2Y2LA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e06)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
489
structure length
472
Chain Sequence
ISEITYSDGTVIASIESRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 162
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2lA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2lA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2lA02
2EFUA 4JXGA 3UE0A 4JKTA 1K54A 4KZAA 1DJAA 1NYMA 4E3JA 5EOOA 1K4FA 4UA6A 4DDYA 2H0TA 3PAEA 2VGJA 4S2NA 4E3MA 4S2KA 1FCOA 1JTDA 1XGJA 5FSRA 4XUZA 1S0WA 2QZ6A 5FA7A 5A90A 2H0YA 2XH9A 4OOLA 1K57C 3HVFA 4XXRA 1PW1A 1RGYA 5HX9A 4KQQA 3HUNA 3RJUA 2ZC6B 3GQZA 4R23A 5FQ9A 5IHVA 5KSHA 4BJPA 2OLUA 4IVKA 5DTTA 1IKGA 4QU3A 1NRFA 2WGVA 2Z2MB 3AGDA 3PBNA 4X68A 4X6TA 4RX2A 3HL9A 4Y7PA 1HD8A 1QMEA 4KQOA 4QB8A 1PWDA 2ZM8A 5FQQA 2OLVA 5EVIC 1O7EA 3OCLA 4OQGA 3ZG5A 1PZPA 3ZG0A 4P6BA 1LHYA 5EPHA 5HW3A 3BLMA 3MZEA 4EBNA 1YLZA 2HP6A 3M2KA 1HZOA 3IF6B 4LV2A 3BRMA 1KGEA 4PM8A 5E2GA 3IH9A 1IYOA 2WZXA 4EUZA 4Q8IA 1BLSA 4ZDXA 4MEZA 1KGGA 4ZJ1A 1I2WA 3W4PA 3NC8A 5DF7A 3QHYA 1BUEA 1XA1A 3CMZA 2QMIA 3G4PA 3RXXA 4C75A 1O07A 4WYYA 1TDGA 4K0XA 2Y2LA 3SH9A 2WAEA 1W5DA 2UWXA 4BL3A 2XFTA 2Y2NA 1LI9A 1KDWA 5G18A 5FAOA 3G2ZA 2J7VA 5EVIA 3DWZA 4XUXA 3UPNA 4EWFA 3Q81A 5FI2A 5CEBA 2ZQCA 4X53A 1K55C 5HAIA 1H8ZA 5CHJA 2ZQ9A 2ZQ8A 4X56A 5GLCA 4GB7A 5JYPA 1SKFA 3A3JA 3MZFA 1E4DA 1FR1A 4M3KA 4GOGA 3TSGA 3C4PA 3O86A 4MBKA 4IEDA 5GLAA 3ZG9B 3SH7A 3ZHHA 2XGNA 3MXSA 1ZKJA 5CECA 5AQ9A 1QMFA 2Y55A 4U0XA 3S1YA 3ZG7B 2Y2GA 1EROA 4BENA 1SDNA 2ZC7A 3EQVA 5DTSA 5AQ7A 2PU2A 2HDSA 3OPPA 2V20A 3IF6C 4KZ5A 3O3VA 2XD1A 4MNRA 2RL3A 3NY4A 4GD8A 3IWQA 4K91A 4FCFA 1MWUA 3BFEA 1PZOA 4CJNA 3W4QA 1E25A 3CG5A 1LL9A 2OSUA 3E2LA 4JXSA 5AQBA 4WEKA 1ES4A 3FZCA 4WZ5C 2Y2KA 5GHXA 5CHUA 3UPPA 1KVLA 1Z6FA 3N6IA 4S2MA 1K4EA 3GMWA 3ZCZA 3BFCA 1BLHA 3LO7A 4BD0A 1IYQA 1BT5A 2Q9NA 4OVDA 3VP0A 1KE3A 2JCHA 4PMAA 2P74A 4S2NC 3MFDA 4HEFA 4WM9A 1KGFA 3IF5A 2G2WA 3SS4A 5CTNA 5TGFA 2XD5A 3BFFA 3IXBA 4RYEA 4H8RA 5FI7A 1EWZA 1MWRA 3FV7A 5HFOA 4BD1A 4IBRA 1XPBA 3HLGA 3PBQA 3HREA 1TEMA 2ZD8A 4GDNA 5EUAA 3IXHA 5F82A 3OC2A 4EBLA 5TFQA 1PWCA 1IELA 3VOYA 5CXWA 2HPBA 4DE1A 3BEBA 3LY3A 5EECA 3WRZA 3MKFA 4WZ5A 1FSYA 3CJMA 1SDEA 2ZC5B 3RXWA 1XXMA 5GHYA 3VMAA 4EBPA 3PBRA 5DTKA 1GA0A 3HUMA 1BTLA 3I7JA 4KZ4A 3LCEA 4S2LA 5HAQA 5FI6A 3HLBA 1MKIA 2HDUA 3FKVA 2WZZA 1L0DA 1S6RA 4UA9A 3UDXA 1BZAA 3HLFA 4KG5A 4EV4A 1CI9A 4E3OA 4E3KA 4DXBA 2Y2MA 1BSGA 3BECA 5KMWA 4OQ0A 1KE0A 4HESA 1WYCA 1FQGA 1HVBA 2PBYA 5AQAA 4KZ7A 3M6BA 3UN7A 3GV9A 3Q1FA 4UA7A 1H5XA 1W7FA 3MKEA 4NETA 4KG6A 1ZG6A 2DRWA 2OV5A 1W8YA 5TR7A 1U60A 3VFHA 1VQQA 4JPMA 3W8KA 1Q2PA 2ZC4B 3NCKA 3Q7VA 5FDHA 3ZVWA 4S2JA 3IT9A 4F94A 1IYSA 3FWLA 3OPLA 3G34A 5FAQA 1YMXA 2A3UA 4QHCA 4QY5A 1CEFA 4MBFA 2P9VB 3BM6A 4N1XA 4LV0A 1NZOA 3QNCA 3DW0A 4N1HA 1L0GA 3WS1A 3ZVTA 2WKHA 5CERA 5M19A 1IEMA 3GRJA 5FATA 4OP5A 4UHUA 2EX2A 4GKUA 3A3FA 1Y54A 4C3QA 4EQIA 3WS0A 4N92A 3SOIA 2XLNA 2WKIA 3V5MA 3ZDJA 3A3DA 1GCEA 1L0EA 2WAFA 4LCMA 4BL2A 3C7UA 3DWKA 3ITAA 1SCWA 3VSKA 4WMCD 5KZHA 5F1GA 5M1AA 4BLMA 4OPRA 4RA7A 4FH4A 5GLDA 1ES3A 4PM5A 2Y2JA 2WKEA 2J9PA 3O87A 3IH8A 3OPHA 4JBFA 4DF6A 4DDSA 3VP2A 1VM1A 3IWIA 2H10A 1PIOA 4WELA 5BOHA 2XFSA 4P87A 4N9KA 4LENA 3UE1A 1YLPA 1FCMA 1NY0A 3OPRA 4OQHA 1TDLA 2FFYA 5CGXA 3ZG8B 1JWPA 2Y4AA 1ALQA 1W79A 1RGZA 2ZM0A 3MBZA 3GTCA 4FSFA 5DF8A 1ES2A 4A5RA 1LI0A 1PWGA 3VFFA 3S4XA 4KZ8A 3TOIA 3VP1A 5J8XA 4R0QA 4ZBEA 3SS5A 3WS2A 4N9LA 3Q7VB 5EVLA 1L2SA 1XGIA 1MWSA 2JBFA 1ERQA 3Q82A 4KG2A 4K0WA 1YMSA 1ONGA 2G2UA 3HUOA 1BLCA 2VGKA 1ERMA 3N8RA 4OONA 3UY6A 3PBTA 2IWDA 1L0FA 5FQMA 2DNSA 3OZHA 1WYBA 1MBLA 2Y2OA 4R4SA 5CRFA 4OP8A 2V1ZA 5HAPA 3C4OA 1MPLA 3FKWA 2R9XA 2X71A 4KZ3A 1YM1A 4DE0A 2Y91A 3ZGAB 2XQZA 3G35A 4JF5A 5U47A 4JXWA 2ZC3B 3N4IA 1YLTA 3ZFZA 5E2FA 3QNBA 3VP3A 5A93A 2QPNA 4QY6A 1XA7A 5CGSA 3V50A 2ZM2A 2R9WA 1PI4A 2P9VA 2XEPA 4IVIA 1GA9A 2B5RA 2DCFA 5EE8A 2EX9A 5L2FA 1MXOA 3ITBA 4Z9QA 2ZLYA 3GSGA 2Y2PA 5HL1A 2HDRA 3IWOA 4FH2A 2HP5A 3Q7ZA 4LV3A 4U3TA 4IBXA 1NZUA 3B3XA 4WZ4A 4Y0TA 3Q07A 2EXBA 1YLJA 3C5AA 3JYIA 4X69A 2ZQ7A 4JLFA 4PM9A 1C3BA 3M6HA 4WEJA 1FCNA 1MY8A 3NBLA 3PBOA 3IHAA 4DRTA 1E3UA 3O88A 4MBHA 1ZC2A 2Q9MA 3CZDA 4YINA 1G68A 3LEZA 4E6XA 1DJBA 4DKIA 1YT4A 4JF6A 5GHZA 5EOEA 4CPKA 1RP5A 4GN2A 3P98A 3ZNYA 4DXCA 3VSLA 2EXAA 3UPOA 2C5WB 1CI8A 2ZMAA 2A49A 1N4OA 5D3OA 5CEDA 4S2IA 3WWXA 3AGFA 2ZQDA 4FD8A 2XF3A 2XR0A 3EQUA 2Y59A 4L0LA 3WS4A 3HLDA 3A3IA 4OH0A 3NI9A 4WMCA 3E2KA 4OOYA 2WGIA 3BYDA 3ISGA 4OLGA 3VOZA 1ESUA 3UNWA 3N8LA 4GNUA 3MZDA 3G32A 5KSCA 4QJGA 3IQAA 4R3BA 4C6YA 4ZJ3A 4OQIA 5JYOA 1AXBA 1BULA 1E3UD 3D4FA 3FYZA 5CHMA 4DE2A 5E2EA 3P09A 1K56A 5DF9A 1LLBA 3UE3A 4KZBA 4ID4A 5E43A 3GR2A 4O7DA 2JE5A 3AGEA 5FQKA 4R1GA 3S22A 3W4OA 4BQMA 2RCXA 4B4XA 4MLLA 1K25A 4E3LA 5CTMA 1NJ4A 3V3RA 5GLBA 2XDMA 2J8YA 1J9MA 1KE4A 3V39A 1GHIA 3PTEA 4S2PA 4RVAA 4OPZA 1N9BA 4RX3A 3V3SA 1KVMA 4YFMA 3NDEA 4E6WA 1K57A 2IWCA 1CEGA 2EX8A 2Y2QA 5FQJA 3HLEA 1ES5A 3A3EA 4ZTKA 1TVFA 1FR6A 4E3IA 3UDIA 1PI5A 4GD6A 4JF4A 1YQSA 2WADA 4R3JA 2HP9A 1FOFA 1JWVA 1K56D 1K6RA 3BFDA 3BLSA 3PBSA 4PM7A 5F83A 1IYPA 1YLWA 2EX6A 2WGWA 3G2YA 3G30A 1ESIA 4DE3A 4PM6A 4R4RA 4P0MA 4OPYA 3N7WA 5FASA 1G6AA 1OMEA 4ZAMA 1GHMA 1ZG4A 5A92A 5GL9A 1XX2A 1I2SA 1DJCA 2H5SA 4WBGA 1JVJA 1M6KA 1SHVA 3HLCA 1K38A 4JXVA 4B4ZA 5FAPA 2CC1A 3NDGA 1I5QA 4Y0UA 5FQIA 3VP4A 1GHPA 1JWZA 3WRTA 3GVBA 2XK1A 4X55A 5HARA 5DVAA 3UO9A 4NK3A 1IKIA 2IWBA 3G31A 4OOMA 1RCJA 1DY6A 1XKZA 4KZ9A 1XP4A 2V2FF 5M18A 2X01A 3DTMA 4KQRA 4HBTA 2JC7A 2HDQA 2FFFB 3SS3A 2BG1A 3ZNTA 3BFGA 5EVID 4HBUA 4OLDA 1K55A 2EFXA 3C7VA 1ONHA 1EI5A 3NIAA 4KENB 2ZQAA 4ZJ2A 4OKPA 4S2OA 2Y2HA 1YLYA 1BLPA 4KZ6A 4GDBA 2GDNA 3HLWA 4U0TA 5CGWA 1WE4A 2Z2LB 2X02A 3LY4A 3WS5A 3N8SA 3HBRA 1LL5A 2PU4A 3MXRA 4PPRA 3IXDA 4LV1A 2J9OA 2I72A 1K54C 4D2OA 1KDSA 4UAAA 2WGWB 1FSWA 4B88A 5EVIB 1NXYA 4LCLA 4GZBA 2ZJ9A 3OCNA 1PYYA 3SH8A 3IF6A 2WYXA 2C6WB 2Y2IA 1NYYA 1W8QA 3PAGA 3TG9A 5E2HA 5F1FA 1M40A 4Y0OA 3UDFA 3IHBA 4P85A 4OPQA 4E3NA 4QD4A 1HTZA 2E8IA 1CK3A 3M2JA 5I94A 1Q2QA 5A91A 1JTGA 2BLSA 2WUQA 1K6SA 2WK0A 1PW8A 1H8YA 1MWTA 3IXGA
chains in the Genus database with same CATH superfamily
4X25A 4MDZA 4EEUA 4E3JA 1P3GC 4UA6A 4GHIA 3NQUA 4S2KA 1JTDA 4FOFA 1S0WA 3LIAA 1A0KA 3EGXC 2KOIA 3VH5T 4UUZB 1PW1A 3NQJA 3HUNA 4NG2A 5FEGA 4BJPA 1M1AD 2OAP1 4B93A 5EV0A 3T1XA 3MGPA 3WKJA 4J8VC 1P3OB 5I5LA 4LRXC 1G28A 1NLZA 2R78A 4QB8A 4EQ1A 1O7EA 4OQGA 4P6BA 1E6ZA 1YSPA 5HW3A 3IX4A 3LR4A 2YFVA 4EBNA 2HP6A 3AZMC 3IF6B 3C1CA 4PM8A 1H3OA 5CP6B 3IH9A 1BLSA 4ZDXA 1KGGA 5DKKA 4J8UB 5DF7A 1H0MA 2W1TB 3G4PA 3RXXA 2VEAA 3B6GB 3SH9A 4QLCA 3REJA 3AZKB 1W5DA 2V8FA 5G49B 1KDWA 5G18A 3REID 2BYMB 3ZQ5A 4FUWA 4IBBA 2O9AA 2J7VA 5B1LC 3UPNA 3LR5A 1K55C 2ZQ9A 3AZMA 5DNNB 2ZM5A 5CPKA 3FPWA 4Z5TD 4X23C 3O86A 5JRGB 3FPVA 2EWVA 2K31A 2NUTC 4WU8B 1ZKJA 5AQ9A 1QMFA 4U0XA 3DBAA 5CX7A 3S1YA 3ZG7B 2Y2GA 4BENA 3RELC 4O0PA 1P3MC 3KS8A 2ZC7A 5DTSA 5AQ7A 3VOLA 2HDSA 5B1LA 1VHMA 5CPJB 1P3FC 4MNRA 1ZLAB 2RVQC 4DJ3A 5AV5B 1YAXA 1S67L 5E5AD 4GCZA 3UB7A 5AV6D 3CG5A 1LL9A 3E2LA 4X23A 4HP4A 1ES4A 3MGQB 3IS2A 1KVLA 3GMWA 3MGSD 4BD0A 4NZ5A 4GH9A 1BT5A 2Q9NA 4GHLA 3RELA 5L8MA 3TU4C 5HSQA 5AY8C 3MFDA 5KDMB 1P3FA 3MXQA 1TZYA 2D49A 3HREA 5F82A 3UB9A 3AV1B 1IELA 3F1OA 3WRZA 1FSYA 3RXWA 1VB6A 3EEAA 2ZY5A 3AN2B 1OPXA 5B0ZD 2PAVP 1P3AC 3I7JA 3WTPB 3LCEA 4H9RA 5HAQA 5CPIA 5FI6A 3LELB 4YS3A 3TU4A 2VX8A 3VH6W 4Z66D 3X1UC 1L0DA 1AOIC 1S6RA 1BZAA 2JKGA 4LLOB 5HDSA 2Y2MA 3BECA 1LT0A 4HESA 1ULYA 3A0SA 1F66A 2HZ5A 5AQAA 4R70A 5B32G 3C30A 4DJ2A 4EUVA 4GS9A 1ED7A 3E4OA 5B0YB 3GV9A 3Q1FA 3UTAC 2FZ0A 2CV5D 1W7FA 4NETA 3MVDB 2PYOD 1ZG6A 1P3AA 5IT5A 4Y17A 5B31B 1UR9A 3C1BB 1SKOA 1Q2PA 4I3IA 5HD5A 1AOIA 3OPLA 5B40C 3AZLD 3W97C 4J8WD 2HIOB 3R4KA 1BYWA 3ZVTA 4Y15A 1ID3C 1IEMA 3GRJA 5FATA 3LIEA 3UTAA 4C3QA 3A3FA 2JKFA 1NWZA 2XLNA 2WKIA 3A3DA 1UGUA 3ITAA 3WA9A 5F1GA 5AVEA 3VH5W 4OPRA 4RA7A 1GSWA 2Y2JA 3LJAB 3W99C 4DDSA 1PIOA 3AZFD 5BOHA 5LBRA 3W97A 1XFQA 2XFSA 4N9KA 4LENA 3ZG8B 4WJ3C 4FTXA 3NOPC 3MBZA 4A5RA 1M18A 3AFAA 2ZOHA 1PWGA 3VFFA 5J8XA 3W96C 3SS5A 5BS7C 4N9LA 3WD0A 1XJ2A 4KG2A 3C8CA 1YMSA 1AWIA 3W99A 4JJNC 4LD9C 2VGKA 1ERMA 2XROA 4Z2MH 4NE5A 3L2AA 4IUHA 4HP9A 5CRFA 4OP8A 3LIFA 3DTEA 3KWQC 1YU4A 3CI6A 3FKWA 1S1YA 1YM1A 1HQ3D 5B33C 3KFUG 1V9YA 4DE0A 3ZGAB 2XQZA 4JF5A 3B42A 4YM6A 1KX3D 5BS7A 1YLTA 3ZFZA 5GSUC 2QPNA 2PRFA 4BBUA 4KQDA 2F8ND 3EPHA 2XEPA 4LD9A 2B5RA 2DCFA 5L2FA 1P3BD 4WU8C 1CQAA 4XZQD 3GSGA 1KX4C 5B2IB 1BH8B 3C2WA 2HDRA 3IWOA 3Q7ZA 1XJ6A 4IBXA 3B3XA 2WKRA 3QP2A 4AWLB 4NXFA 3KWQA 4WL9A 5AVBD 3JYIA 3R7WB 3KXBC 4X69A 3S7OA 1YSQA 3IHAA 2Z6CA 2YFWB 1S32C 3O88A 3MMHA 3H9WA 5GSUA 5GHZA 3PR6A 2FJ7A 4GN2A 3VSLA 3UPOA 3PYPA 1P3IA 3A6ND 5F68A 3UTBA 3QP8A 1IFQA 1N4OA 3X1TC 1H8MA 3KYZA 5CEDA 1KX4A 2XF3A 3EQUA 4QWOA 2Y59A 3WS4A 4CAYA 1DP8A 3HLDA 3MNND 2O9BA 1J3WA 3AZGB 1P3KB 3CITA 3K2NA 3N8LA 2CWEA 3LZ0C 1P3LC 1E88A 4C6YA 4OQIA 3AZHC 5B24D 1E3UD 3D4FA 1OTIA 4DE2A 4ZUXB 3P09A 1LLBA 3LIBA 3D9YA 3GR2A 4O7DA 3AZIB 3WAAB 2YKFA 1K25A 5BO0B 3NHQA 2NQBD 4F3LA 3X1TA 5JA4A 4OPZA 4RX3A 4YFMA 3GDIA 5IS1A 4E6WA 1TS8A 1JFIA 3IBJA 1P3LA 4ZTKA 3A3EA 4GD6A 3REHD 1YQSA 2WADA 4JF4A 4R3JA 5J7EA 1K56D 1K6RA 1VEUA 4B9OA 2W3EA 5GXQC 2EX6A 4XT2A 4CQHA 4DE3A 4GHIB 3NQUB 4R4RA 4P0MA 3N7WA 1G6AA 3JVUA 3F1NB 4G91B 4PAUA 1ZG4A 2HGVA 3BJNA 5HZHA 1I2SA 4WBGA 4Y13A 1PFLA 3HLCA 5F99B 4YOFA 2LY8A 2CC1A 5HWTA 1I5QA 2L1MA 3MGPB 1JWZA 3VP4A 3WKJB 5AV9A 3S7QA 3O62B 4XUJD 5F5YA 5GXQA 1DY6A 2V2FF 2X01A 1Z2CB 1P3GB 4KGCC 1E6NA 2HDQA 2FFFB 4BBTA 3ZNTA 2YFVB 1T19A 3BFGA 1CJFA 3AZED 1H3OB 3REKC 1EI5A 3NIAA 2ZQAA 4S2OA 1YLYA 4PKYA 4YWZA 3X1VA 4KZ6A 4JGRA 4M6BA 5CGWA 1MZUA 1WE4A 3N8SA 4R6LA 1TAFA 4J8VB 4DN0A 5B1MD 2W3DA 4LCLA 1PZRA 4MB4A 1PYYA 4I39A 2C6WB 3AZMB 3UB6A 1P3PC 5GT0C 1KX5C 1GXDA 2G5IC 3REKA 1M1AA 1M40A 4H9QA 3UDFA 3C38A 3T1RA 4OPQA 4E3NA 1HTZA 2E8IA 1CK3A 5A91A 3CPTA 1K6SA 2WK0A 1PW8A 1H8YA 2EFUA 4JXGA 3UE0A 3W98C 1P3OD 2B02A 