD A;  1EI5 A;  5BNV A;  3C1B C;  4DE2 A;  4WBG A;  3AV1 A;  1P3B B;  4LG2 A;  4XUJ B;  1MWS A;  4OKP A;  5DNM C;  1BUL A;  1XGI A;  3B0B A;  5B2I A;  3OZH A;  5B32 A;  1GCE A;  3MGR C;  2ZJ9 A;  4WU9 C;  1P3B A;  5B0Y C;  3KXB B;  3A6N B;  3AZI B;  5HW3 A;  5A93 A;  4LV1 A;  1GHM A;  3ZG0 A;  3G2Z A;  1K4E A;  5JYO A;  5CPJ D;  4JBF A;  5AV8 B;  4BL3 A;  2NQB C;  1K56 A;  1XGJ A;  1VM1 A;  5CP6 C;  4KUD A;  1F1E A;  4YIN A;  1M18 A;  3AZJ B;  3W98 B;  3W96 A;  3HON A;  5I94 A;  3AZL A;  4OPZ A;  1ID3 C;  3LZ0 D;  1BH9 A;  5E5A D;  2HP6 A;  5AV9 C;  3WAA C;  5AVC D;  3HSH A;  3N8S A;  1BUE A;  3M2K A;  2XGN A;  1L0G A;  2FJ7 C;  3OCN A;  1TVF A;  1YU4 A;  4Z9Q A;  1KX4 B;  4KQO A;  3W99 A;  4KZ7 A;  3KSY A;  1ZLA D;  2ARO B;  3AYW C;  4WU8 D;  4K91 A;  5KMW A;  3LEL C;  3VOZ A;  2PYO B;  5B40 A;  1LHY A;  4C6Y A;  4E3J A;  1N9B A;  4IBG A;  5B1L A;  3O62 B;  3B6F A;  1ES5 A;  2ARO A;  1H8Y A;  3IXG A;  1JVJ A;  3N4I A;  3QNB A;  3X1S B;  3WA9 D;  3C1C B;  4HBT A;  4D2O A;  3WTP C;  5JRG C;  2NZD A;  4QY5 A;  4PMA A;  1H3O A;  1YLW A;  3REL B;  1YLZ A;  3MGQ A;  5GSU B;  5DNN D;  3AZF A;  1JWZ A;  5FQJ A;  1RGY A;  3CJM A;  5GSU A;  2CV5 D;  2EFU A;  1BT5 A;  5G49 A;  3KUY A;  4BLM A;  1NZU A;  3SH9 A;  3ZDJ A;  1M40 A;  3B6G C;  4X23 D;  1P34 C;  3OCL A;  3UTB A;  3OPP A;  1KGG A;  5B31 D;  2EX6 A;  5EVI C;  4S2M A;  1NYM A;  4EBL A;  1KU5 A;  3AN2 B;  1P3L D;  4ZTK A;  1XA7 A;  3E2K A;  5F1G A;  5GXQ D;  4ZUX B;  4DKI A;  4PM9 A;  3SS5 A;  4QLC A;  4NYY A;  1K4F A;  5U47 A;  4OOY A;  4YM6 B;  3DWK A;  3MGP D;  5B2J D;  3IP4 C;  4NY2 A;  2OSU A;  1U60 A;  5HAQ A;  4NE3 A;  1BLH A;  3AZM B;  4OPR A;  3MGS A;  2F8N G;  3LEZ A;  4J8W A;  3Q81 A;  3VP4 A;  3AZK D;  3X1T A;  4JPM A;  1W8Q A;  5CPJ C;  1S32 B;  4NZ5 A;  1B6W A;  3AGF A;  1M1A D;  1JTG A;  3BRM A;  1G68 A;  3M2J A;  2E8I A;  4ZBJ B;  4KG5 A;  3UDX A;  3N8R A;  1PZR A;  4Z5T B;  3UT9 B;  2P74 A;  1VQQ A;  3LZ0 C;  1KE3 A;  2RVQ C;  3MVD B;  3AZE B;  2ZMA A;  4YS3 B;  3O88 A;  5E5A C;  4KEN B;  4IBF A;  1S0W A;  4UAA A;  5G18 A;  1Q2P A;  4KG2 A;  4KZ3 A;  2IWB A;  2ZY3 A;  5AVC C;  3AV2 B;  4IBI A;  3VP2 A;  4E3K A;  4H9O B;  5AY8 A;  3NQU B;  3AZN A;  1B67 A;  1QME A;  1P3F D;  3Q7V A;  5GT0 C;  1ZKJ A;  5E2E A;  4H9P B;  1HTZ A;  3DTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...