2VK3A 4KZAA 4Q0HA 2H0TA 3PAEA 4S2NA 5GT3C 3VH5A 2IO5B 1XGJA 5FSRA 3V67A 5B1LB 2QZ6A 5FA7A 3W2ZA 5DJTA 2XSSA 5AV8C 4M4XA 4KQQA 1P3PA 4G3KA 5GT0A 2JN7A 5CP6D 5IHVA 4H9NB 4EO5C 5KSHA 4MN6A 2OLUA 5DFXA 4X23B 5DTTA 4J8UD 4QU3A 4X68A 4GW9A 3UT9C 3HL9A 5HD3A 3REIA 1EQZC 3B6GD 4NXGA 1MKMA 1QMEA 3AZKD 3W98A 4NZ3A 1PWDA 2ZM8A 1S4RA 3RELB 3CAXA 1P3MB 3OCLA 1OTEA 3ZG0A 4NE6A 5EPHA 5GT3A 4UQIS 5F69A 1P3FB 4EUZA 3B6FC 2I9VA 5AV8A 2J3TD 5DNND 1I2WA 1S66L 2QMIA 3F1OB 4Z2GA 1TDGA 3UT9A 3NECA 2XFTA 4BL3A 2Y2NA 1EQZA 1LI9A 2VGLS 4IUKA 3E0YA 3G2ZA 4ETZA 3TU4B 3DWZA 4XUXA 4EWFA 1CK7A 5AY8B 1UR8A 5HAIA 1TS6A 3EPKA 3N3FA 2B95A 4HQAA 2B18A 5GLCA 5CPJD 5E5AA 4GB7A 1ZLAD 1KU5A 5AV5D 4M3KA 4ZUXC 3C4PA 4MBKA 3IX3A 4IEDA 3VE4A 4EXOA 1OT6A 3SH7A 2XGNA 2GNXA 3WAAC 3MGSA 1U35D 3MGQD 2W27A 3FKEA 2AROC 4HOIA 4IJFA 5AVCD 1P3AB 1CF0A 2QYBA 3OPPA 2V20A 4KZ5A 2XD1A 4O8GA 3X1UB 1AOIB 3T4SA 4CLCE 3NY4A 4GD8A 2NZDC 4FCFA 1MWUA 3PXPA 4ZRRA 5B32C 1OTAA 3FZCA 4WZ5C 2Y2KA 4JGQA 3AV1D 5GHXA 2M7UA 2PYOC 3UPPA 3AZJC 4E04A 2W1RA 3UTAB 3ZCZA 3BFCA 2AROA 3VP0A 3EPLA 2PYPA 5IU1A 4Z66A 5HWWA 3IF5A 3LELD 3SS4A 5TGFA 5HFOA 3E98A 3FV7A 1XPBA 3HLGA 4J8WC 1OTDA 1TEMA 4JGOA 3OC2A 5B40B 5F6AA 4EBLA 1PWCA 5CXWA 3W97B 2CV5A 3BEBA 4QNLA 4WZ5A 2PYOA 1ID3B 4Y2FA 1H3QA 1XXMA 5B0YD 4H6JA 5GHYA 3PBRA 3VMAA 1GA0A 3HUMA 1BTLA 4KZ4A 4S2LA 4G92C 3EG5B 3MVDD 2BTFP 5B31D 3C1BD 1DP9A 3C1CC 4UA9A 3AZLA 4E3KA 4IBJA 1NLYA 3W99B 1XJ4A 4J8WA 2W3HA 4OQ0A 4H9SA 1FQGA 1HVBA 4KZ7A 2Z6DA 2VJWA 5HL6A 4KUDC 4OJ6A 2HIOD 4QLCC 3REJC 4HGAC 1BH9B 4KG6A 2DRWA 1OJ5A 4AFIA 3X1SC 3NCKA 3Q7VA 3W96B 3ZVWA 3V9RA 4NY2A 4I38A 5CPKC 3AZFA 4QY5A 3LJAD 4LV0A 3QNCA 4JJNB 4LD9B 1L0GA 3WS1A 2F8NK 1X0OA 5M19A 4KUDA 2L5AA 4OP5A 2L4RA 4G3WA 2EX2A 4LRYC 4Z2MG 3AV2C 3WS0A 4N92A 3SOIA 1KS0A 3KWQB 1VETA 2IO5C 2KDKA 2MJ6A 3OBFA 4BL2A 5M1AA 5B33B 3X1SA 3MGRD 4DMZA 1ES3A 2J9PA 3IH8A 1D1JA 5GSUB 4DRBA 1E6RA 3VP2A 1VM1A 3B0CW 4WELA 4Y5FA 5EM0A 2W3FA 4P87A 4IBEA 1FCMA 1NY0A 3LZ1C 1KX4B 1JWPA 2Y4AA 1RGZA 2ZM0A 4FSFA 4CAYB 3B0DB 1HQ3A 3AV2A 3T1QB 4J8XD 4NEED 4KZ8A 3MFXA 3VP1A 3KXBB 1LL8A 4ARZB 3WS2A 1TS0A 1MWSA 2JBFA 1ERQA 3Q82A 1TZYC 1S32B 1ONGA 3LR0A 5TBMA 1P3BA 2JKTM 3N8RA 4XZQA 3PBTA 2IWDA 3LYXA 5FQMA 3MQ0A 1MBLA 2Y2OA 3SZTA 3X1TB 3LZ1A 4HIAA 5B2ID 4L9GA 3C4OA 5CPIC 4IBKA 2UV0E 5JA4B 1A7WA 4YS3C 1PRQA 1JFIB 1P34C 3LZ0B 1P3LB 5E2FA 1N1JA 3QNBA 3VP3A 3AZHB 3LUQA 2R9WA 3L27A 3TRCA 1F66C 4X1MA 3A6NA 1GA9A 4Z2JA 1VEUB 3QP6A 2EX9A 5DKLA 2ZLYA 3D72A 5HL1A 1DRMA 4QPRA 3SW1A 3MNNA 4RQ9A 2HUEC 2RIQA 4R8PC 3C5AA 4PM9A 1FCNA 3AZGD 1P3KD 1MY8A 1TS7A 3NBLA 3PBOA 1E3UA 3AZNC 4HH3A 1P34A 2Q9MA 3CZDA 1DJBA 1YT4A 4JF6A 4R38A 5EOEA 3ZNYA 3P98A 4DXCA 3WD4A 2VZWA 1PDCA 2C5WB 2VV8A 5BNXA 4GJ4A 5EVEA 2ZL1A 3AZID 5GXQB 3AGFA 2ZQDA 3WWXA 1W63Q 4L0LA 2XR0A 3JPUA 4WMCA 3E2KA 3KX0X 3WA9C 1H8PA 4OLGA 4R8PA 3VE3A 4GNUA 2O99A 3MZDA 4WNNB 3T4TA 5KSCA 4R3BA 3AZNA 1BULA 3REHA 4KHAA 5E2EA 4O01A 1K56A 3UE3A 2FN2A 4KZBA 4HJ4A 4ID4A 5E43A 1T18A 2D02A 2RCXA 4B4XA 4MLLA 1TAFB 1NJ4A 5GLBA 3L9KA 4H9PA 2QJ7A 1J9MA 1M18C 3AFAC 1KE4A 1GHIA 2GX5A 5G4YA 3PTEA 4KGCB 4S2PA 2IA2A 4RVAA 5DFYA 5L10A 3V3SA 2WKPA 1KVMA 3K3CA 1K57A 2IWCA 3REKB 1FR6A 3CLOA 4H9QB 3H0RC 4WU9C 5F99D 2KX6A 3BFDA 1FOFA 2A24A 5F83A 3MGPD 2EA9A 5FUGA 3WKJD 4P6ZS 3O62D 1YLWA 2WGWA 1ESIA 4OPYA 4MB3A 1P3GD 5A92A 4YM6C 3MQOA 1P3PB 5GT0B 1KX5B 1DJCA 2H5SA 1JVJA 1NRJA 3HJIA 4WU9A 3LEQA 5FQIA 3GVBA 5HARA 5B1MA 3UO9A 5BPVA 3WTPE 3KUYC 4OOMA 1RCJA 3W98B 4J8VD 1XKZA 2D01A 4UQIM 3P7NA 3DTMA 4KQRA 3JVVA 5GT3B 1GOIA 2K2NA 3BY9A 3C7VA 1ONHA 1T1AA 4E44A 3DTIA 2F8NG 5AV8B 4ETXA 2VV7A 3AZMD 2Y2HA 4EO5B 2GDNA 1WWIA 2FJ7C 4CLCD 3HBRA 2PU4A 3MXRA 4PPRA 1P3IC 3UT9B 5B2JD 3FDDA 3UTBC 1P3OA 1K0KA 3IXDA 2I72A 1EQZB 3K3DA 3KUYA 4NE3A 2XA7S 3B0DC 2J80A 3AYWC 2PD8A 3KYEA 4B88A 5FEFA 4GZBA 2BYKA 1L6JA 3IF6A 5B1LD 5CP6A 1NYYA 3PAGA 2GJ3A 3B6FB 5E2HA 4GHAA 4J8UA 5HWVA 4Y0OA 3IHBA 5I94A 1Q2QA 3KSIA 2BLSA 3B6GA 4X23D 3AZKA 3KS4A 3IXGA 4D60A 4JKTA 5EOOA 1H0GA 4DDYA 1YU3A 2VGJA 3AYWA 1FCOA 3RELD 1P3MD 4XUZA 3DTKA 3LI9A 2H0YA 2XH9A 5A90A 1P9RA 3S7PA 3HVFA 4II7A 5DNNA 3BW6A 2IOUA 1P3FD 4R23A 5FQ9A 4ME4A 1U35C 4KUKA 4IVKA 1M19C 1IKGA 3VV4A 2WGVA 4X6TA 4RX2A 1D06A 4Y7PA 4KQOA 4X1LA 5FQQA 2AROB 2OLVA 5EVIC 4Z2HA 3P01A 3MZEA 5BT1C 1YLZA 1ZLAA 5AY8D 1HZOA 4LV2A 5AV5A 5C3IC 1KGEA 1UWPX 5E2GA 2HJEA 3H82A 4MEZA 4ZJ1A 4TX8A 3W4PA 3NC8A 2NZDB 2P08A 1BUEA 1XA1A 2P7JA 3CMZA 1U35A 4C75A 1O07A 1M19A 5B32B 5AV9C 2PYOB 2WAEA 3AZJB 5AVCA 2PT7A 1XJ3A 4HMDA 3LI8A 2ZMVA 2ZY3A 4EEPA 5A8BA 5EVIA 1P3AD 5DNMC 2OWJA 3HSHA 5CHJA 1T1CA 3FG8A 3NQJB 5JYPA 3X1UD 3X1VC 4J8WB 1E4DA 1FR1A 4GOGA 3TSGA 3AV1A 5GLAA 3HCYA 5CECA 2V1BA 2Y79A 2Y55A 3T50A 4Q0IA 3UTAD 4G92B 2PU2A 3KSGA 4UPKA 5DNMA 1LSXA 3OOVA 3C1CB 4IJEA 1M1AC 4K91A 3UB5P 3BFEA 1PZOA 3W4QA 4JXSA 2OSUA 5B40D 3IP4C 1T3UA 5B0YA 1Z6FA 3N6IA 5FDSA 4S2MA 4KUDB 3W97D 4QLCB 3REJB 1BLHA 4HGAB 3MVDA 1ID3D 1IYQA 1KE3A 4G3VA 5B31A 4PMAA 4S2NC 3X1SB 2G2WA 2G5HC 2XD5A 3IXBA 4RYEA 4WUJA 1EWZA 1W1VA 4HJ6A 2ACGA 2VLGA 3MR0A 5EUAA 2W0NA 4GDNA 3F6TA 5CPKB 5TFQA 3W99D 2HIOA 3VOYA 2HPBA 4DE1A 3LY3A 5EECA 3MKFA 3REIC 1SDEA 2ZY4A 5KIZA 3BQAA 3H7WA 5DTKA 4LG2A 1HQ3B 3AV2B 3MGRC 4HHDA 2F8NH 3LGOA 2HDUA 3FKVA 5AVFA 5HPIA 4NKPA 3UDXA 3W96D 1T1BA 4Z5TC 4E3OA 2L0WA 4I3JA 4BBVA 3QP5A 1WYCA 4XZQB 3M6BA 4JJND 4LD9D 3ZYTA 3IS2B 2V0WA 1IOUA 4J8XC 3LZ1B 3MKEA 1Y28A 2OV5A 1FIKA 5TR7A 4ZBJC 3MGRA 3VFHA 3KWQD 1VQQA 4JPMA 3W8KA 2YKHA 4NZ1A 1YPRA 3IT9A 4S2JA 5B33D 3M7PA 1N1JB 5E5AC 2V0UA 3T4KA 1TZYB 3G34A 5AV6C 5FAQA 1YMXA 4Z5TA 2A3UA 1G5UA 5GSUD 3A6NB 1NZOA 1OTBA 3DW0A 3EOIA 3MGSC 5JRGD 2WKHA 5J4EA 2QKPA 5CERA 1F98A 1B67A 4UHUA 4EQIA 4IBCA 4GKUA 1Y54A 4WU8D 4J8XA 1EW0A 1KX4D 4H9RB 1GCEA 5CPIB 1L0EA 1WA9A 2WAFA 3C7UA 4LCMA 4YS3B 1SCWA 3AL0C 4BLMA 4L9FA 4FH4A 5GLDA 3UMEA 3KXBD 3TW8A 1P34B 4PM5A 2WKEA 4NFTA 4JBFA 3OPHA 1GSVA 3E4QA 5AV6A 1S32D 3HJKA 1F66B 2H10A 1ZTUA 4GS9B 5B0ZC 3UE1A 5B2IA 1BH8A 3OPRA 1TDLA 2FFYA 5CGXA 5C5KA 1ALQA 1W79A 5DF8A 1ES2A 3EEHA 2HUEB 5BNVA 3X1TD 1LI0A 3S4XA 4Z66C 3R7WA 2FH5A 4R8PB 1AIWA 1SKOB 4ZBEA 1XGIA 3AZNB 1LSVA 3LZ0D 1P3LD 2G2UA 1BLCA 4KHAB 3MQQA 4I3AA 4LRZE 3QP4A 3AZHD 4OONA 1HLUP 3UY6A 3L7HA 2CV5C 4OJOA 1L0FA 2DNSA 2QHKA 3OZHA 5L07A 5B0ZA 4R4SA 3EGDC 2V1ZA 1W2EA 5AJGA 3OLOA 3AN2D 3HONA 2X71A 1P3KA 3WTPD 3WA9B 2Y91A 3VH6T 4L9EA 3AZLC 2JSSA 1XA7A 3V50A 1QO6A 4H9SC 2P9VA 3AZIA 5EE8A 3ITBA 4Z9QA 4LV3A 1P0ZA 1L3LA 1DP6A 4WZ4A 5B31G 5GXQD 3B33A 1M18B 3AFAB 1YKDA 2ZQ7A 3M6HA 4WEJA 4MN5A 3LR3A 2O9CA 4OJ5A 4MBHA 4E6XA 5L09A 3AZFC 1E15A 4WU9B 1YU0A 1RP5A 5D3OA 4S2IA 4FD8A 4OJLA 5HPFA 4PHTA 2PR5A 4OH0A 3MF0A 2AVXA 4OOYA 2WGIA 3F1PA 3F1NA 3ISGA 2BASA 2VA0A 1ESUA 4KGCD 2VKSA 1OJGA 3G32A 1J7MA 3IQAA 4YM6B 4ZJ3A 5F99A 3REKD 3CUEA 5DF9A 5FQKA 2JE5A 3A1KA 2M1CA 3AGEA 3W4OA 3O62A 4E3LA 2XA7M 5CTMA 3V3RA 5EM1A 1FILA 3KUYB 2GZAA 1HQ3C 1P3GA 5CHLB 2BYKB 1KX3C 3FC7A 4R3AA 2EX8A 5FQJA 1N9OA 3HLEA 3ULFA 2DMWA 3UDIA 4CLCC 1P3PD 5GT0D 1KX5D 5B2JC 1P3BC 1EAKA 4XZQC 2FJ7B 2HP9A 4PM7A 3BLSA 1P3IB 4J8VA 3UTBB 4NXBA 1IYPA 3CWFA 3G2YA 1F1EA 5AVBC 4OUIA 4K08A 4PM6A 5FASA 3W98D 3AYWB 4IBIA 1OMEA 1KX3A 1GHMA 5GT3D 2F2AC 5GL9A 3UE6A 1XX2A 2VV6A 1M6KA 2F8NA 5AV8D 1K38A 4JXVA 4CLCA 4B4ZA 3A6NC 5FAPA 5B2JA 3NDGA 4Y0UA 1GHPA 5DJUA 2XK1A 4X55A 5DVAA 1STZA 1F2KA 4NK3A 3UT9D 2IWBA 3MNNC 4F3LB 1EQZD 5M18A 1XP4A 5AVBA 1F9IA 1W1TA 4HBTA 3NOTC 2JC7A 3UB8A 4OLDA 1K55A 5B24C 2E8JA 4MCWA 4KENB 3H82B 4ZJ2A 4OKPA 2A2LA 2V9AA 4H9NA 3T12B 1GSXA 4E45A 3B6FD 4EETB 1U35B 1E8BA 2X02A 3LY4A 1M19B 1N9LA 2NQBC 5AVCB 2RTSA 2J9OA 2JKTI 1K54C 4D2OA 3PHYA 1KDSA 1TF1A 4XT2B 1Y4OA 1P3MA 5EVIB 1NXYA 3BQ8A 3NULA 2ZJ9A 3OCNA 3S7NA 2PR6A 4IBFA 2WYXA 2Y2IA 5C3IB 5B24A 4MMNA 3REHC 2O0YA 4WV4B 4P85A 4HJ3A 3R45A 3MSHA 2HV1A 3M2JA 1JTGA 4ZUXD 2WUQA 5AV9B 2NQBA 3GECA 2J8PA 4IBGA 3KSHA 3WAAD 1K54A 3T4JA 1DJAA 1NYMA 1K4FA 3UMDA 3L29A 4E3MA 2AROD 5AY8A 3LFVA 5DNMB 2CMNA 4OOLA 1K57C 2ZMFA 4XXRA 1RGYA 3KYQA 2OOLA 5HX9A 1O6IA 4HH2A 3A1IA 3RJUA 2ZC6B 3GQZA 3X1VB 4HMCA 4JGPA 1ACFA 4XUJC 2NZDD 1NRFA 2Z2MB 3AGDA 2XRNA 3PBNA 1YU1A 5B32D 2KLIA 1HD8A 3AZJD 3U2AA 3T1SA 2EWWA 3ZG5A 1PZPA 4LPZA 2NUPC 1LHYA 3AZEC 3BLMA 3M2KA 3H0LC 3BRMA 3X1UA 1IYOA 2WZXA 4Q8IA 4DQYB 1M1AB 3QHYA 3RH8B 2PYRA 4H9OA 3D3OA 4XUJA 4WYYA 3CPTB 5B1MC 2Y2LA 4K0XA 2UWXA 3H7WB 3WD1A 4Z2IA 5FAOA 4CSRA 3Q81A 5FI2A 5CEBA 2ZQCA 4X53A 4LFUA 3AZEA 1H0IA 1ODVA 1H8ZA 3IX8A 2ZQ8A 4X56A 1W1YA 1UWNX 1SKFA 3A3JA 3C1CD 1F5MA 3MZFA 5B40A 4Z2KA 2PBDP 1TD5A 2ZBBA 3TJZC 3ZG9B 1W63M 3ZHHA 4OJPA 3MXSA 1P3OC 2P04A 4IHQA 1ID3A 2LB9A 1XFNA 2DF4C 3REIB 1V9ZA 2V1AA 4WF0A 4KUDD 1EROA 4QLCD 3REJD 3MS6A 1SDNA 3EQVA 5FL3A 3MGRB 1N9NA 4MN7A 3IF6C 1LSWA 3O3VA 5CP6C 4UUZA 2RL3A 1ZHHB 3X1SD 4Z5TB 4J8UC 3IWQA 4CJNA 1E25A 5AQBA 5CPKD 4DRAA 4WEKA 3B6GC 5CHUA 2VGLM 3AZKC 1K4EA 1S1ZA 1BH9A 4I5SA 3LO7A 4J8XB 4OVDA 2JCHA 2P74A 4HEFA 3AV2D 4ZBJB 4WM9A 1KGFA 2QWSA 3W96A 4IJGA 2OAQ1 5CTNA 3BFFA 2J3TC 4H8RA 5FI7A 1MWRA 5DNNC 4BD1A 4IBRA 4HI4A 3PBQA 5E5AB 2ZD8A 3WD3A 5AV6B 3IXHA 5JRGC 4JJNA 3T4OA 2W1TA 3WX7A 3MGSB 1Q9CA 3CJMA 2ZC5B 5G49A 4EBPA 5BNVB 3LZ1D 2BYMA 3HLBA 1MKIA 5B33A 5CPJC 1ZLAC 1Z09A 2WZZA 5AV5C 3HLFA 1S4SA 4KG5A 4EV4A 2OWHA 1CI9A 4DXBA 1BSGA 5KMWA 2RVQD 1KE0A 1TZYD 3A0RA 5JRGA 2PBYA 3MGQC 3UN7A 4WU8A 4UA7A 5B0ZB 3EPJA 5AVCC 1H5XA 4BWIA 3NJAA 3LIDA 1W8YA 2JKRM 1U60A 3A0VA 2V8CA 1WWSA 4IBDA 4Z66B 3DAVA 3KXBA 4WLAA 4ARZA 5CPID 2ZC4B 4NYUA 1MC0A 5FDHA 4YS3D 3TU4D 5CPJA 2QJ5A 1SZVA 1S32A 4F94A 1IYSA 3FWLA 1P34D 4QHCA 1CEFA 4MBFA 2P9VB 3BM6A 4N1XA 3AV1C 2JHEA 4N1HA 1F66D 3MGQA 2CV5B 3AN2C 4H6JB 3WTPC 3V5MA 3ZDJA 3LELC 2W3GA 3DWKA 3VSKA 4WMCD 3KSYA 5KDMA 4NZ4A 3L25A 2JKRI 5KZHA 1KOUA 4R8PD 1OGBA 3LZ0A 3AZLB 1W1PA 3BWLA 3T4QA 3O87A 4DF6A 3AZHA 3AZND 1AOID 3IWIA 5B0YC 1YLPA 4NXEA 4OQHA 3AN2A 3MVDC 1HTAA 3GTCA 3WTPA 5B31C 5EFWA 4WN5A 3C1BC 3F1PB 4HY8A 4Q0JA 3LELA 3TOIA 4R0QA 4EU0A 3Q7VB 4KUOA 5EVLA 1L2SA 3V9RB 3WA9D 2PD7A 4K0WA 1R4VA 2Q0OA 3HUOA 3AZFB 2HIOC 3KSFA 3L26A 1WYBA 2M7VA 2W8SA 5HAPA 4EW7A 1MPLA 2R9XA 3VH6A 3WD2A 4KZ3A 1VETB 1M18D 3AFAD 3C1BA 3G35A 4WNNA 5U47A 4JXWA 2ZC3B 5MC7A 3N4IA 3EWKA 3LJAC 5A93A 4QY6A 3U4LP 5CGSA 2ZM2A 4NYYA 1PI4A 2HF6A 4IVIA 5HDDA 4WU9D 1MXOA 5TJJA 3B0BA 2Y2PA 4FH2A 2HP5A 4U3TA 1NZUA 4Y0TA 3Q07A 3RTYA 2EXBA 1YLJA 4KGCA 2VQRA 1B6WA 1D7EA 1KX3B 4JLFA 1C3BA 3BY8A 4DRTA 3QP1A 1CXWA 1ZC2A 4YM6D 3LJAA 2F8NB 1G68A 3LEZA 4YINA 4DKIA 4CLCB 1G6OA 3E4PA 5B2JB 4CPKA 1YU2A 5TBMB 1P3BB 5K5BA 3IBRA 2EXAA 1CI8A 2ZMAA 4UEYA 2A49A 5G4ZA 5AVBB 3LICA 3KUYD 3A3IA 3NI9A 3BYDA 3VOZA 3UNWA 2ZY2A 4QJGA 1KX5A 3CHWP 5JYOA 2V5OA 2DQNC 1AXBA 4Z1WA 5CHMA 3FYZA 3T4LA 3B0CT 3S22A 4R1GA 2FJ7D 5B2IC 1YUEA 3O5YA 2XDMA 4EERA 1P3ID 3UTBD 2J8YA 1E6PA 4AWLC 3MNNB 1P97A 3V39A 3KO6A 1GPFA 3MJQA 1N9BA 3AYWD 1BFMA 4YNRA 3NDEA 4Z2LA 1CEGA 2Y2QA 5B24B 1ES5A 1TVFA 2K7SA 3ICYA 1PNEA 2PDRA 4E3IA 3NOUC 1PI5A 3R45B 2ZOIA 4WZSB 4HNBA 1JWVA 3L28A 3PBSA 2NQBB 5BNXB 4LGWA 2ZL1B 1JNUA 4MB5A 1P9WA 3G30A 4ESPA 3AZGC 1P3KC 2LB5A 4ZAMA 3B47A 5J3WA 2YFWA 3B6FA 1SHVA 4BMWA 3REHB 2J3WA 3P5JB 3AZIC 3WRTA 1M19D 5HDCA 1IKIA 3G31A 4H9PB 4KZ9A 1OT9A 3RFBA 1OGGA 4HMEA 3SS3A 3H0MC 2BG1A 3AZGA 5EVID 4HBUA 2EFXA 2PHYA 2Y8HA 5BT1D 1BLPA 4GDBA 4ZUXA 3HLWA 4U0TA 4H9OB 2INWA 2WKQA 2Z2LB 3WS5A 4XUJB 2HJ9C 1LL5A 4P6ZM 3WAAA 2A24B 3TE8A 5BO0A 4LV1A 5FUGB 2G7UA 5AV9D 4UAAA 2WGWB 1FSWA 4CSRB 4EESA 4G91C 3MQLA 3AZEB 2H28A 3SH8A 5DNMD 3G6OA 4GLQA 1W8QA 4PKYG 3TG9A 5F99C 5F1FA 2NZDA 3CUEC 4QD4A 3MGPC 3X1VD 4Y3IA 3WKJC 5B32A 3O62C 3AZJA 5B1MB 4BQMA 1MWTA
chains in the Genus database with same CATH topology
4E3JA 1P3GC 4UA6A 3NQUA 4S2KA 1JTDA 1S0WA 3VH5T 4UUZB 1PW1A 3NQJA 3HUNA 4BJPA 1M1AD 3MGPA 3WKJA 4J8VC 1P3OB 4QB8A 1O7EA 4OQGA 4P6BA 5HW3A 2YFVA 4EBNA 2HP6A 3AZMC 3IF6B 3C1CA 4PM8A 1H3OA 5CP6B 3IH9A 1BLSA 4ZDXA 1KGGA 4J8UB 5DF7A 3G4PA 3RXXA 3B6GB 3SH9A 4QLCA 3REJA 3AZKB 1W5DA 5G49B 1KDWA 5G18A 3REID 2BYMB 4IBBA 2J7VA 5B1LC 3UPNA 1K55C 2ZQ9A 3AZMA 5DNNB 2ZM5A 5CPKA 4Z5TD 4X23C 3O86A 5JRGB 4WU8B 1ZKJA 5AQ9A 1QMFA 4U0XA 3S1YA 3ZG7B 2Y2GA 4BENA 3RELC 1P3MC 3KS8A 2ZC7A 5DTSA 5AQ7A 2HDSA 5B1LA 5CPJB 1P3FC 4MNRA 1ZLAB 2RVQC 5AV5B 5E5AD 5AV6D 3CG5A 1LL9A 3E2LA 4X23A 1ES4A 3MGQB 1KVLA 3GMWA 3MGSD 4BD0A 4NZ5A 4GH9A 1BT5A 2Q9NA 4GHLA 3RELA 3TU4C 5AY8C 3MFDA 5KDMB 1P3FA 1TZYA 3HREA 5F82A 3AV1B 1IELA 3WRZA 1FSYA 3RXWA 2ZY5A 3AN2B 5B0ZD 1P3AC 3I7JA 3WTPB 3LCEA 4H9RA 5HAQA 5CPIA 5FI6A 3LELB 4YS3A 3TU4A 3VH6W 4Z66D 3X1UC 1L0DA 1AOIC 1S6RA 1BZAA 2Y2MA 3BECA 4HESA 1ULYA 1F66A 5AQAA 5B32G 3GV9A 5B0YB 3Q1FA 3UTAC 2CV5D 1W7FA 4NETA 3MVDB 2PYOD 1ZG6A 1P3AA 5B31B 3C1BB 1Q2PA 1AOIA 3OPLA 5B40C 3AZLD 3W97C 4J8WD 2HIOB 3ZVTA 1ID3C 1IEMA 3GRJA 5FATA 3UTAA 4C3QA 3A3FA 2XLNA 2WKIA 3A3DA 3ITAA 3WA9A 5F1GA 3VH5W 4OPRA 4RA7A 2Y2JA 3LJAB 3W99C 4DDSA 1PIOA 3AZFD 5BOHA 3W97A 2XFSA 4N9KA 4LENA 3ZG8B 4WJ3C 3MBZA 4A5RA 1M18A 3AFAA 1PWGA 3VFFA 5J8XA 3W96C 3SS5A 5BS7C 4N9LA 4KG2A 1YMSA 3W99A 4JJNC 4LD9C 2VGKA 1ERMA 4Z2MH 4NE5A 3L2AA 5CRFA 4OP8A 3KWQC 1YU4A 3FKWA 1YM1A 1HQ3D 5B33C 3KFUG 4DE0A 3ZGAB 2XQZA 4JF5A 4YM6A 1KX3D 5BS7A 1YLTA 3ZFZA 5GSUC 2QPNA 2F8ND 3EPHA 2XEPA 4LD9A 2B5RA 2DCFA 5L2FA 1P3BD 4WU8C 4XZQD 3GSGA 1KX4C 5B2IB 1BH8B 2HDRA 3IWOA 3Q7ZA 4IBXA 3B3XA 4AWLB 3KWQA 5AVBD 3JYIA 3KXBC 4X69A 3IHAA 2YFWB 1S32C 3O88A 5GSUA 5GHZA 2FJ7A 4GN2A 3VSLA 3UPOA 1P3IA 3A6ND 3UTBA 1N4OA 3X1TC 5CEDA 1KX4A 2XF3A 3EQUA 3WS4A 2Y59A 4CAYA 3HLDA 3MNND 3AZGB 1P3KB 3N8LA 2CWEA 3LZ0C 1P3LC 4C6YA 4OQIA 3AZHC 5B24D 1E3UD 3D4FA 4DE2A 4ZUXB 3P09A 1LLBA 3GR2A 4O7DA 3AZIB 3WAAB 1K25A 5BO0B 2NQBD 3X1TA 5JA4A 4OPZA 4RX3A 4YFMA 4E6WA 1JFIA 1P3LA 4ZTKA 3A3EA 4GD6A 3REHD 1YQSA 2WADA 4JF4A 4R3JA 1K56D 1K6RA 5GXQC 2EX6A 4DE3A 3NQUB 4R4RA 4P0MA 3N7WA 1G6AA 4G91B 1ZG4A 1I2SA 4WBGA 3HLCA 5F99B 2LY8A 2CC1A 1I5QA 3MGPB 1JWZA 3VP4A 3WKJB 5AV9A 3O62B 4XUJD 5GXQA 1DY6A 2V2FF 2X01A 1Z2CB 1P3GB 4KGCC 2HDQA 2FFFB 3ZNTA 2YFVB 3BFGA 3AZED 1H3OB 3REKC 1EI5A 3NIAA 2ZQAA 4S2OA 1YLYA 3X1VA 4KZ6A 4M6BA 5CGWA 1WE4A 3N8SA 1TAFA 4J8VB 5B1MD 4LCLA 1PZRA 1PYYA 2C6WB 3AZMB 1P3PC 5GT0C 1KX5C 2G5IC 3REKA 1M1AA 1M40A 4H9QA 3UDFA 4OPQA 4E3NA 1HTZA 2E8IA 1CK3A 5A91A 1K6SA 2WK0A 1PW8A 1H8YA 2EFUA 4JXGA 3UE0A 3W98C 1P3OD 4KZAA 2H0TA 3PAEA 4S2NA 5GT3C 3VH5A 2IO5B 1XGJA 5FSRA 5B1LB 2QZ6A 5FA7A 5AV8C 4KQQA 1P3PA 5GT0A 5CP6D 5IHVA 4H9NB 4EO5C 5KSHA 2OLUA 4X23B 5DTTA 4J8UD 4QU3A 4X68A 3UT9C 3HL9A 3REIA 1EQZC 3B6GD 1QMEA 3AZKD 3W98A 4NZ3A 1PWDA 2ZM8A 3RELB 1P3MB 3OCLA 3ZG0A 4NE6A 5EPHA 5GT3A 1P3FB 4EUZA 3B6FC 5AV8A 5DNND 1I2WA 2QMIA 1TDGA 3UT9A 4BL3A 2XFTA 2Y2NA 1EQZA 1LI9A 3G2ZA 3TU4B 3DWZA 4XUXA 4EWFA 5AY8B 5HAIA 3EPKA 3N3FA 5GLCA 5CPJD 5E5AA 4GB7A 1ZLAD 1KU5A 5AV5D 4M3KA 4ZUXC 3C4PA 4MBKA 4IEDA 3SH7A 2XGNA 3WAAC 3MGSA 1U35D 3MGQD 3FKEA 2AROC 4IJFA 5AVCD 1P3AB 3OPPA 2V20A 4KZ5A 2XD1A 3X1UB 1AOIB 3NY4A 4GD8A 2NZDC 4FCFA 1MWUA 5B32C 3FZCA 4WZ5C 2Y2KA 5GHXA 3AV1D 3UPPA 2PYOC 3AZJC 3UTAB 3ZCZA 3BFCA 2AROA 3VP0A 3EPLA 4Z66A 3IF5A 3LELD 3SS4A 5TGFA 5HFOA 3FV7A 1XPBA 3HLGA 4J8WC 1TEMA 3OC2A 5B40B 4EBLA 1PWCA 5CXWA 3W97B 2CV5A 3BEBA 4QNLA 4WZ5A 2PYOA 1ID3B 1XXMA 5B0YD 5GHYA 3VMAA 3PBRA 1GA0A 3HUMA 1BTLA 4KZ4A 4S2LA 4G92C 3EG5B 3MVDD 5B31D 3C1BD 3C1CC 4UA9A 3AZLA 4E3KA 4IBJA 3W99B 4OQ0A 4J8WA 4H9SA 1FQGA 1HVBA 4KZ7A 4KUDC 4OJ6A 2HIOD 4QLCC 3REJC 4HGAC 1BH9B 4KG6A 2DRWA 3X1SC 3NCKA 3Q7VA 3W96B 3ZVWA 3V9RA 4NY2A 5CPKC 3AZFA 4QY5A 3LJAD 4LV0A 3QNCA 4JJNB 4LD9B 1L0GA 3WS1A 2F8NK 5M19A 4KUDA 2L5AA 4OP5A 2EX2A 4Z2MG 3AV2C 3WS0A 4N92A 3SOIA 3KWQB 4BL2A 2IO5C 5M1AA 5B33B 3X1SA 3MGRD 1ES3A 2J9PA 3IH8A 5GSUB 4DRBA 3VP2A 1VM1A 3B0CW 4WELA 4P87A 4IBEA 1FCMA 1NY0A 3LZ1C 1KX4B 1JWPA 2Y4AA 1RGZA 2ZM0A 4FSFA 4CAYB 3B0DB 1HQ3A 3AV2A 4J8XD 4KZ8A 3VP1A 3KXBB 3WS2A 1MWSA 2JBFA 1ERQA 3Q82A 1TZYC 1S32B 1ONGA 1P3BA 3N8RA 4XZQA 3PBTA 2IWDA 5FQMA 1MBLA 2Y2OA 3X1TB 3LZ1A 5B2ID 3C4OA 5CPIC 4IBKA 5JA4B 1A7WA 4YS3C 1JFIB 1P34C 3LZ0B 1P3LB 5E2FA 1N1JA 3QNBA 3VP3A 3AZHB 2R9WA 3L27A 1F66C 3A6NA 1GA9A 2EX9A 2ZLYA 5HL1A 3MNNA 2HUEC 2RIQA 4R8PC 3C5AA 4PM9A 1FCNA 3AZGD 1P3KD 1MY8A 3NBLA 3PBOA 1E3UA 3AZNC 1P34A 2Q9MA 3CZDA 1DJBA 1YT4A 4JF6A 5EOEA 3ZNYA 3P98A 4DXCA 2C5WB 5BNXA 3AZID 5GXQB 3AGFA 2ZQDA 3WWXA 4L0LA 2XR0A 4WMCA 3E2KA 3WA9C 4OLGA 4R8PA 4GNUA 3MZDA 4WNNB 5KSCA 4R3BA 3AZNA 1BULA 3REHA 4KHAA 5E2EA 3UE3A 1K56A 4KZBA 4ID4A 5E43A 2RCXA 4B4XA 4MLLA 1TAFB 1NJ4A 5GLBA 4H9PA 1J9MA 1M18C 3AFAC 1KE4A 1GHIA 3PTEA 4KGCB 4S2PA 4RVAA 3V3SA 1KVMA 1K57A 2IWCA 3REKB 1FR6A 4H9QB 3H0RC 4WU9C 5F99D 3BFDA 1FOFA 5F83A 3MGPD 5FUGA 3WKJD 3O62D 1YLWA 2WGWA 1ESIA 4OPYA 1P3GD 5A92A 4YM6C 1P3PB 5GT0B 1KX5B 1DJCA 2H5SA 1JVJA 4WU9A 5FQIA 3GVBA 5HARA 5B1MA 3UO9A 5BPVA 3WTPE 3KUYC 4OOMA 1RCJA 3W98B 4J8VD 1XKZA 3DTMA 4KQRA 5GT3B 3C7VA 1ONHA 4E44A 2F8NG 5AV8B 3AZMD 2Y2HA 4EO5B 2GDNA 1WWIA 2FJ7C 3HBRA 2PU4A 3MXRA 4PPRA 1P3IC 3UT9B 5B2JD 3FDDA 3UTBC 1P3OA 3IXDA 2I72A 1EQZB 3KUYA 4NE3A 3B0DC 3AYWC 4B88A 4GZBA 2BYKA 3IF6A 5B1LD 5CP6A 1NYYA 3PAGA 3B6FB 5E2HA 4GHAA 4J8UA 4Y0OA 3IHBA 5I94A 1Q2QA 2BLSA 3B6GA 4X23D 3AZKA 3IXGA 3KS4A 4JKTA 5EOOA 4DDYA 1YU3A 2VGJA 3AYWA 1FCOA 3RELD 1P3MD 4XUZA 5A90A 2H0YA 2XH9A 3HVFA 5DNNA 2IOUA 1P3FD 4R23A 5FQ9A 1U35C 4IVKA 1M19C 1IKGA 2WGVA 4X6TA 4RX2A 4Y7PA 4KQOA 5FQQA 2AROB 2OLVA 5EVIC 3MZEA 5BT1C 1YLZA 1ZLAA 5AY8D 1HZOA 4LV2A 5AV5A 5C3IC 1KGEA 5E2GA 4MEZA 4ZJ1A 3W4PA 3NC8A 2NZDB 1BUEA 1XA1A 3CMZA 1U35A 4C75A 1O07A 1M19A 5B32B 5AV9C 2PYOB 2WAEA 3AZJB 5AVCA 2ZY3A 5EVIA 1P3AD 5DNMC 3HSHA 5CHJA 3NQJB 5JYPA 3X1UD 3X1VC 4J8WB 1E4DA 1FR1A 4GOGA 3TSGA 3AV1A 5GLAA 5CECA 2Y55A 3UTAD 4G92B 2PU2A 4UPKA 5DNMA 3C1CB 4IJEA 1M1AC 4K91A 3BFEA 1PZOA 3W4QA 4JXSA 2OSUA 5B40D 3IP4C 1T3UA 5B0YA 1Z6FA 3N6IA 4S2MA 4KUDB 3W97D 4QLCB 3REJB 1BLHA 4HGAB 3MVDA 1ID3D 1IYQA 1KE3A 5B31A 4PMAA 4S2NC 3X1SB 2G2WA 2G5HC 2XD5A 3IXBA 4RYEA 1EWZA 5EUAA 4GDNA 3F6TA 5CPKB 5TFQA 3W99D 2HIOA 3VOYA 2HPBA 4DE1A 3LY3A 5EECA 3MKFA 3REIC 1SDEA 2ZY4A 5DTKA 4LG2A 1HQ3B 3AV2B 3MGRC 2F8NH 2HDUA 3FKVA 3UDXA 3W96D 4Z5TC 4E3OA 1WYCA 4XZQB 3M6BA 4JJND 4LD9D 4J8XC 3LZ1B 3MKEA 2OV5A 5TR7A 4ZBJC 3MGRA 3VFHA 3KWQD 1VQQA 4JPMA 3W8KA 4NZ1A 4S2JA 3IT9A 5B33D 1N1JB 5E5AC 1TZYB 3G34A 5AV6C 5FAQA 1YMXA 4Z5TA 2A3UA 5GSUD 3A6NB 1NZOA 3DW0A 3MGSC 5JRGD 2WKHA 5CERA 1B67A 4UHUA 4EQIA 4IBCA 4GKUA 1Y54A 4WU8D 4J8XA 1KX4D 4H9RB 1GCEA 5CPIB 1L0EA 2WAFA 4LCMA 3C7UA 4YS3B 1SCWA 3AL0C 4BLMA 4FH4A 5GLDA 3KXBD 1P34B 4PM5A 2WKEA 4NFTA 4JBFA 3OPHA 5AV6A 1S32D 1F66B 2H10A 5B0ZC 3UE1A 5B2IA 1BH8A 3OPRA 1TDLA 2FFYA 5CGXA 1ALQA 1W79A 5DF8A 1ES2A 2HUEB 5BNVA 3X1TD 1LI0A 3S4XA 4Z66C 4R8PB 4ZBEA 1XGIA 3AZNB 3LZ0D 1P3LD 2G2UA 1BLCA 4KHAB 3AZHD 4OONA 3UY6A 2CV5C 4OJOA 1L0FA 2DNSA 3OZHA 5B0ZA 4R4SA 2V1ZA 1W2EA 3AN2D 3HONA 2X71A 1P3KA 3WTPD 3WA9B 2Y91A 3VH6T 3AZLC 2JSSA 1XA7A 3V50A 4H9SC 2P9VA 3AZIA 5EE8A 3ITBA 4Z9QA 4LV3A 4WZ4A 5B31G 5GXQD 1M18B 3AFAB 2ZQ7A 3M6HA 4WEJA 4OJ5A 4MBHA 4E6XA 3AZFC 4WU9B 1YU0A 1RP5A 5D3OA 4S2IA 4FD8A 4OJLA 4OH0A 4OOYA 2WGIA 3ISGA 1ESUA 4KGCD 3G32A 3IQAA 4YM6B 4ZJ3A 5F99A 3REKD 5DF9A 5FQKA 2JE5A 3A1KA 3AGEA 3W4OA 3O62A 4E3LA 5CTMA 3V3RA 3KUYB 1HQ3C 1P3GA 5CHLB 2BYKB 1KX3C 2EX8A 5FQJA 3HLEA 3UDIA 1P3PD 5GT0D 1KX5D 5B2JC 1P3BC 4XZQC 2FJ7B 2HP9A 4PM7A 3BLSA 1P3IB 4J8VA 3UTBB 1IYPA 3G2YA 1F1EA 5AVBC 4OUIA 4PM6A 5FASA 3W98D 3AYWB 4IBIA 1OMEA 1KX3A 1GHMA 5GT3D 2F2AC 5GL9A 1XX2A 1M6KA 2F8NA 5AV8D 1K38A 4JXVA 4B4ZA 3A6NC 5FAPA 5B2JA 3NDGA 4Y0UA 1GHPA 2XK1A 4X55A 5DVAA 4NK3A 3UT9D 2IWBA 3MNNC 1EQZD 5M18A 1XP4A 5AVBA 4HBTA 2JC7A 4OLDA 1K55A 5B24C 4KENB 4ZJ2A 4OKPA 4H9NA 4E45A 3B6FD 1U35B 2X02A 3LY4A 1M19B 2NQBC 5AVCB 2J9OA 1K54C 4D2OA 1KDSA 1P3MA 5EVIB 1NXYA 2ZJ9A 3OCNA 4IBFA 2WYXA 2Y2IA 5C3IB 5B24A 3REHC 4WV4B 4P85A 3R45A 3M2JA 1JTGA 4ZUXD 2WUQA 5AV9B 2NQBA 2J8PA 4IBGA 3WAAD 1K54A 1DJAA 1NYMA 1K4FA 3L29A 4E3MA 2AROD 5AY8A 5DNMB 4OOLA 1K57C 4XXRA 1RGYA 5HX9A 3A1IA 3RJUA 2ZC6B 3GQZA 3X1VB 4XUJC 2NZDD 1NRFA 2Z2MB 3AGDA 3PBNA 1YU1A 5B32D 1HD8A 3AZJD 3ZG5A 1PZPA 1LHYA 3AZEC 3BLMA 3M2KA 3H0LC 3BRMA 3X1UA 1IYOA 2WZXA 4Q8IA 4DQYB 1M1AB 3QHYA 4H9OA 4XUJA 4WYYA 5B1MC 2Y2LA 4K0XA 2UWXA 5FAOA 4CSRA 3Q81A 5FI2A 5CEBA 2ZQCA 4X53A 3AZEA 1H8ZA 2ZQ8A 4X56A 1SKFA 3A3JA 3C1CD 3MZFA 5B40A 3ZG9B 3ZHHA 4OJPA 3MXSA 1P3OC 1ID3A 2DF4C 3REIB 4KUDD 1EROA 4QLCD 3REJD 1SDNA 3EQVA 3MGRB 3IF6C 3O3VA 5CP6C 4UUZA 2RL3A 3X1SD 4Z5TB 4J8UC 3IWQA 4CJNA 1E25A 5AQBA 5CPKD 4DRAA 4WEKA 3B6GC 5CHUA 3AZKC 1K4EA 1BH9A 3LO7A 4J8XB 4OVDA 2JCHA 2P74A 4HEFA 3AV2D 4ZBJB 4WM9A 1KGFA 3W96A 5CTNA 3BFFA 4H8RA 5FI7A 1MWRA 5DNNC 4BD1A 4IBRA 3PBQA 5E5AB 2ZD8A 5AV6B 3IXHA 5JRGC 4JJNA 3WX7A 3MGSB 1Q9CA 3CJMA 2ZC5B 5G49A 4EBPA 5BNVB 3LZ1D 2BYMA 3HLBA 1MKIA 5B33A 5CPJC 1ZLAC 2WZZA 5AV5C 3HLFA 4KG5A 4EV4A 1CI9A 4DXBA 1BSGA 5KMWA 2RVQD 1KE0A 1TZYD 5JRGA 2PBYA 3MGQC 3UN7A 4WU8A 4UA7A 5B0ZB 3EPJA 5AVCC 1H5XA 1W8YA 1U60A 1WWSA 4IBDA 4Z66B 3KXBA 5CPID 2ZC4B 4NYUA 5FDHA 4YS3D 3TU4D 5CPJA 1S32A 4F94A 1IYSA 3FWLA 1P34D 4QHCA 1CEFA 4MBFA 2P9VB 3BM6A 4N1XA 3AV1C 4N1HA 1F66D 3MGQA 2CV5B 3AN2C 3WTPC 3V5MA 3ZDJA 3LELC 3DWKA 3VSKA 4WMCD 3KSYA 5KDMA 4NZ4A 3L25A 5KZHA 4R8PD 3LZ0A 3AZLB 3O87A 4DF6A 3AZHA 3AZND 1AOID 3IWIA 5B0YC 1YLPA 4OQHA 3AN2A 3MVDC 1HTAA 3GTCA 3WTPA 5B31C 3C1BC 3LELA 3TOIA 4R0QA 3Q7VB 5EVLA 1L2SA 3V9RB 3WA9D 4K0WA 1R4VA 3HUOA 3AZFB 2HIOC 3L26A 1WYBA 2W8SA 5HAPA 1MPLA 2R9XA 3VH6A 4KZ3A 1M18D 3AFAD 3C1BA 3G35A 4WNNA 5U47A 4JXWA 2ZC3B 3N4IA 3LJAC 5A93A 4QY6A 5CGSA 2ZM2A 4NYYA 1PI4A 4IVIA 4WU9D 1MXOA 3B0BA 2Y2PA 4FH2A 2HP5A 4U3TA 1NZUA 4Y0TA 3Q07A 2EXBA 1YLJA 4KGCA 2VQRA 1B6WA 1KX3B 4JLFA 1C3BA 4DRTA 1ZC2A 4YINA 4YM6D 3LJAA 2F8NB 1G68A 3LEZA 4DKIA 5B2JB 4CPKA 1YU2A 1P3BB 2EXAA 1CI8A 2ZMAA 2A49A 5AVBB 3KUYD 3A3IA 3NI9A 3BYDA 3VOZA 3UNWA 2ZY2A 4QJGA 1KX5A 5JYOA 2DQNC 1AXBA 5CHMA 3FYZA 3B0CT 3S22A 4R1GA 2FJ7D 5B2IC 1YUEA 2XDMA 1P3ID 3UTBD 2J8YA 4AWLC 3MNNB 3V39A 1N9BA 3AYWD 1BFMA 3NDEA 1CEGA 2Y2QA 5B24B 1ES5A 1TVFA 4E3IA 1PI5A 3R45B 4WZSB 1JWVA 3L28A 3PBSA 2NQBB 5BNXB 3G30A 3AZGC 1P3KC 4ZAMA 2YFWA 3B6FA 1SHVA 3REHB 3P5JB 3AZIC 3WRTA 1M19D 1IKIA 3G31A 4H9PB 4KZ9A 3SS3A 3H0MC 2BG1A 3AZGA 5EVID 4HBUA 2EFXA 5BT1D 1BLPA 4GDBA 4ZUXA 3HLWA 4U0TA 4H9OB 2Z2LB 3WS5A 4XUJB 1LL5A 3WAAA 5BO0A 4LV1A 5FUGB 5AV9D 4UAAA 2WGWB 1FSWA 4CSRB 4G91C 3AZEB 3SH8A 5DNMD 1W8QA 3TG9A 5F99C 5F1FA 2NZDA 4QD4A 3MGPC 3X1VD 3WKJC 5B32A 3O62C 3AZJA 5B1MB 4BQMA 1MWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFU A;  4JXG A;  3UE0 A;  4JKT A;  1K54 A;  4KZA A;  1DJA A;  1NYM A;  4E3J A;  5EOO A;  1K4F A;  4UA6 A;  4DDY A;  2H0T A;  3PAE A;  2VGJ A;  4S2N A;  4E3M A;  4S2K A;  1FCO A;  1JTD A;  1XGJ A;  5FSR A;  4XUZ A;  1S0W A;  2QZ6 A;  5FA7 A;  5A90 A;  2H0Y A;  2XH9 A;  4OOL A;  1K57 C;  3HVF A;  4XXR A;  1PW1 A;  1RGY A;  5HX9 A;  4KQQ A;  3HUN A;  3RJU A;  2ZC6 B;  3GQZ A;  4R23 A;  5FQ9 A;  5IHV A;  5KSH A;  4BJP A;  2OLU A;  4IVK A;  5DTT A;  1IKG A;  4QU3 A;  1NRF A;  2WGV A;  2Z2M B;  3AGD A;  3PBN A;  4X68 A;  4X6T A;  4RX2 A;  3HL9 A;  4Y7P A;  1HD8 A;  1QME A;  4KQO A;  4QB8 A;  1PWD A;  2ZM8 A;  5FQQ A;  2OLV A;  5EVI C;  1O7E A;  3OCL A;  4OQG A;  3ZG5 A;  1PZP A;  3ZG0 A;  4P6B A;  1LHY A;  5EPH A;  5HW3 A;  3BLM A;  3MZE A;  4EBN A;  1YLZ A;  2HP6 A;  3M2K A;  1HZO A;  3IF6 B;  4LV2 A;  3BRM A;  1KGE A;  4PM8 A;  5E2G A;  3IH9 A;  1IYO A;  2WZX A;  4EUZ A;  4Q8I A;  1BLS A;  4ZDX A;  4MEZ A;  1KGG A;  4ZJ1 A;  1I2W A;  3W4P A;  3NC8 A;  5DF7 A;  3QHY A;  1BUE A;  1XA1 A;  3CMZ A;  2QMI A;  3G4P A;  3RXX A;  4C75 A;  1O07 A;  4WYY A;  1TDG A;  4K0X A;  2Y2L A;  3SH9 A;  2WAE A;  1W5D A;  2UWX A;  4BL3 A;  2XFT A;  2Y2N A;  1LI9 A;  1KDW A;  5G18 A;  5FAO A;  3G2Z A;  2J7V A;  5EVI A;  3DWZ A;  4XUX A;  3UPN A;  4EWF A;  3Q81 A;  5FI2 A;  5CEB A;  2ZQC A;  4X53 A;  1K55 C;  5HAI A;  1H8Z A;  5CHJ A;  2ZQ9 A;  2ZQ8 A;  4X56 A;  5GLC A;  4GB7 A;  5JYP A;  1SKF A;  3A3J A;  3MZF A;  1E4D A;  1FR1 A;  4M3K A;  4GOG A;  3TSG A;  3C4P A;  3O86 A;  4MBK A;  4IED A;  5GLA A;  3ZG9 B;  3SH7 A;  3ZHH A;  2XGN A;  3MXS A;  1ZKJ A;  5CEC A;  5AQ9 A;  1QMF A;  2Y55 A;  4U0X A;  3S1Y A;  3ZG7 B;  2Y2G A;  1ERO A;  4BEN A;  1SDN A;  2ZC7 A;  3EQV A;  5DTS A;  5AQ7 A;  2PU2 A;  2HDS A;  3OPP A;  2V20 A;  3IF6 C;  4KZ5 A;  3O3V A;  2XD1 A;  4MNR A;  2RL3 A;  3NY4 A;  4GD8 A;  3IWQ A;  4K91 A;  4FCF A;  1MWU A;  3BFE A;  1PZO A;  4CJN A;  3W4Q A;  1E25 A;  3CG5 A;  1LL9 A;  2OSU A;  3E2L A;  4JXS A;  5AQB A;  4WEK A;  1ES4 A;  3FZC A;  4WZ5 C;  2Y2K A;  5GHX A;  5CHU A;  3UPP A;  1KVL A;  1Z6F A;  3N6I A;  4S2M A;  1K4E A;  3GMW A;  3ZCZ A;  3BFC A;  1BLH A;  3LO7 A;  4BD0 A;  1IYQ A;  1BT5 A;  2Q9N A;  4OVD A;  3VP0 A;  1KE3 A;  2JCH A;  4PMA A;  2P74 A;  4S2N C;  3MFD A;  4HEF A;  4WM9 A;  1KGF A;  3IF5 A;  2G2W A;  3SS4 A;  5CTN A;  5TGF A;  2XD5 A;  3BFF A;  3IXB A;  4RYE A;  4H8R A;  5FI7 A;  1EWZ A;  1MWR A;  3FV7 A;  5HFO A;  4BD1 A;  4IBR A;  1XPB A;  3HLG A;  3PBQ A;  3HRE A;  1TEM A;  2ZD8 A;  4GDN A;  5EUA A;  3IXH A;  5F82 A;  3OC2 A;  4EBL A;  5TFQ A;  1PWC A;  1IEL A;  3VOY A;  5CXW A;  2HPB A;  4DE1 A;  3BEB A;  3LY3 A;  5EEC A;  3WRZ A;  3MKF A;  4WZ5 A;  1FSY A;  3CJM A;  1SDE A;  2ZC5 B;  3RXW A;  1XXM A;  5GHY A;  3VMA A;  4EBP A;  3PBR A;  5DTK A;  1GA0 A;  3HUM A;  1BTL A;  3I7J A;  4KZ4 A;  3LCE A;  4S2L A;  5HAQ A;  5FI6 A;  3HLB A;  1MKI A;  2HDU A;  3FKV A;  2WZZ A;  1L0D A;  1S6R A;  4UA9 A;  3UDX A;  1BZA A;  3HLF A;  4KG5 A;  4EV4 A;  1CI9 A;  4E3O A;  4E3K A;  4DXB A;  2Y2M A;  1BSG A;  3BEC A;  5KMW A;  4OQ0 A;  1KE0 A;  4HES A;  1WYC A;  1FQG A;  1HVB A;  2PBY A;  5AQA A;  4KZ7 A;  3M6B A;  3UN7 A;  3GV9 A;  3Q1F A;  4UA7 A;  1H5X A;  1W7F A;  3MKE A;  4NET A;  4KG6 A;  1ZG6 A;  2DRW A;  2OV5 A;  1W8Y A;  5TR7 A;  1U60 A;  3VFH A;  1VQQ A;  4JPM A;  3W8K A;  1Q2P A;  2ZC4 B;  3NCK A;  3Q7V A;  5FDH A;  3ZVW A;  4S2J A;  3IT9 A;  4F94 A;  1IYS A;  3FWL A;  3OPL A;  3G34 A;  5FAQ A;  1YMX A;  2A3U A;  4QHC A;  4QY5 A;  1CEF A;  4MBF A;  2P9V B;  3BM6 A;  4N1X A;  4LV0 A;  1NZO A;  3QNC A;  3DW0 A;  4N1H A;  1L0G A;  3WS1 A;  3ZVT A;  2WKH A;  5CER A;  5M19 A;  1IEM A;  3GRJ A;  5FAT A;  4OP5 A;  4UHU A;  2EX2 A;  4GKU A;  3A3F A;  1Y54 A;  4C3Q A;  4EQI A;  3WS0 A;  4N92 A;  3SOI A;  2XLN A;  2WKI A;  3V5M A;  3ZDJ A;  3A3D A;  1GCE A;  1L0E A;  2WAF A;  4LCM A;  4BL2 A;  3C7U A;  3DWK A;  3ITA A;  1SCW A;  3VSK A;  4WMC D;  5KZH A;  5F1G A;  5M1A A;  4BLM A;  4OPR A;  4RA7 A;  4FH4 A;  5GLD A;  1ES3 A;  4PM5 A;  2Y2J A;  2WKE A;  2J9P A;  3O87 A;  3IH8 A;  3OPH A;  4JBF A;  4DF6 A;  4DDS A;  3VP2 A;  1VM1 A;  3IWI A;  2H10 A;  1PIO A;  4WEL A;  5BOH A;  2XFS A;  4P87 A;  4N9K A;  4LEN A;  3UE1 A;  1YLP A;  1FCM A;  1NY0 A;  3OPR A;  4OQH A;  1TDL A;  2FFY A;  5CGX A;  3ZG8 B;  1JWP A;  2Y4A A;  1ALQ A;  1W79 A;  1RGZ A;  2ZM0 A;  3MBZ A;  3GTC A;  4FSF A;  5DF8 A;  1ES2 A;  4A5R A;  1LI0 A;  1PWG A;  3VFF A;  3S4X A;  4KZ8 A;  3TOI A;  3VP1 A;  5J8X A;  4R0Q A;  4ZBE A;  3SS5 A;  3WS2 A;  4N9L A;  3Q7V B;  5EVL A;  1L2S A;  1XGI A;  1MWS A;  2JBF A;  1ERQ A;  3Q82 A;  4KG2 A;  4K0W A;  1YMS A;  1ONG A;  2G2U A;  3HUO A;  1BLC A;  2VGK A;  1ERM A;  3N8R A;  4OON A;  3UY6 A;  3PBT A;  2IWD A;  1L0F A;  5FQM A;  2DNS A;  3OZH A;  1WYB A;  1MBL A;  2Y2O A;  4R4S A;  5CRF A;  4OP8 A;  2V1Z A;  5HAP A;  3C4O A;  1MPL A;  3FKW A;  2R9X A;  2X71 A;  4KZ3 A;  1YM1 A;  4DE0 A;  2Y91 A;  3ZGA B;  2XQZ A;  3G35 A;  4JF5 A;  5U47 A;  4JXW A;  2ZC3 B;  3N4I A;  1YLT A;  3ZFZ A;  5E2F A;  3QNB A;  3VP3 A;  5A93 A;  2QPN A;  4QY6 A;  1XA7 A;  5CGS A;  3V50 A;  2ZM2 A;  2R9W A;  1PI4 A;  2P9V A;  2XEP A;  4IVI A;  1GA9 A;  2B5R A;  2DCF A;  5EE8 A;  2EX9 A;  5L2F A;  1MXO A;  3ITB A;  4Z9Q A;  2ZLY A;  3GSG A;  2Y2P A;  5HL1 A;  2HDR A;  3IWO A;  4FH2 A;  2HP5 A;  3Q7Z A;  4LV3 A;  4U3T A;  4IBX A;  1NZU A;  3B3X A;  4WZ4 A;  4Y0T A;  3Q07 A;  2EXB A;  1YLJ A;  3C5A A;  3JYI A;  4X69 A;  2ZQ7 A;  4JLF A;  4PM9 A;  1C3B A;  3M6H A;  4WEJ A;  1FCN A;  1MY8 A;  3NBL A;  3PBO A;  3IHA A;  4DRT A;  1E3U A;  3O88 A;  4MBH A;  1ZC2 A;  2Q9M A;  3CZD A;  4YIN A;  1G68 A;  3LEZ A;  4E6X A;  1DJB A;  4DKI A;  1YT4 A;  4JF6 A;  5GHZ A;  5EOE A;  4CPK A;  1RP5 A;  4GN2 A;  3P98 A;  3ZNY A;  4DXC A;  3VSL A;  2EXA A;  3UPO A;  2C5W B;  1CI8 A;  2ZMA A;  2A49 A;  1N4O A;  5D3O A;  5CED A;  4S2I A;  3WWX A;  3AGF A;  2ZQD A;  4FD8 A;  2XF3 A;  2XR0 A;  3EQU A;  2Y59 A;  4L0L A;  3WS4 A;  3HLD A;  3A3I A;  4OH0 A;  3NI9 A;  4WMC A;  3E2K A;  4OOY A;  2WGI A;  3BYD A;  3ISG A;  4OLG A;  3VOZ A;  1ESU A;  3UNW A;  3N8L A;  4GNU A;  3MZD A;  3G32 A;  5KSC A;  4QJG A;  3IQA A;  4R3B A;  4C6Y A;  4ZJ3 A;  4OQI A;  5JYO A;  1AXB A;  1BUL A;  1E3U D;  3D4F A;  3FYZ A;  5CHM A;  4DE2 A;  5E2E A;  3P09 A;  1K56 A;  5DF9 A;  1LLB A;  3UE3 A;  4KZB A;  4ID4 A;  5E43 A;  3GR2 A;  4O7D A;  2JE5 A;  3AGE A;  5FQK A;  4R1G A;  3S22 A;  3W4O A;  4BQM A;  2RCX A;  4B4X A;  4MLL A;  1K25 A;  4E3L A;  5CTM A;  1NJ4 A;  3V3R A;  5GLB A;  2XDM A;  2J8Y A;  1J9M A;  1KE4 A;  3V39 A;  1GHI A;  3PTE A;  4S2P A;  4RVA A;  4OPZ A;  1N9B A;  4RX3 A;  3V3S A;  1KVM A;  4YFM A;  3NDE A;  4E6W A;  1K57 A;  2IWC A;  1CEG A;  2EX8 A;  2Y2Q A;  5FQJ A;  3HLE A;  1ES5 A;  3A3E A;  4ZTK A;  1TVF A;  1FR6 A;  4E3I A;  3UDI A;  1PI5 A;  4GD6 A;  4JF4 A;  1YQS A;  2WAD A;  4R3J A;  2HP9 A;  1FOF A;  1JWV A;  1K56 D;  1K6R A;  3BFD A;  3BLS A;  3PBS A;  4PM7 A;  5F83 A;  1IYP A;  1YLW A;  2EX6 A;  2WGW A;  3G2Y A;  3G30 A;  1ESI A;  4DE3 A;  4PM6 A;  4R4R A;  4P0M A;  4OPY A;  3N7W A;  5FAS A;  1G6A A;  1OME A;  4ZAM A;  1GHM A;  1ZG4 A;  5A92 A;  5GL9 A;  1XX2 A;  1I2S A;  1DJC A;  2H5S A;  4WBG A;  1JVJ A;  1M6K A;  1SHV A;  3HLC A;  1K38 A;  4JXV A;  4B4Z A;  5FAP A;  2CC1 A;  3NDG A;  1I5Q A;  4Y0U A;  5FQI A;  3VP4 A;  1GHP A;  1JWZ A;  3WRT A;  3GVB A;  2XK1 A;  4X55 A;  5HAR A;  5DVA A;  3UO9 A;  4NK3 A;  1IKI A;  2IWB A;  3G31 A;  4OOM A;  1RCJ A;  1DY6 A;  1XKZ A;  4KZ9 A;  1XP4 A;  2V2F F;  5M18 A;  2X01 A;  3DTM A;  4KQR A;  4HBT A;  2JC7 A;  2HDQ A;  2FFF B;  3SS3 A;  2BG1 A;  3ZNT A;  3BFG A;  5EVI D;  4HBU A;  4OLD A;  1K55 A;  2EFX A;  3C7V A;  1ONH A;  1EI5 A;  3NIA A;  4KEN B;  2ZQA A;  4ZJ2 A;  4OKP A;  4S2O A;  2Y2H A;  1YLY A;  1BLP A;  4KZ6 A;  4GDB A;  2GDN A;  3HLW A;  4U0T A;  5CGW A;  1WE4 A;  2Z2L B;  2X02 A;  3LY4 A;  3WS5 A;  3N8S A;  3HBR A;  1LL5 A;  2PU4 A;  3MXR A;  4PPR A;  3IXD A;  4LV1 A;  2J9O A;  2I72 A;  1K54 C;  4D2O A;  1KDS A;  4UAA A;  2WGW B;  1FSW A;  4B88 A;  5EVI B;  1NXY A;  4LCL A;  4GZB A;  2ZJ9 A;  3OCN A;  1PYY A;  3SH8 A;  3IF6 A;  2WYX A;  2C6W B;  2Y2I A;  1NYY A;  1W8Q A;  3PAG A;  3TG9 A;  5E2H A;  5F1F A;  1M40 A;  4Y0O A;  3UDF A;  3IHB A;  4P85 A;  4OPQ A;  4E3N A;  4QD4 A;  1HTZ A;  2E8I A;  1CK3 A;  3M2J A;  5I94 A;  1Q2Q A;  5A91 A;  1JTG A;  2BLS A;  2WUQ A;  1K6S A;  2WK0 A;  1PW8 A;  1H8Y A;  1MWT A;  3IXG A; 
#chains in the Genus database with same CATH topology
 4X25 A;  4MDZ A;  4EEU A;  4E3J A;  1P3G C;  4UA6 A;  4GHI A;  3NQU A;  4S2K A;  1JTD A;  4FOF A;  1S0W A;  3LIA A;  1A0K A;  3EGX C;  2KOI A;  3VH5 T;  4UUZ B;  1PW1 A;  3NQJ A;  3HUN A;  4NG2 A;  5FEG A;  4BJP A;  1M1A D;  2OAP 1;  4B93 A;  5EV0 A;  3T1X A;  3MGP A;  3WKJ A;  4J8V C;  1P3O B;  5I5L A;  4LRX C;  1G28 A;  1NLZ A;  2R78 A;  4QB8 A;  4EQ1 A;  1O7E A;  4OQG A;  4P6B A;  1E6Z A;  1YSP A;  5HW3 A;  3IX4 A;  3LR4 A;  2YFV A;  4EBN A;  2HP6 A;  3AZM C;  3IF6 B;  3C1C A;  4PM8 A;  1H3O A;  5CP6 B;  3IH9 A;  1BLS A;  4ZDX A;  1KGG A;  5DKK A;  4J8U B;  5DF7 A;  1H0M A;  2W1T B;  3G4P A;  3RXX A;  2VEA A;  3B6G B;  3SH9 A;  4QLC A;  3REJ A;  3AZK B;  1W5D A;  2V8F A;  5G49 B;  1KDW A;  5G18 A;  3REI D;  2BYM B;  3ZQ5 A;  4FUW A;  4IBB A;  2O9A A;  2J7V A;  5B1L C;  3UPN A;  3LR5 A;  1K55 C;  2ZQ9 A;  3AZM A;  5DNN B;  2ZM5 A;  5CPK A;  3FPW A;  4Z5T D;  4X23 C;  3O86 A;  5JRG B;  3FPV A;  2EWV A;  2K31 A;  2NUT C;  4WU8 B;  1ZKJ A;  5AQ9 A;  1QMF A;  4U0X A;  3DBA A;  5CX7 A;  3S1Y A;  3ZG7 B;  2Y2G A;  4BEN A;  3REL C;  4O0P A;  1P3M C;  3KS8 A;  2ZC7 A;  5DTS A;  5AQ7 A;  3VOL A;  2HDS A;  5B1L A;  1VHM A;  5CPJ B;  1P3F C;  4MNR A;  1ZLA B;  2RVQ C;  4DJ3 A;  5AV5 B;  1YAX A;  1S67 L;  5E5A D;  4GCZ A;  3UB7 A;  5AV6 D;  3CG5 A;  1LL9 A;  3E2L A;  4X23 A;  4HP4 A;  1ES4 A;  3MGQ B;  3IS2 A;  1KVL A;  3GMW A;  3MGS D;  4BD0 A;  4NZ5 A;  4GH9 A;  1BT5 A;  2Q9N A;  4GHL A;  3REL A;  5L8M A;  3TU4 C;  5HSQ A;  5AY8 C;  3MFD A;  5KDM B;  1P3F A;  3MXQ A;  1TZY A;  2D49 A;  3HRE A;  5F82 A;  3UB9 A;  3AV1 B;  1IEL A;  3F1O A;  3WRZ A;  1FSY A;  3RXW A;  1VB6 A;  3EEA A;  2ZY5 A;  3AN2 B;  1OPX A;  5B0Z D;  2PAV P;  1P3A C;  3I7J A;  3WTP B;  3LCE A;  4H9R A;  5HAQ A;  5CPI A;  5FI6 A;  3LEL B;  4YS3 A;  3TU4 A;  2VX8 A;  3VH6 W;  4Z66 D;  3X1U C;  1L0D A;  1AOI C;  1S6R A;  1BZA A;  2JKG A;  4LLO B;  5HDS A;  2Y2M A;  3BEC A;  1LT0 A;  4HES A;  1ULY A;  3A0S A;  1F66 A;  2HZ5 A;  5AQA A;  4R70 A;  5B32 G;  3C30 A;  4DJ2 A;  4EUV A;  4GS9 A;  1ED7 A;  3E4O A;  5B0Y B;  3GV9 A;  3Q1F A;  3UTA C;  2FZ0 A;  2CV5 D;  1W7F A;  4NET A;  3MVD B;  2PYO D;  1ZG6 A;  1P3A A;  5IT5 A;  4Y17 A;  5B31 B;  1UR9 A;  3C1B B;  1SKO A;  1Q2P A;  4I3I A;  5HD5 A;  1AOI A;  3OPL A;  5B40 C;  3AZL D;  3W97 C;  4J8W D;  2HIO B;  3R4K A;  1BYW A;  3ZVT A;  4Y15 A;  1ID3 C;  1IEM A;  3GRJ A;  5FAT A;  3LIE A;  3UTA A;  4C3Q A;  3A3F A;  2JKF A;  1NWZ A;  2XLN A;  2WKI A;  3A3D A;  1UGU A;  3ITA A;  3WA9 A;  5F1G A;  5AVE A;  3VH5 W;  4OPR A;  4RA7 A;  1GSW A;  2Y2J A;  3LJA B;  3W99 C;  4DDS A;  1PIO A;  3AZF D;  5BOH A;  5LBR A;  3W97 A;  1XFQ A;  2XFS A;  4N9K A;  4LEN A;  3ZG8 B;  4WJ3 C;  4FTX A;  3NOP C;  3MBZ A;  4A5R A;  1M18 A;  3AFA A;  2ZOH A;  1PWG A;  3VFF A;  5J8X A;  3W96 C;  3SS5 A;  5BS7 C;  4N9L A;  3WD0 A;  1XJ2 A;  4KG2 A;  3C8C A;  1YMS A;  1AWI A;  3W99 A;  4JJN C;  4LD9 C;  2VGK A;  1ERM A;  2XRO A;  4Z2M H;  4NE5 A;  3L2A A;  4IUH A;  4HP9 A;  5CRF A;  4OP8 A;  3LIF A;  3DTE A;  3KWQ C;  1YU4 A;  3CI6 A;  3FKW A;  1S1Y A;  1YM1 A;  1HQ3 D;  5B33 C;  3KFU G;  1V9Y A;  4DE0 A;  3ZGA B;  2XQZ A;  4JF5 A;  3B42 A;  4YM6 A;  1KX3 D;  5BS7 A;  1YLT A;  3ZFZ A;  5GSU C;  2QPN A;  2PRF A;  4BBU A;  4KQD A;  2F8N D;  3EPH A;  2XEP A;  4LD9 A;  2B5R A;  2DCF A;  5L2F A;  1P3B D;  4WU8 C;  1CQA A;  4XZQ D;  3GSG A;  1KX4 C;  5B2I B;  1BH8 B;  3C2W A;  2HDR A;  3IWO A;  3Q7Z A;  1XJ6 A;  4IBX A;  3B3X A;  2WKR A;  3QP2 A;  4AWL B;  4NXF A;  3KWQ A;  4WL9 A;  5AVB D;  3JYI A;  3R7W B;  3KXB C;  4X69 A;  3S7O A;  1YSQ A;  3IHA A;  2Z6C A;  2YFW B;  1S32 C;  3O88 A;  3MMH A;  3H9W A;  5GSU A;  5GHZ A;  3PR6 A;  2FJ7 A;  4GN2 A;  3VSL A;  3UPO A;  3PYP A;  1P3I A;  3A6N D;  5F68 A;  3UTB A;  3QP8 A;  1IFQ A;  1N4O A;  3X1T C;  1H8M A;  3KYZ A;  5CED A;  1KX4 A;  2XF3 A;  3EQU A;  4QWO A;  2Y59 A;  3WS4 A;  4CAY A;  1DP8 A;  3HLD A;  3MNN D;  2O9B A;  1J3W A;  3AZG B;  1P3K B;  3CIT A;  3K2N A;  3N8L A;  2CWE A;  3LZ0 C;  1P3L C;  1E88 A;  4C6Y A;  4OQI A;  3AZH C;  5B24 D;  1E3U D;  3D4F A;  1OTI A;  4DE2 A;  4ZUX B;  3P09 A;  1LLB A;  3LIB A;  3D9Y A;  3GR2 A;  4O7D A;  3AZI B;  3WAA B;  2YKF A;  1K25 A;  5BO0 B;  3NHQ A;  2NQB D;  4F3L A;  3X1T A;  5JA4 A;  4OPZ A;  4RX3 A;  4YFM A;  3GDI A;  5IS1 A;  4E6W A;  1TS8 A;  1JFI A;  3IBJ A;  1P3L A;  4ZTK A;  3A3E A;  4GD6 A;  3REH D;  1YQS A;  2WAD A;  4JF4 A;  4R3J A;  5J7E A;  1K56 D;  1K6R A;  1VEU A;  4B9O A;  2W3E A;  5GXQ C;  2EX6 A;  4XT2 A;  4CQH A;  4DE3 A;  4GHI B;  3NQU B;  4R4R A;  4P0M A;  3N7W A;  1G6A A;  3JVU A;  3F1N B;  4G91 B;  4PAU A;  1ZG4 A;  2HGV A;  3BJN A;  5HZH A;  1I2S A;  4WBG A;  4Y13 A;  1PFL A;  3HLC A;  5F99 B;  4YOF A;  2LY8 A;  2CC1 A;  5HWT A;  1I5Q A;  2L1M A;  3MGP B;  1JWZ A;  3VP4 A;  3WKJ B;  5AV9 A;  3S7Q A;  3O62 B;  4XUJ D;  5F5Y A;  5GXQ A;  1DY6 A;  2V2F F;  2X01 A;  1Z2C B;  1P3G B;  4KGC C;  1E6N A;  2HDQ A;  2FFF B;  4BBT A;  3ZNT A;  2YFV B;  1T19 A;  3BFG A;  1CJF A;  3AZE D;  1H3O B;  3REK C;  1EI5 A;  3NIA A;  2ZQA A;  4S2O A;  1YLY A;  4PKY A;  4YWZ A;  3X1V A;  4KZ6 A;  4JGR A;  4M6B A;  5CGW A;  1MZU A;  1WE4 A;  3N8S A;  4R6L A;  1TAF A;  4J8V B;  4DN0 A;  5B1M D;  2W3D A;  4LCL A;  1PZR A;  4MB4 A;  1PYY A;  4I39 A;  2C6W B;  3AZM B;  3UB6 A;  1P3P C;  5GT0 C;  1KX5 C;  1GXD A;  2G5I C;  3REK A;  1M1A A;  1M40 A;  4H9Q A;  3UDF A;  3C38 A;  3T1R A;  4OPQ A;  4E3N A;  1HTZ A;  2E8I A;  1CK3 A;  5A91 A;  3CPT A;  1K6S A;  2WK0 A;  1PW8 A;  1H8Y A;  2EFU A;  4JXG A;  3UE0 A;  3W98 C;  1P3O D;  2B02 A;  2VK3 A;  4KZA A;  4Q0H A;  2H0T A;  3PAE A;  4S2N A;  5GT3 C;  3VH5 A;  2IO5 B;  1XGJ A;  5FSR A;  3V67 A;  5B1L B;  2QZ6 A;  5FA7 A;  3W2Z A;  5DJT A;  2XSS A;  5AV8 C;  4M4X A;  4KQQ A;  1P3P A;  4G3K A;  5GT0 A;  2JN7 A;  5CP6 D;  5IHV A;  4H9N B;  4EO5 C;  5KSH A;  4MN6 A;  2OLU A;  5DFX A;  4X23 B;  5DTT A;  4J8U D;  4QU3 A;  4X68 A;  4GW9 A;  3UT9 C;  3HL9 A;  5HD3 A;  3REI A;  1EQZ C;  3B6G D;  4NXG A;  1MKM A;  1QME A;  3AZK D;  3W98 A;  4NZ3 A;  1PWD A;  2ZM8 A;  1S4R A;  3REL B;  3CAX A;  1P3M B;  3OCL A;  1OTE A;  3ZG0 A;  4NE6 A;  5EPH A;  5GT3 A;  4UQI S;  5F69 A;  1P3F B;  4EUZ A;  3B6F C;  2I9V A;  5AV8 A;  2J3T D;  5DNN D;  1I2W A;  1S66 L;  2QMI A;  3F1O B;  4Z2G A;  1TDG A;  3UT9 A;  3NEC A;  2XFT A;  4BL3 A;  2Y2N A;  1EQZ A;  1LI9 A;  2VGL S;  4IUK A;  3E0Y A;  3G2Z A;  4ETZ A;  3TU4 B;  3DWZ A;  4XUX A;  4EWF A;  1CK7 A;  5AY8 B;  1UR8 A;  5HAI A;  1TS6 A;  3EPK A;  3N3F A;  2B95 A;  4HQA A;  2B18 A;  5GLC A;  5CPJ D;  5E5A A;  4GB7 A;  1ZLA D;  1KU5 A;  5AV5 D;  4M3K A;  4ZUX C;  3C4P A;  4MBK A;  3IX3 A;  4IED A;  3VE4 A;  4EXO A;  1OT6 A;  3SH7 A;  2XGN A;  2GNX A;  3WAA C;  3MGS A;  1U35 D;  3MGQ D;  2W27 A;  3FKE A;  2ARO C;  4HOI A;  4IJF A;  5AVC D;  1P3A B;  1CF0 A;  2QYB A;  3OPP A;  2V20 A;  4KZ5 A;  2XD1 A;  4O8G A;  3X1U B;  1AOI B;  3T4S A;  4CLC E;  3NY4 A;  4GD8 A;  2NZD C;  4FCF A;  1MWU A;  3PXP A;  4ZRR A;  5B32 C;  1OTA A;  3FZC A;  4WZ5 C;  2Y2K A;  4JGQ A;  3AV1 D;  5GHX A;  2M7U A;  2PYO C;  3UPP A;  3AZJ C;  4E04 A;  2W1R A;  3UTA B;  3ZCZ A;  3BFC A;  2ARO A;  3VP0 A;  3EPL A;  2PYP A;  5IU1 A;  4Z66 A;  5HWW A;  3IF5 A;  3LEL D;  3SS4 A;  5TGF A;  5HFO A;  3E98 A;  3FV7 A;  1XPB A;  3HLG A;  4J8W C;  1OTD A;  1TEM A;  4JGO A;  3OC2 A;  5B40 B;  5F6A A;  4EBL A;  1PWC A;  5CXW A;  3W97 B;  2CV5 A;  3BEB A;  4QNL A;  4WZ5 A;  2PYO A;  1ID3 B;  4Y2F A;  1H3Q A;  1XXM A;  5B0Y D;  4H6J A;  5GHY A;  3PBR A;  3VMA A;  1GA0 A;  3HUM A;  1BTL A;  4KZ4 A;  4S2L A;  4G92 C;  3EG5 B;  3MVD D;  2BTF P;  5B31 D;  3C1B D;  1DP9 A;  3C1C C;  4UA9 A;  3AZL A;  4E3K A;  4IBJ A;  1NLY A;  3W99 B;  1XJ4 A;  4J8W A;  2W3H A;  4OQ0 A;  4H9S A;  1FQG A;  1HVB A;  4KZ7 A;  2Z6D A;  2VJW A;  5HL6 A;  4KUD C;  4OJ6 A;  2HIO D;  4QLC C;  3REJ C;  4HGA C;  1BH9 B;  4KG6 A;  2DRW A;  1OJ5 A;  4AFI A;  3X1S C;  3NCK A;  3Q7V A;  3W96 B;  3ZVW A;  3V9R A;  4NY2 A;  4I38 A;  5CPK C;  3AZF A;  4QY5 A;  3LJA D;  4LV0 A;  3QNC A;  4JJN B;  4LD9 B;  1L0G A;  3WS1 A;  2F8N K;  1X0O A;  5M19 A;  4KUD A;  2L5A A;  4OP5 A;  2L4R A;  4G3W A;  2EX2 A;  4LRY C;  4Z2M G;  3AV2 C;  3WS0 A;  4N92 A;  3SOI A;  1KS0 A;  3KWQ B;  1VET A;  2IO5 C;  2KDK A;  2MJ6 A;  3OBF A;  4BL2 A;  5M1A A;  5B33 B;  3X1S A;  3MGR D;  4DMZ A;  1ES3 A;  2J9P A;  3IH8 A;  1D1J A;  5GSU B;  4DRB A;  1E6R A;  3VP2 A;  1VM1 A;  3B0C W;  4WEL A;  4Y5F A;  5EM0 A;  2W3F A;  4P87 A;  4IBE A;  1FCM A;  1NY0 A;  3LZ1 C;  1KX4 B;  1JWP A;  2Y4A A;  1RGZ A;  2ZM0 A;  4FSF A;  4CAY B;  3B0D B;  1HQ3 A;  3AV2 A;  3T1Q B;  4J8X D;  4NEE D;  4KZ8 A;  3MFX A;  3VP1 A;  3KXB B;  1LL8 A;  4ARZ B;  3WS2 A;  1TS0 A;  1MWS A;  2JBF A;  1ERQ A;  3Q82 A;  1TZY C;  1S32 B;  1ONG A;  3LR0 A;  5TBM A;  1P3B A;  2JKT M;  3N8R A;  4XZQ A;  3PBT A;  2IWD A;  3LYX A;  5FQM A;  3MQ0 A;  1MBL A;  2Y2O A;  3SZT A;  3X1T B;  3LZ1 A;  4HIA A;  5B2I D;  4L9G A;  3C4O A;  5CPI C;  4IBK A;  2UV0 E;  5JA4 B;  1A7W A;  4YS3 C;  1PRQ A;  1JFI B;  1P34 C;  3LZ0 B;  1P3L B;  5E2F A;  1N1J A;  3QNB A;  3VP3 A;  3AZH B;  3LUQ A;  2R9W A;  3L27 A;  3TRC A;  1F66 C;  4X1M A;  3A6N A;  1GA9 A;  4Z2J A;  1VEU B;  3QP6 A;  2EX9 A;  5DKL A;  2ZLY A;  3D72 A;  5HL1 A;  1DRM A;  4QPR A;  3SW1 A;  3MNN A;  4RQ9 A;  2HUE C;  2RIQ A;  4R8P C;  3C5A A;  4PM9 A;  1FCN A;  3AZG D;  1P3K D;  1MY8 A;  1TS7 A;  3NBL A;  3PBO A;  1E3U A;  3AZN C;  4HH3 A;  1P34 A;  2Q9M A;  3CZD A;  1DJB A;  1YT4 A;  4JF6 A;  4R38 A;  5EOE A;  3ZNY A;  3P98 A;  4DXC A;  3WD4 A;  2VZW A;  1PDC A;  2C5W B;  2VV8 A;  5BNX A;  4GJ4 A;  5EVE A;  2ZL1 A;  3AZI D;  5GXQ B;  3AGF A;  2ZQD A;  3WWX A;  1W63 Q;  4L0L A;  2XR0 A;  3JPU A;  4WMC A;  3E2K A;  3KX0 X;  3WA9 C;  1H8P A;  4OLG A;  4R8P A;  3VE3 A;  4GNU A;  2O99 A;  3MZD A;  4WNN B;  3T4T A;  5KSC A;  4R3B A;  3AZN A;  1BUL A;  3REH A;  4KHA A;  5E2E A;  4O01 A;  1K56 A;  3UE3 A;  2FN2 A;  4KZB A;  4HJ4 A;  4ID4 A;  5E43 A;  1T18 A;  2D02 A;  2RCX A;  4B4X A;  4MLL A;  1TAF B;  1NJ4 A;  5GLB A;  3L9K A;  4H9P A;  2QJ7 A;  1J9M A;  1M18 C;  3AFA C;  1KE4 A;  1GHI A;  2GX5 A;  5G4Y A;  3PTE A;  4KGC B;  4S2P A;  2IA2 A;  4RVA A;  5DFY A;  5L10 A;  3V3S A;  2WKP A;  1KVM A;  3K3C A;  1K57 A;  2IWC A;  3REK B;  1FR6 A;  3CLO A;  4H9Q B;  3H0R C;  4WU9 C;  5F99 D;  2KX6 A;  3BFD A;  1FOF A;  2A24 A;  5F83 A;  3MGP D;  2EA9 A;  5FUG A;  3WKJ D;  4P6Z S;  3O62 D;  1YLW A;  2WGW A;  1ESI A;  4OPY A;  4MB3 A;  1P3G D;  5A92 A;  4YM6 C;  3MQO A;  1P3P B;  5GT0 B;  1KX5 B;  1DJC A;  2H5S A;  1JVJ A;  1NRJ A;  3HJI A;  4WU9 A;  3LEQ A;  5FQI A;  3GVB A;  5HAR A;  5B1M A;  3UO9 A;  5BPV A;  3WTP E;  3KUY C;  4OOM A;  1RCJ A;  3W98 B;  4J8V D;  1XKZ A;  2D01 A;  4UQI M;  3P7N A;  3DTM A;  4KQR A;  3JVV A;  5GT3 B;  1GOI A;  2K2N A;  3BY9 A;  3C7V A;  1ONH A;  1T1A A;  4E44 A;  3DTI A;  2F8N G;  5AV8 B;  4ETX A;  2VV7 A;  3AZM D;  2Y2H A;  4EO5 B;  2GDN A;  1WWI A;  2FJ7 C;  4CLC D;  3HBR A;  2PU4 A;  3MXR A;  4PPR A;  1P3I C;  3UT9 B;  5B2J D;  3FDD A;  3UTB C;  1P3O A;  1K0K A;  3IXD A;  2I72 A;  1EQZ B;  3K3D A;  3KUY A;  4NE3 A;  2XA7 S;  3B0D C;  2J80 A;  3AYW C;  2PD8 A;  3KYE A;  4B88 A;  5FEF A;  4GZB A;  2BYK A;  1L6J A;  3IF6 A;  5B1L D;  5CP6 A;  1NYY A;  3PAG A;  2GJ3 A;  3B6F B;  5E2H A;  4GHA A;  4J8U A;  5HWV A;  4Y0O A;  3IHB A;  5I94 A;  1Q2Q A;  3KSI A;  2BLS A;  3B6G A;  4X23 D;  3AZK A;  3KS4 A;  3IXG A;  4D60 A;  4JKT A;  5EOO A;  1H0G A;  4DDY A;  1YU3 A;  2VGJ A;  3AYW A;  1FCO A;  3REL D;  1P3M D;  4XUZ A;  3DTK A;  3LI9 A;  2H0Y A;  2XH9 A;  5A90 A;  1P9R A;  3S7P A;  3HVF A;  4II7 A;  5DNN A;  3BW6 A;  2IOU A;  1P3F D;  4R23 A;  5FQ9 A;  4ME4 A;  1U35 C;  4KUK A;  4IVK A;  1M19 C;  1IKG A;  3VV4 A;  2WGV A;  4X6T A;  4RX2 A;  1D06 A;  4Y7P A;  4KQO A;  4X1L A;  5FQQ A;  2ARO B;  2OLV A;  5EVI C;  4Z2H A;  3P01 A;  3MZE A;  5BT1 C;  1YLZ A;  1ZLA A;  5AY8 D;  1HZO A;  4LV2 A;  5AV5 A;  5C3I C;  1KGE A;  1UWP X;  5E2G A;  2HJE A;  3H82 A;  4MEZ A;  4ZJ1 A;  4TX8 A;  3W4P A;  3NC8 A;  2NZD B;  2P08 A;  1BUE A;  1XA1 A;  2P7J A;  3CMZ A;  1U35 A;  4C75 A;  1O07 A;  1M19 A;  5B32 B;  5AV9 C;  2PYO B;  2WAE A;  3AZJ B;  5AVC A;  2PT7 A;  1XJ3 A;  4HMD A;  3LI8 A;  2ZMV A;  2ZY3 A;  4EEP A;  5A8B A;  5EVI A;  1P3A D;  5DNM C;  2OWJ A;  3HSH A;  5CHJ A;  1T1C A;  3FG8 A;  3NQJ B;  5JYP A;  3X1U D;  3X1V C;  4J8W B;  1E4D A;  1FR1 A;  4GOG A;  3TSG A;  3AV1 A;  5GLA A;  3HCY A;  5CEC A;  2V1B A;  2Y79 A;  2Y55 A;  3T50 A;  4Q0I A;  3UTA D;  4G92 B;  2PU2 A;  3KSG A;  4UPK A;  5DNM A;  1LSX A;  3OOV A;  3C1C B;  4IJE A;  1M1A C;  4K91 A;  3UB5 P;  3BFE A;  1PZO A;  3W4Q A;  4JXS A;  2OSU A;  5B40 D;  3IP4 C;  1T3U A;  5B0Y A;  1Z6F A;  3N6I A;  5FDS A;  4S2M A;  4KUD B;  3W97 D;  4QLC B;  3REJ B;  1BLH A;  4HGA B;  3MVD A;  1ID3 D;  1IYQ A;  1KE3 A;  4G3V A;  5B31 A;  4PMA A;  4S2N C;  3X1S B;  2G2W A;  2G5H C;  2XD5 A;  3IXB A;  4RYE A;  4WUJ A;  1EWZ A;  1W1V A;  4HJ6 A;  2ACG A;  2VLG A;  3MR0 A;  5EUA A;  2W0N A;  4GDN A;  3F6T A;  5CPK B;  5TFQ A;  3W99 D;  2HIO A;  3VOY A;  2HPB A;  4DE1 A;  3LY3 A;  5EEC A;  3MKF A;  3REI C;  1SDE A;  2ZY4 A;  5KIZ A;  3BQA A;  3H7W A;  5DTK A;  4LG2 A;  1HQ3 B;  3AV2 B;  3MGR C;  4HHD A;  2F8N H;  3LGO A;  2HDU A;  3FKV A;  5AVF A;  5HPI A;  4NKP A;  3UDX A;  3W96 D;  1T1B A;  4Z5T C;  4E3O A;  2L0W A;  4I3J A;  4BBV A;  3QP5 A;  1WYC A;  4XZQ B;  3M6B A;  4JJN D;  4LD9 D;  3ZYT A;  3IS2 B;  2V0W A;  1IOU A;  4J8X C;  3LZ1 B;  3MKE A;  1Y28 A;  2OV5 A;  1FIK A;  5TR7 A;  4ZBJ C;  3MGR A;  3VFH A;  3KWQ D;  1VQQ A;  4JPM A;  3W8K A;  2YKH A;  4NZ1 A;  1YPR A;  3IT9 A;  4S2J A;  5B33 D;  3M7P A;  1N1J B;  5E5A C;  2V0U A;  3T4K A;  1TZY B;  3G34 A;  5AV6 C;  5FAQ A;  1YMX A;  4Z5T A;  2A3U A;  1G5U A;  5GSU D;  3A6N B;  1NZO A;  1OTB A;  3DW0 A;  3EOI A;  3MGS C;  5JRG D;  2WKH A;  5J4E A;  2QKP A;  5CER A;  1F98 A;  1B67 A;  4UHU A;  4EQI A;  4IBC A;  4GKU A;  1Y54 A;  4WU8 D;  4J8X A;  1EW0 A;  1KX4 D;  4H9R B;  1GCE A;  5CPI B;  1L0E A;  1WA9 A;  2WAF A;  3C7U A;  4LCM A;  4YS3 B;  1SCW A;  3AL0 C;  4BLM A;  4L9F A;  4FH4 A;  5GLD A;  3UME A;  3KXB D;  3TW8 A;  1P34 B;  4PM5 A;  2WKE A;  4NFT A;  4JBF A;  3OPH A;  1GSV A;  3E4Q A;  5AV6 A;  1S32 D;  3HJK A;  1F66 B;  2H10 A;  1ZTU A;  4GS9 B;  5B0Z C;  3UE1 A;  5B2I A;  1BH8 A;  3OPR A;  1TDL A;  2FFY A;  5CGX A;  5C5K A;  1ALQ A;  1W79 A;  5DF8 A;  1ES2 A;  3EEH A;  2HUE B;  5BNV A;  3X1T D;  1LI0 A;  3S4X A;  4Z66 C;  3R7W A;  2FH5 A;  4R8P B;  1AIW A;  1SKO B;  4ZBE A;  1XGI A;  3AZN B;  1LSV A;  3LZ0 D;  1P3L D;  2G2U A;  1BLC A;  4KHA B;  3MQQ A;  4I3A A;  4LRZ E;  3QP4 A;  3AZH D;  4OON A;  1HLU P;  3UY6 A;  3L7H A;  2CV5 C;  4OJO A;  1L0F A;  2DNS A;  2QHK A;  3OZH A;  5L07 A;  5B0Z A;  4R4S A;  3EGD C;  2V1Z A;  1W2E A;  5AJG A;  3OLO A;  3AN2 D;  3HON A;  2X71 A;  1P3K A;  3WTP D;  3WA9 B;  2Y91 A;  3VH6 T;  4L9E A;  3AZL C;  2JSS A;  1XA7 A;  3V50 A;  1QO6 A;  4H9S C;  2P9V A;  3AZI A;  5EE8 A;  3ITB A;  4Z9Q A;  4LV3 A;  1P0Z A;  1L3L A;  1DP6 A;  4WZ4 A;  5B31 G;  5GXQ D;  3B33 A;  1M18 B;  3AFA B;  1YKD A;  2ZQ7 A;  3M6H A;  4WEJ A;  4MN5 A;  3LR3 A;  2O9C A;  4OJ5 A;  4MBH A;  4E6X A;  5L09 A;  3AZF C;  1E15 A;  4WU9 B;  1YU0 A;  1RP5 A;  5D3O A;  4S2I A;  4FD8 A;  4OJL A;  5HPF A;  4PHT A;  2PR5 A;  4OH0 A;  3MF0 A;  2AVX A;  4OOY A;  2WGI A;  3F1P A;  3F1N A;  3ISG A;  2BAS A;  2VA0 A;  1ESU A;  4KGC D;  2VKS A;  1OJG A;  3G32 A;  1J7M A;  3IQA A;  4YM6 B;  4ZJ3 A;  5F99 A;  3REK D;  3CUE A;  5DF9 A;  5FQK A;  2JE5 A;  3A1K A;  2M1C A;  3AGE A;  3W4O A;  3O62 A;  4E3L A;  2XA7 M;  5CTM A;  3V3R A;  5EM1 A;  1FIL A;  3KUY B;  2GZA A;  1HQ3 C;  1P3G A;  5CHL B;  2BYK B;  1KX3 C;  3FC7 A;  4R3A A;  2EX8 A;  5FQJ A;  1N9O A;  3HLE A;  3ULF A;  2DMW A;  3UDI A;  4CLC C;  1P3P D;  5GT0 D;  1KX5 D;  5B2J C;  1P3B C;  1EAK A;  4XZQ C;  2FJ7 B;  2HP9 A;  4PM7 A;  3BLS A;  1P3I B;  4J8V A;  3UTB B;  4NXB A;  1IYP A;  3CWF A;  3G2Y A;  1F1E A;  5AVB C;  4OUI A;  4K08 A;  4PM6 A;  5FAS A;  3W98 D;  3AYW B;  4IBI A;  1OME A;  1KX3 A;  1GHM A;  5GT3 D;  2F2A C;  5GL9 A;  3UE6 A;  1XX2 A;  2VV6 A;  1M6K A;  2F8N A;  5AV8 D;  1K38 A;  4JXV A;  4CLC A;  4B4Z A;  3A6N C;  5FAP A;  5B2J A;  3NDG A;  4Y0U A;  1GHP A;  5DJU A;  2XK1 A;  4X55 A;  5DVA A;  1STZ A;  1F2K A;  4NK3 A;  3UT9 D;  2IWB A;  3MNN C;  4F3L B;  1EQZ D;  5M18 A;  1XP4 A;  5AVB A;  1F9I A;  1W1T A;  4HBT A;  3NOT C;  2JC7 A;  3UB8 A;  4OLD A;  1K55 A;  5B24 C;  2E8J A;  4MCW A;  4KEN B;  3H82 B;  4ZJ2 A;  4OKP A;  2A2L A;  2V9A A;  4H9N A;  3T12 B;  1GSX A;  4E45 A;  3B6F D;  4EET B;  1U35 B;  1E8B A;  2X02 A;  3LY4 A;  1M19 B;  1N9L A;  2NQB C;  5AVC B;  2RTS A;  2J9O A;  2JKT I;  1K54 C;  4D2O A;  3PHY A;  1KDS A;  1TF1 A;  4XT2 B;  1Y4O A;  1P3M A;  5EVI B;  1NXY A;  3BQ8 A;  3NUL A;  2ZJ9 A;  3OCN A;  3S7N A;  2PR6 A;  4IBF A;  2WYX A;  2Y2I A;  5C3I B;  5B24 A;  4MMN A;  3REH C;  2O0Y A;  4WV4 B;  4P85 A;  4HJ3 A;  3R45 A;  3MSH A;  2HV1 A;  3M2J A;  1JTG A;  4ZUX D;  2WUQ A;  5AV9 B;  2NQB A;  3GEC A;  2J8P A;  4IBG A;  3KSH A;  3WAA D;  1K54 A;  3T4J A;  1DJA A;  1NYM A;  1K4F A;  3UMD A;  3L29 A;  4E3M A;  2ARO D;  5AY8 A;  3LFV A;  5DNM B;  2CMN A;  4OOL A;  1K57 C;  2ZMF A;  4XXR A;  1RGY A;  3KYQ A;  2OOL A;  5HX9 A;  1O6I A;  4HH2 A;  3A1I A;  3RJU A;  2ZC6 B;  3GQZ A;  3X1V B;  4HMC A;  4JGP A;  1ACF A;  4XUJ C;  2NZD D;  1NRF A;  2Z2M B;  3AGD A;  2XRN A;  3PBN A;  1YU1 A;  5B32 D;  2KLI A;  1HD8 A;  3AZJ D;  3U2A A;  3T1S A;  2EWW A;  3ZG5 A;  1PZP A;  4LPZ A;  2NUP C;  1LHY A;  3AZE C;  3BLM A;  3M2K A;  3H0L C;  3BRM A;  3X1U A;  1IYO A;  2WZX A;  4Q8I A;  4DQY B;  1M1A B;  3QHY A;  3RH8 B;  2PYR A;  4H9O A;  3D3O A;  4XUJ A;  4WYY A;  3CPT B;  5B1M C;  2Y2L A;  4K0X A;  2UWX A;  3H7W B;  3WD1 A;  4Z2I A;  5FAO A;  4CSR A;  3Q81 A;  5FI2 A;  5CEB A;  2ZQC A;  4X53 A;  4LFU A;  3AZE A;  1H0I A;  1ODV A;  1H8Z A;  3IX8 A;  2ZQ8 A;  4X56 A;  1W1Y A;  1UWN X;  1SKF A;  3A3J A;  3C1C D;  1F5M A;  3MZF A;  5B40 A;  4Z2K A;  2PBD P;  1TD5 A;  2ZBB A;  3TJZ C;  3ZG9 B;  1W63 M;  3ZHH A;  4OJP A;  3MXS A;  1P3O C;  2P04 A;  4IHQ A;  1ID3 A;  2LB9 A;  1XFN A;  2DF4 C;  3REI B;  1V9Z A;  2V1A A;  4WF0 A;  4KUD D;  1ERO A;  4QLC D;  3REJ D;  3MS6 A;  1SDN A;  3EQV A;  5FL3 A;  3MGR B;  1N9N A;  4MN7 A;  3IF6 C;  1LSW A;  3O3V A;  5CP6 C;  4UUZ A;  2RL3 A;  1ZHH B;  3X1S D;  4Z5T B;  4J8U C;  3IWQ A;  4CJN A;  1E25 A;  5AQB A;  5CPK D;  4DRA A;  4WEK A;  3B6G C;  5CHU A;  2VGL M;  3AZK C;  1K4E A;  1S1Z A;  1BH9 A;  4I5S A;  3LO7 A;  4J8X B;  4OVD A;  2JCH A;  2P74 A;  4HEF A;  3AV2 D;  4ZBJ B;  4WM9 A;  1KGF A;  2QWS A;  3W96 A;  4IJG A;  2OAQ 1;  5CTN A;  3BFF A;  2J3T C;  4H8R A;  5FI7 A;  1MWR A;  5DNN C;  4BD1 A;  4IBR A;  4HI4 A;  3PBQ A;  5E5A B;  2ZD8 A;  3WD3 A;  5AV6 B;  3IXH A;  5JRG C;  4JJN A;  3T4O A;  2W1T A;  3WX7 A;  3MGS B;  1Q9C A;  3CJM A;  2ZC5 B;  5G49 A;  4EBP A;  5BNV B;  3LZ1 D;  2BYM A;  3HLB A;  1MKI A;  5B33 A;  5CPJ C;  1ZLA C;  1Z09 A;  2WZZ A;  5AV5 C;  3HLF A;  1S4S A;  4KG5 A;  4EV4 A;  2OWH A;  1CI9 A;  4DXB A;  1BSG A;  5KMW A;  2RVQ D;  1KE0 A;  1TZY D;  3A0R A;  5JRG A;  2PBY A;  3MGQ C;  3UN7 A;  4WU8 A;  4UA7 A;  5B0Z B;  3EPJ A;  5AVC C;  1H5X A;  4BWI A;  3NJA A;  3LID A;  1W8Y A;  2JKR M;  1U60 A;  3A0V A;  2V8C A;  1WWS A;  4IBD A;  4Z66 B;  3DAV A;  3KXB A;  4WLA A;  4ARZ A;  5CPI D;  2ZC4 B;  4NYU A;  1MC0 A;  5FDH A;  4YS3 D;  3TU4 D;  5CPJ A;  2QJ5 A;  1SZV A;  1S32 A;  4F94 A;  1IYS A;  3FWL A;  1P34 D;  4QHC A;  1CEF A;  4MBF A;  2P9V B;  3BM6 A;  4N1X A;  3AV1 C;  2JHE A;  4N1H A;  1F66 D;  3MGQ A;  2CV5 B;  3AN2 C;  4H6J B;  3WTP C;  3V5M A;  3ZDJ A;  3LEL C;  2W3G A;  3DWK A;  3VSK A;  4WMC D;  3KSY A;  5KDM A;  4NZ4 A;  3L25 A;  2JKR I;  5KZH A;  1KOU A;  4R8P D;  1OGB A;  3LZ0 A;  3AZL B;  1W1P A;  3BWL A;  3T4Q A;  3O87 A;  4DF6 A;  3AZH A;  3AZN D;  1AOI D;  3IWI A;  5B0Y C;  1YLP A;  4NXE A;  4OQH A;  3AN2 A;  3MVD C;  1HTA A;  3GTC A;  3WTP A;  5B31 C;  5EFW A;  4WN5 A;  3C1B C;  3F1P B;  4HY8 A;  4Q0J A;  3LEL A;  3TOI A;  4R0Q A;  4EU0 A;  3Q7V B;  4KUO A;  5EVL A;  1L2S A;  3V9R B;  3WA9 D;  2PD7 A;  4K0W A;  1R4V A;  2Q0O A;  3HUO A;  3AZF B;  2HIO C;  3KSF A;  3L26 A;  1WYB A;  2M7V A;  2W8S A;  5HAP A;  4EW7 A;  1MPL A;  2R9X A;  3VH6 A;  3WD2 A;  4KZ3 A;  1VET B;  1M18 D;  3AFA D;  3C1B A;  3G35 A;  4WNN A;  5U47 A;  4JXW A;  2ZC3 B;  5MC7 A;  3N4I A;  3EWK A;  3LJA C;  5A93 A;  4QY6 A;  3U4L P;  5CGS A;  2ZM2 A;  4NYY A;  1PI4 A;  2HF6 A;  4IVI A;  5HDD A;  4WU9 D;  1MXO A;  5TJJ A;  3B0B A;  2Y2P A;  4FH2 A;  2HP5 A;  4U3T A;  1NZU A;  4Y0T A;  3Q07 A;  3RTY A;  2EXB A;  1YLJ A;  4KGC A;  2VQR A;  1B6W A;  1D7E A;  1KX3 B;  4JLF A;  1C3B A;  3BY8 A;  4DRT A;  3QP1 A;  1CXW A;  1ZC2 A;  4YM6 D;  3LJA A;  2F8N B;  1G68 A;  3LEZ A;  4YIN A;  4DKI A;  4CLC B;  1G6O A;  3E4P A;  5B2J B;  4CPK A;  1YU2 A;  5TBM B;  1P3B B;  5K5B A;  3IBR A;  2EXA A;  1CI8 A;  2ZMA A;  4UEY A;  2A49 A;  5G4Z A;  5AVB B;  3LIC A;  3KUY D;  3A3I A;  3NI9 A;  3BYD A;  3VOZ A;  3UNW A;  2ZY2 A;  4QJG A;  1KX5 A;  3CHW P;  5JYO A;  2V5O A;  2DQN C;  1AXB A;  4Z1W A;  5CHM A;  3FYZ A;  3T4L A;  3B0C T;  3S22 A;  4R1G A;  2FJ7 D;  5B2I C;  1YUE A;  3O5Y A;  2XDM A;  4EER A;  1P3I D;  3UTB D;  2J8Y A;  1E6P A;  4AWL C;  3MNN B;  1P97 A;  3V39 A;  3KO6 A;  1GPF A;  3MJQ A;  1N9B A;  3AYW D;  1BFM A;  4YNR A;  3NDE A;  4Z2L A;  1CEG A;  2Y2Q A;  5B24 B;  1ES5 A;  1TVF A;  2K7S A;  3ICY A;  1PNE A;  2PDR A;  4E3I A;  3NOU C;  1PI5 A;  3R45 B;  2ZOI A;  4WZS B;  4HNB A;  1JWV A;  3L28 A;  3PBS A;  2NQB B;  5BNX B;  4LGW A;  2ZL1 B;  1JNU A;  4MB5 A;  1P9W A;  3G30 A;  4ESP A;  3AZG C;  1P3K C;  2LB5 A;  4ZAM A;  3B47 A;  5J3W A;  2YFW A;  3B6F A;  1SHV A;  4BMW A;  3REH B;  2J3W A;  3P5J B;  3AZI C;  3WRT A;  1M19 D;  5HDC A;  1IKI A;  3G31 A;  4H9P B;  4KZ9 A;  1OT9 A;  3RFB A;  1OGG A;  4HME A;  3SS3 A;  3H0M C;  2BG1 A;  3AZG A;  5EVI D;  4HBU A;  2EFX A;  2PHY A;  2Y8H A;  5BT1 D;  1BLP A;  4GDB A;  4ZUX A;  3HLW A;  4U0T A;  4H9O B;  2INW A;  2WKQ A;  2Z2L B;  3WS5 A;  4XUJ B;  2HJ9 C;  1LL5 A;  4P6Z M;  3WAA A;  2A24 B;  3TE8 A;  5BO0 A;  4LV1 A;  5FUG B;  2G7U A;  5AV9 D;  4UAA A;  2WGW B;  1FSW A;  4CSR B;  4EES A;  4G91 C;  3MQL A;  3AZE B;  2H28 A;  3SH8 A;  5DNM D;  3G6O A;  4GLQ A;  1W8Q A;  4PKY G;  3TG9 A;  5F99 C;  5F1F A;  2NZD A;  3CUE C;  4QD4 A;  3MGP C;  3X1V D;  4Y3I A;  3WKJ C;  5B32 A;  3O62 C;  3AZJ A;  5B1M B;  4BQM A;  1MWT A; 
#chains in the Genus database with same CATH homology
 4E3J A;  1P3G C;  4UA6 A;  3NQU A;  4S2K A;  1JTD A;  1S0W A;  3VH5 T;  4UUZ B;  1PW1 A;  3NQJ A;  3HUN A;  4BJP A;  1M1A D;  3MGP A;  3WKJ A;  4J8V C;  1P3O B;  4QB8 A;  1O7E A;  4OQG A;  4P6B A;  5HW3 A;  2YFV A;  4EBN A;  2HP6 A;  3AZM C;  3IF6 B;  3C1C A;  4PM8 A;  1H3O A;  5CP6 B;  3IH9 A;  1BLS A;  4ZDX A;  1KGG A;  4J8U B;  5DF7 A;  3G4P A;  3RXX A;  3B6G B;  3SH9 A;  4QLC A;  3REJ A;  3AZK B;  1W5D A;  5G49 B;  1KDW A;  5G18 A;  3REI D;  2BYM B;  4IBB A;  2J7V A;  5B1L C;  3UPN A;  1K55 C;  2ZQ9 A;  3AZM A;  5DNN B;  2ZM5 A;  5CPK A;  4Z5T D;  4X23 C;  3O86 A;  5JRG B;  4WU8 B;  1ZKJ A;  5AQ9 A;  1QMF A;  4U0X A;  3S1Y A;  3ZG7 B;  2Y2G A;  4BEN A;  3REL C;  1P3M C;  3KS8 A;  2ZC7 A;  5DTS A;  5AQ7 A;  2HDS A;  5B1L A;  5CPJ B;  1P3F C;  4MNR A;  1ZLA B;  2RVQ C;  5AV5 B;  5E5A D;  5AV6 D;  3CG5 A;  1LL9 A;  3E2L A;  4X23 A;  1ES4 A;  3MGQ B;  1KVL A;  3GMW A;  3MGS D;  4BD0 A;  4NZ5 A;  4GH9 A;  1BT5 A;  2Q9N A;  4GHL A;  3REL A;  3TU4 C;  5AY8 C;  3MFD A;  5KDM B;  1P3F A;  1TZY A;  3HRE A;  5F82 A;  3AV1 B;  1IEL A;  3WRZ A;  1FSY A;  3RXW A;  2ZY5 A;  3AN2 B;  5B0Z D;  1P3A C;  3I7J A;  3WTP B;  3LCE A;  4H9R A;  5HAQ A;  5CPI A;  5FI6 A;  3LEL B;  4YS3 A;  3TU4 A;  3VH6 W;  4Z66 D;  3X1U C;  1L0D A;  1AOI C;  1S6R A;  1BZA A;  2Y2M A;  3BEC A;  4HES A;  1ULY A;  1F66 A;  5AQA A;  5B32 G;  3GV9 A;  5B0Y B;  3Q1F A;  3UTA C;  2CV5 D;  1W7F A;  4NET A;  3MVD B;  2PYO D;  1ZG6 A;  1P3A A;  5B31 B;  3C1B B;  1Q2P A;  1AOI A;  3OPL A;  5B40 C;  3AZL D;  3W97 C;  4J8W D;  2HIO B;  3ZVT A;  1ID3 C;  1IEM A;  3GRJ A;  5FAT A;  3UTA A;  4C3Q A;  3A3F A;  2XLN A;  2WKI A;  3A3D A;  3ITA A;  3WA9 A;  5F1G A;  3VH5 W;  4OPR A;  4RA7 A;  2Y2J A;  3LJA B;  3W99 C;  4DDS A;  1PIO A;  3AZF D;  5BOH A;  3W97 A;  2XFS A;  4N9K A;  4LEN A;  3ZG8 B;  4WJ3 C;  3MBZ A;  4A5R A;  1M18 A;  3AFA A;  1PWG A;  3VFF A;  5J8X A;  3W96 C;  3SS5 A;  5BS7 C;  4N9L A;  4KG2 A;  1YMS A;  3W99 A;  4JJN C;  4LD9 C;  2VGK A;  1ERM A;  4Z2M H;  4NE5 A;  3L2A A;  5CRF A;  4OP8 A;  3KWQ C;  1YU4 A;  3FKW A;  1YM1 A;  1HQ3 D;  5B33 C;  3KFU G;  4DE0 A;  3ZGA B;  2XQZ A;  4JF5 A;  4YM6 A;  1KX3 D;  5BS7 A;  1YLT A;  3ZFZ A;  5GSU C;  2QPN A;  2F8N D;  3EPH A;  2XEP A;  4LD9 A;  2B5R A;  2DCF A;  5L2F A;  1P3B D;  4WU8 C;  4XZQ D;  3GSG A;  1KX4 C;  5B2I B;  1BH8 B;  2HDR A;  3IWO A;  3Q7Z A;  4IBX A;  3B3X A;  4AWL B;  3KWQ A;  5AVB D;  3JYI A;  3KXB C;  4X69 A;  3IHA A;  2YFW B;  1S32 C;  3O88 A;  5GSU A;  5GHZ A;  2FJ7 A;  4GN2 A;  3VSL A;  3UPO A;  1P3I A;  3A6N D;  3UTB A;  1N4O A;  3X1T C;  5CED A;  1KX4 A;  2XF3 A;  3EQU A;  3WS4 A;  2Y59 A;  4CAY A;  3HLD A;  3MNN D;  3AZG B;  1P3K B;  3N8L A;  2CWE A;  3LZ0 C;  1P3L C;  4C6Y A;  4OQI A;  3AZH C;  5B24 D;  1E3U D;  3D4F A;  4DE2 A;  4ZUX B;  3P09 A;  1LLB A;  3GR2 A;  4O7D A;  3AZI B;  3WAA B;  1K25 A;  5BO0 B;  2NQB D;  3X1T A;  5JA4 A;  4OPZ A;  4RX3 A;  4YFM A;  4E6W A;  1JFI A;  1P3L A;  4ZTK A;  3A3E A;  4GD6 A;  3REH D;  1YQS A;  2WAD A;  4JF4 A;  4R3J A;  1K56 D;  1K6R A;  5GXQ C;  2EX6 A;  4DE3 A;  3NQU B;  4R4R A;  4P0M A;  3N7W A;  1G6A A;  4G91 B;  1ZG4 A;  1I2S A;  4WBG A;  3HLC A;  5F99 B;  2LY8 A;  2CC1 A;  1I5Q A;  3MGP B;  1JWZ A;  3VP4 A;  3WKJ B;  5AV9 A;  3O62 B;  4XUJ D;  5GXQ A;  1DY6 A;  2V2F F;  2X01 A;  1Z2C B;  1P3G B;  4KGC C;  2HDQ A;  2FFF B;  3ZNT A;  2YFV B;  3BFG A;  3AZE D;  1H3O B;  3REK C;  1EI5 A;  3NIA A;  2ZQA A;  4S2O A;  1YLY A;  3X1V A;  4KZ6 A;  4M6B A;  5CGW A;  1WE4 A;  3N8S A;  1TAF A;  4J8V B;  5B1M D;  4LCL A;  1PZR A;  1PYY A;  2C6W B;  3AZM B;  1P3P C;  5GT0 C;  1KX5 C;  2G5I C;  3REK A;  1M1A A;  1M40 A;  4H9Q A;  3UDF A;  4OPQ A;  4E3N A;  1HTZ A;  2E8I A;  1CK3 A;  5A91 A;  1K6S A;  2WK0 A;  1PW8 A;  1H8Y A;  2EFU A;  4JXG A;  3UE0 A;  3W98 C;  1P3O D;  4KZA A;  2H0T A;  3PAE A;  4S2N A;  5GT3 C;  3VH5 A;  2IO5 B;  1XGJ A;  5FSR A;  5B1L B;  2QZ6 A;  5FA7 A;  5AV8 C;  4KQQ A;  1P3P A;  5GT0 A;  5CP6 D;  5IHV A;  4H9N B;  4EO5 C;  5KSH A;  2OLU A;  4X23 B;  5DTT A;  4J8U D;  4QU3 A;  4X68 A;  3UT9 C;  3HL9 A;  3REI A;  1EQZ C;  3B6G D;  1QME A;  3AZK D;  3W98 A;  4NZ3 A;  1PWD A;  2ZM8 A;  3REL B;  1P3M B;  3OCL A;  3ZG0 A;  4NE6 A;  5EPH A;  5GT3 A;  1P3F B;  4EUZ A;  3B6F C;  5AV8 A;  5DNN D;  1I2W A;  2QMI A;  1TDG A;  3UT9 A;  4BL3 A;  2XFT A;  2Y2N A;  1EQZ A;  1LI9 A;  3G2Z A;  3TU4 B;  3DWZ A;  4XUX A;  4EWF A;  5AY8 B;  5HAI A;  3EPK A;  3N3F A;  5GLC A;  5CPJ D;  5E5A A;  4GB7 A;  1ZLA D;  1KU5 A;  5AV5 D;  4M3K A;  4ZUX C;  3C4P A;  4MBK A;  4IED A;  3SH7 A;  2XGN A;  3WAA C;  3MGS A;  1U35 D;  3MGQ D;  3FKE A;  2ARO C;  4IJF A;  5AVC D;  1P3A B;  3OPP A;  2V20 A;  4KZ5 A;  2XD1 A;  3X1U B;  1AOI B;  3NY4 A;  4GD8 A;  2NZD C;  4FCF A;  1MWU A;  5B32 C;  3FZC A;  4WZ5 C;  2Y2K A;  5GHX A;  3AV1 D;  3UPP A;  2PYO C;  3AZJ C;  3UTA B;  3ZCZ A;  3BFC A;  2ARO A;  3VP0 A;  3EPL A;  4Z66 A;  3IF5 A;  3LEL D;  3SS4 A;  5TGF A;  5HFO A;  3FV7 A;  1XPB A;  3HLG A;  4J8W C;  1TEM A;  3OC2 A;  5B40 B;  4EBL A;  1PWC A;  5CXW A;  3W97 B;  2CV5 A;  3BEB A;  4QNL A;  4WZ5 A;  2PYO A;  1ID3 B;  1XXM A;  5B0Y D;  5GHY A;  3VMA A;  3PBR A;  1GA0 A;  3HUM A;  1BTL A;  4KZ4 A;  4S2L A;  4G92 C;  3EG5 B;  3MVD D;  5B31 D;  3C1B D;  3C1C C;  4UA9 A;  3AZL A;  4E3K A;  4IBJ A;  3W99 B;  4OQ0 A;  4J8W A;  4H9S A;  1FQG A;  1HVB A;  4KZ7 A;  4KUD C;  4OJ6 A;  2HIO D;  4QLC C;  3REJ C;  4HGA C;  1BH9 B;  4KG6 A;  2DRW A;  3X1S C;  3NCK A;  3Q7V A;  3W96 B;  3ZVW A;  3V9R A;  4NY2 A;  5CPK C;  3AZF A;  4QY5 A;  3LJA D;  4LV0 A;  3QNC A;  4JJN B;  4LD9 B;  1L0G A;  3WS1 A;  2F8N K;  5M19 A;  4KUD A;  2L5A A;  4OP5 A;  2EX2 A;  4Z2M G;  3AV2 C;  3WS0 A;  4N92 A;  3SOI A;  3KWQ B;  4BL2 A;  2IO5 C;  5M1A A;  5B33 B;  3X1S A;  3MGR D;  1ES3 A;  2J9P A;  3IH8 A;  5GSU B;  4DRB A;  3VP2 A;  1VM1 A;  3B0C W;  4WEL A;  4P87 A;  4IBE A;  1FCM A;  1NY0 A;  3LZ1 C;  1KX4 B;  1JWP A;  2Y4A A;  1RGZ A;  2ZM0 A;  4FSF A;  4CAY B;  3B0D B;  1HQ3 A;  3AV2 A;  4J8X D;  4KZ8 A;  3VP1 A;  3KXB B;  3WS2 A;  1MWS A;  2JBF A;  1ERQ A;  3Q82 A;  1TZY C;  1S32 B;  1ONG A;  1P3B A;  3N8R A;  4XZQ A;  3PBT A;  2IWD A;  5FQM A;  1MBL A;  2Y2O A;  3X1T B;  3LZ1 A;  5B2I D;  3C4O A;  5CPI C;  4IBK A;  5JA4 B;  1A7W A;  4YS3 C;  1JFI B;  1P34 C;  3LZ0 B;  1P3L B;  5E2F A;  1N1J A;  3QNB A;  3VP3 A;  3AZH B;  2R9W A;  3L27 A;  1F66 C;  3A6N A;  1GA9 A;  2EX9 A;  2ZLY A;  5HL1 A;  3MNN A;  2HUE C;  2RIQ A;  4R8P C;  3C5A A;  4PM9 A;  1FCN A;  3AZG D;  1P3K D;  1MY8 A;  3NBL A;  3PBO A;  1E3U A;  3AZN C;  1P34 A;  2Q9M A;  3CZD A;  1DJB A;  1YT4 A;  4JF6 A;  5EOE A;  3ZNY A;  3P98 A;  4DXC A;  2C5W B;  5BNX A;  3AZI D;  5GXQ B;  3AGF A;  2ZQD A;  3WWX A;  4L0L A;  2XR0 A;  4WMC A;  3E2K A;  3WA9 C;  4OLG A;  4R8P A;  4GNU A;  3MZD A;  4WNN B;  5KSC A;  4R3B A;  3AZN A;  1BUL A;  3REH A;  4KHA A;  5E2E A;  3UE3 A;  1K56 A;  4KZB A;  4ID4 A;  5E43 A;  2RCX A;  4B4X A;  4MLL A;  1TAF B;  1NJ4 A;  5GLB A;  4H9P A;  1J9M A;  1M18 C;  3AFA C;  1KE4 A;  1GHI A;  3PTE A;  4KGC B;  4S2P A;  4RVA A;  3V3S A;  1KVM A;  1K57 A;  2IWC A;  3REK B;  1FR6 A;  4H9Q B;  3H0R C;  4WU9 C;  5F99 D;  3BFD A;  1FOF A;  5F83 A;  3MGP D;  5FUG A;  3WKJ D;  3O62 D;  1YLW A;  2WGW A;  1ESI A;  4OPY A;  1P3G D;  5A92 A;  4YM6 C;  1P3P B;  5GT0 B;  1KX5 B;  1DJC A;  2H5S A;  1JVJ A;  4WU9 A;  5FQI A;  3GVB A;  5HAR A;  5B1M A;  3UO9 A;  5BPV A;  3WTP E;  3KUY C;  4OOM A;  1RCJ A;  3W98 B;  4J8V D;  1XKZ A;  3DTM A;  4KQR A;  5GT3 B;  3C7V A;  1ONH A;  4E44 A;  2F8N G;  5AV8 B;  3AZM D;  2Y2H A;  4EO5 B;  2GDN A;  1WWI A;  2FJ7 C;  3HBR A;  2PU4 A;  3MXR A;  4PPR A;  1P3I C;  3UT9 B;  5B2J D;  3FDD A;  3UTB C;  1P3O A;  3IXD A;  2I72 A;  1EQZ B;  3KUY A;  4NE3 A;  3B0D C;  3AYW C;  4B88 A;  4GZB A;  2BYK A;  3IF6 A;  5B1L D;  5CP6 A;  1NYY A;  3PAG A;  3B6F B;  5E2H A;  4GHA A;  4J8U A;  4Y0O A;  3IHB A;  5I94 A;  1Q2Q A;  2BLS A;  3B6G A;  4X23 D;  3AZK A;  3IXG A;  3KS4 A;  4JKT A;  5EOO A;  4DDY A;  1YU3 A;  2VGJ A;  3AYW A;  1FCO A;  3REL D;  1P3M D;  4XUZ A;  5A90 A;  2H0Y A;  2XH9 A;  3HVF A;  5DNN A;  2IOU A;  1P3F D;  4R23 A;  5FQ9 A;  1U35 C;  4IVK A;  1M19 C;  1IKG A;  2WGV A;  4X6T A;  4RX2 A;  4Y7P A;  4KQO A;  5FQQ A;  2ARO B;  2OLV A;  5EVI C;  3MZE A;  5BT1 C;  1YLZ A;  1ZLA A;  5AY8 D;  1HZO A;  4LV2 A;  5AV5 A;  5C3I C;  1KGE A;  5E2G A;  4MEZ A;  4ZJ1 A;  3W4P A;  3NC8 A;  2NZD B;  1BUE A;  1XA1 A;  3CMZ A;  1U35 A;  4C75 A;  1O07 A;  1M19 A;  5B32 B;  5AV9 C;  2PYO B;  2WAE A;  3AZJ B;  5AVC A;  2ZY3 A;  5EVI A;  1P3A D;  5DNM C;  3HSH A;  5CHJ A;  3NQJ B;  5JYP A;  3X1U D;  3X1V C;  4J8W B;  1E4D A;  1FR1 A;  4GOG A;  3TSG A;  3AV1 A;  5GLA A;  5CEC A;  2Y55 A;  3UTA D;  4G92 B;  2PU2 A;  4UPK A;  5DNM A;  3C1C B;  4IJE A;  1M1A C;  4K91 A;  3BFE A;  1PZO A;  3W4Q A;  4JXS A;  2OSU A;  5B40 D;  3IP4 C;  1T3U A;  5B0Y A;  1Z6F A;  3N6I A;  4S2M A;  4KUD B;  3W97 D;  4QLC B;  3REJ B;  1BLH A;  4HGA B;  3MVD A;  1ID3 D;  1IYQ A;  1KE3 A;  5B31 A;  4PMA A;  4S2N C;  3X1S B;  2G2W A;  2G5H C;  2XD5 A;  3IXB A;  4RYE A;  1EWZ A;  5EUA A;  4GDN A;  3F6T A;  5CPK B;  5TFQ A;  3W99 D;  2HIO A;  3VOY A;  2HPB A;  4DE1 A;  3LY3 A;  5EEC A;  3MKF A;  3REI C;  1SDE A;  2ZY4 A;  5DTK A;  4LG2 A;  1HQ3 B;  3AV2 B;  3MGR C;  2F8N H;  2HDU A;  3FKV A;  3UDX A;  3W96 D;  4Z5T C;  4E3O A;  1WYC A;  4XZQ B;  3M6B A;  4JJN D;  4LD9 D;  4J8X C;  3LZ1 B;  3MKE A;  2OV5 A;  5TR7 A;  4ZBJ C;  3MGR A;  3VFH A;  3KWQ D;  1VQQ A;  4JPM A;  3W8K A;  4NZ1 A;  4S2J A;  3IT9 A;  5B33 D;  1N1J B;  5E5A C;  1TZY B;  3G34 A;  5AV6 C;  5FAQ A;  1YMX A;  4Z5T A;  2A3U A;  5GSU D;  3A6N B;  1NZO A;  3DW0 A;  3MGS C;  5JRG D;  2WKH A;  5CER A;  1B67 A;  4UHU A;  4EQI A;  4IBC A;  4GKU A;  1Y54 A;  4WU8 D;  4J8X A;  1KX4 D;  4H9R B;  1GCE A;  5CPI B;  1L0E A;  2WAF A;  4LCM A;  3C7U A;  4YS3 B;  1SCW A;  3AL0 C;  4BLM A;  4FH4 A;  5GLD A;  3KXB D;  1P34 B;  4PM5 A;  2WKE A;  4NFT A;  4JBF A;  3OPH A;  5AV6 A;  1S32 D;  1F66 B;  2H10 A;  5B0Z C;  3UE1 A;  5B2I A;  1BH8 A;  3OPR A;  1TDL A;  2FFY A;  5CGX A;  1ALQ A;  1W79 A;  5DF8 A;  1ES2 A;  2HUE B;  5BNV A;  3X1T D;  1LI0 A;  3S4X A;  4Z66 C;  4R8P B;  4ZBE A;  1XGI A;  3AZN B;  3LZ0 D;  1P3L D;  2G2U A;  1BLC A;  4KHA B;  3AZH D;  4OON A;  3UY6 A;  2CV5 C;  4OJO A;  1L0F A;  2DNS A;  3OZH A;  5B0Z A;  4R4S A;  2V1Z A;  1W2E A;  3AN2 D;  3HON A;  2X71 A;  1P3K A;  3WTP D;  3WA9 B;  2Y91 A;  3VH6 T;  3AZL C;  2JSS A;  1XA7 A;  3V50 A;  4H9S C;  2P9V A;  3AZI A;  5EE8 A;  3ITB A;  4Z9Q A;  4LV3 A;  4WZ4 A;  5B31 G;  5GXQ D;  1M18 B;  3AFA B;  2ZQ7 A;  3M6H A;  4WEJ A;  4OJ5 A;  4MBH A;  4E6X A;  3AZF C;  4WU9 B;  1YU0 A;  1RP5 A;  5D3O A;  4S2I A;  4FD8 A;  4OJL A;  4OH0 A;  4OOY A;  2WGI A;  3ISG A;  1ESU A;  4KGC D;  3G32 A;  3IQA A;  4YM6 B;  4ZJ3 A;  5F99 A;  3REK D;  5DF9 A;  5FQK A;  2JE5 A;  3A1K A;  3AGE A;  3W4O A;  3O62 A;  4E3L A;  5CTM A;  3V3R A;  3KUY B;  1HQ3 C;  1P3G A;  5CHL B;  2BYK B;  1KX3 C;  2EX8 A;  5FQJ A;  3HLE A;  3UDI A;  1P3P D;  5GT0 D;  1KX5 D;  5B2J C;  1P3B C;  4XZQ C;  2FJ7 B;  2HP9 A;  4PM7 A;  3BLS A;  1P3I B;  4J8V A;  3UTB B;  1IYP A;  3G2Y A;  1F1E A;  5AVB C;  4OUI A;  4PM6 A;  5FAS A;  3W98 D;  3AYW B;  4IBI A;  1OME A;  1KX3 A;  1GHM A;  5GT3 D;  2F2A C;  5GL9 A;  1XX2 A;  1M6K A;  2F8N A;  5AV8 D;  1K38 A;  4JXV A;  4B4Z A;  3A6N C;  5FAP A;  5B2J A;  3NDG A;  4Y0U A;  1GHP A;  2XK1 A;  4X55 A;  5DVA A;  4NK3 A;  3UT9 D;  2IWB A;  3MNN C;  1EQZ D;  5M18 A;  1XP4 A;  5AVB A;  4HBT A;  2JC7 A;  4OLD A;  1K55 A;  5B24 C;  4KEN B;  4ZJ2 A;  4OKP A;  4H9N A;  4E45 A;  3B6F D;  1U35 B;  2X02 A;  3LY4 A;  1M19 B;  2NQB C;  5AVC B;  2J9O A;  1K54 C;  4D2O A;  1KDS A;  1P3M A;  5EVI B;  1NXY A;  2ZJ9 A;  3OCN A;  4IBF A;  2WYX A;  2Y2I A;  5C3I B;  5B24 A;  3REH C;  4WV4 B;  4P85 A;  3R45 A;  3M2J A;  1JTG A;  4ZUX D;  2WUQ A;  5AV9 B;  2NQB A;  2J8P A;  4IBG A;  3WAA D;  1K54 A;  1DJA A;  1NYM A;  1K4F A;  3L29 A;  4E3M A;  2ARO D;  5AY8 A;  5DNM B;  4OOL A;  1K57 C;  4XXR A;  1RGY A;  5HX9 A;  3A1I A;  3RJU A;  2ZC6 B;  3GQZ A;  3X1V B;  4XUJ C;  2NZD D;  1NRF A;  2Z2M B;  3AGD A;  3PBN A;  1YU1 A;  5B32 D;  1HD8 A;  3AZJ D;  3ZG5 A;  1PZP A;  1LHY A;  3AZE C;  3BLM A;  3M2K A;  3H0L C;  3BRM A;  3X1U A;  1IYO A;  2WZX A;  4Q8I A;  4DQY B;  1M1A B;  3QHY A;  4H9O A;  4XUJ A;  4WYY A;  5B1M C;  2Y2L A;  4K0X A;  2UWX A;  5FAO A;  4CSR A;  3Q81 A;  5FI2 A;  5CEB A;  2ZQC A;  4X53 A;  3AZE A;  1H8Z A;  2ZQ8 A;  4X56 A;  1SKF A;  3A3J A;  3C1C D;  3MZF A;  5B40 A;  3ZG9 B;  3ZHH A;  4OJP A;  3MXS A;  1P3O C;  1ID3 A;  2DF4 C;  3REI B;  4KUD D;  1ERO A;  4QLC D;  3REJ D;  1SDN A;  3EQV A;  3MGR B;  3IF6 C;  3O3V A;  5CP6 C;  4UUZ A;  2RL3 A;  3X1S D;  4Z5T B;  4J8U C;  3IWQ A;  4CJN A;  1E25 A;  5AQB A;  5CPK D;  4DRA A;  4WEK A;  3B6G C;  5CHU A;  3AZK C;  1K4E A;  1BH9 A;  3LO7 A;  4J8X B;  4OVD A;  2JCH A;  2P74 A;  4HEF A;  3AV2 D;  4ZBJ B;  4WM9 A;  1KGF A;  3W96 A;  5CTN A;  3BFF A;  4H8R A;  5FI7 A;  1MWR A;  5DNN C;  4BD1 A;  4IBR A;  3PBQ A;  5E5A B;  2ZD8 A;  5AV6 B;  3IXH A;  5JRG C;  4JJN A;  3WX7 A;  3MGS B;  1Q9C A;  3CJM A;  2ZC5 B;  5G49 A;  4EBP A;  5BNV B;  3LZ1 D;  2BYM A;  3HLB A;  1MKI A;  5B33 A;  5CPJ C;  1ZLA C;  2WZZ A;  5AV5 C;  3HLF A;  4KG5 A;  4EV4 A;  1CI9 A;  4DXB A;  1BSG A;  5KMW A;  2RVQ D;  1KE0 A;  1TZY D;  5JRG A;  2PBY A;  3MGQ C;  3UN7 A;  4WU8 A;  4UA7 A;  5B0Z B;  3EPJ A;  5AVC C;  1H5X A;  1W8Y A;  1U60 A;  1WWS A;  4IBD A;  4Z66 B;  3KXB A;  5CPI D;  2ZC4 B;  4NYU A;  5FDH A;  4YS3 D;  3TU4 D;  5CPJ A;  1S32 A;  4F94 A;  1IYS A;  3FWL A;  1P34 D;  4QHC A;  1CEF A;  4MBF A;  2P9V B;  3BM6 A;  4N1X A;  3AV1 C;  4N1H A;  1F66 D;  3MGQ A;  2CV5 B;  3AN2 C;  3WTP C;  3V5M A;  3ZDJ A;  3LEL C;  3DWK A;  3VSK A;  4WMC D;  3KSY A;  5KDM A;  4NZ4 A;  3L25 A;  5KZH A;  4R8P D;  3LZ0 A;  3AZL B;  3O87 A;  4DF6 A;  3AZH A;  3AZN D;  1AOI D;  3IWI A;  5B0Y C;  1YLP A;  4OQH A;  3AN2 A;  3MVD C;  1HTA A;  3GTC A;  3WTP A;  5B31 C;  3C1B C;  3LEL A;  3TOI A;  4R0Q A;  3Q7V B;  5EVL A;  1L2S A;  3V9R B;  3WA9 D;  4K0W A;  1R4V A;  3HUO A;  3AZF B;  2HIO C;  3L26 A;  1WYB A;  2W8S A;  5HAP A;  1MPL A;  2R9X A;  3VH6 A;  4KZ3 A;  1M18 D;  3AFA D;  3C1B A;  3G35 A;  4WNN A;  5U47 A;  4JXW A;  2ZC3 B;  3N4I A;  3LJA C;  5A93 A;  4QY6 A;  5CGS A;  2ZM2 A;  4NYY A;  1PI4 A;  4IVI A;  4WU9 D;  1MXO A;  3B0B A;  2Y2P A;  4FH2 A;  2HP5 A;  4U3T A;  1NZU A;  4Y0T A;  3Q07 A;  2EXB A;  1YLJ A;  4KGC A;  2VQR A;  1B6W A;  1KX3 B;  4JLF A;  1C3B A;  4DRT A;  1ZC2 A;  4YIN A;  4YM6 D;  3LJA A;  2F8N B;  1G68 A;  3LEZ A;  4DKI A;  5B2J B;  4CPK A;  1YU2 A;  1P3B B;  2EXA A;  1CI8 A;  2ZMA A;  2A49 A;  5AVB B;  3KUY D;  3A3I A;  3NI9 A;  3BYD A;  3VOZ A;  3UNW A;  2ZY2 A;  4QJG A;  1KX5 A;  5JYO A;  2DQN C;  1AXB A;  5CHM A;  3FYZ A;  3B0C T;  3S22 A;  4R1G A;  2FJ7 D;  5B2I C;  1YUE A;  2XDM A;  1P3I D;  3UTB D;  2J8Y A;  4AWL C;  3MNN B;  3V39 A;  1N9B A;  3AYW D;  1BFM A;  3NDE A;  1CEG A;  2Y2Q A;  5B24 B;  1ES5 A;  1TVF A;  4E3I A;  1PI5 A;  3R45 B;  4WZS B;  1JWV A;  3L28 A;  3PBS A;  2NQB B;  5BNX B;  3G30 A;  3AZG C;  1P3K C;  4ZAM A;  2YFW A;  3B6F A;  1SHV A;  3REH B;  3P5J B;  3AZI C;  3WRT A;  1M19 D;  1IKI A;  3G31 A;  4H9P B;  4KZ9 A;  3SS3 A;  3H0M C;  2BG1 A;  3AZG A;  5EVI D;  4HBU A;  2EFX A;  5BT1 D;  1BLP A;  4GDB A;  4ZUX A;  3HLW A;  4U0T A;  4H9O B;  2Z2L B;  3WS5 A;  4XUJ B;  1LL5 A;  3WAA A;  5BO0 A;  4LV1 A;  5FUG B;  5AV9 D;  4UAA A;  2WGW B;  1FSW A;  4CSR B;  4G91 C;  3AZE B;  3SH8 A;  5DNM D;  1W8Q A;  3TG9 A;  5F99 C;  5F1F A;  2NZD A;  4QD4 A;  3MGP C;  3X1V D;  3WKJ C;  5B32 A;  3O62 C;  3AZJ A;  5B1M B;  4BQM A;  1MWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...