2Y2LA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e06)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
489
structure length
472
Chain Sequence
ISEITYSDGTVIASIESRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 162
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2lA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2lA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2lA02
4OKPA 5CGXA 2X02A 3IXGA 3VFHA 2WAEA 4PM9A 5AQ9A 1I2WA 5EVLA 4BD1A 3PBNA 3HUNA 1YLTA 1IYSA 3LY3A 4B4ZA 2E8IA 2FFYA 2HP5A 2HDUA 3Q82A 3OPLA 3UDXA 2OV5A 4UA9A 5EOEA 3SS3A 3M2KA 3G32A 5EE8A 1FOFA 3HL9A 1JWVA 4OLGA 3EQUA 4OP5A 1U60A 5HX9A 1CEFA 4JF5A 5CHUA 3SH9A 1FCMA 3I7JA 5CXWA 4Y0OA 1NZOA 4S2NC 1JTGA 4OONA 5EVIA 3VP4A 4EBLA 4LCLA 1PW1A 1W8QA 1VM1A 3HLFA 5E43A 4E3IA 4OLDA 1N9BA 3WS0A 1ES4A 4U0XA 4DE2A 2WKEA 3ITAA 3MFDA 4BL2A 4E3JA 1YMSA 2EX9A 4P87A 1J9MA 4GD6A 3CMZA 4OPQA 2J9PA 4OOLA 4ZBEA 4ZJ1A 5E2HA 3HLCA 3AGFA 2ZD8A 3HLDA 4X6TA 1WYCA 3MXSA 4DE0A 3BFCA 3G4PA 1E3UA 3BEBA 3ZNTA 1YLZA 4R4RA 3C7UA 3W4OA 4IVKA 3O86A 3MZFA 4S2JA 4GKUA 3PTEA 2GDNA 4KG2A 1K54A 5AQBA 4ZJ3A 2WADA 1FCOA 1YT4A 3IWQA 3BYDA 4UAAA 1OMEA 4KQRA 2Y2OA 4E6WA 4Y0UA 5HFOA 1TDLA 5G18A 2Y2NA 1KE3A 5F83A 2ZC4B 3GMWA 4KG5A 3RXXA 1I5QA 4QY5A 2Y2QA 2PU2A 4S2IA 2WZXA 2DNSA 4XUZA 3VOYA 4JXWA 5L2FA 4GNUA 2XFSA 3DTMA 1RCJA 5AQAA 3N7WA 1KDWA 4PMAA 5HAIA 4WMCD 3HREA 1MWUA 1XX2A 4PPRA 5GL9A 2Y4AA 3S1YA 5FQQA 4OQGA 4R3BA 4ZJ2A 1RP5A 5CEDA 2IWCA 5DF8A 1H5XA 3OPPA 4X56A 5HL1A 2CC1A 2ZLYA 5KMWA 3LEZA 3HLBA 2VGJA 4S2NA 3SS5A 5E2GA 1DJBA 1K38A 3AGEA 5CGSA 1NRFA 5GLDA 4CPKA 1ES3A 2XD1A 2G2UA 5CEBA 3N6IA 3G31A 4S2LA 5CERA 2Y91A 1KE4A 2XK1A 4XUXA 2J8YA 3IWOA 4Y0TA 1NJ4A 1Q2QA 1TDGA 3RJUA 3FYZA 4RX3A 1BSGA 2HP6A 4KZ7A 3WRZA 1LL9A 1PIOA 1TEMA 3ZNYA 4JPMA 5GHZA 3SH8A 1HZOA 3LCEA 2XGNA 2R9WA 4R4SA 5GHXA 4DE1A 3MKFA 1VQQA 5A93A 4KZ6A 2ZQ8A 2ZM0A 4OPRA 1K6SA 5DF9A 5FI6A 1L0GA 3ZDJA 4B88A 2UWXA 1GCEA 1MXOA 4KQQA 4K0WA 2OSUA 2ZM8A 4K91A 4X68A 1PWCA 4ID4A 1H8YA 3UPNA 5FQMA 3MZDA 1KVMA 1G6AA 1K56A 1MBLA 3ZG0A 4MBHA 4RYEA 4KZ4A 4EQIA 2RCXA 2ZQCA 5A91A 3PBTA 5AQ7A 3M6BA 2BLSA 4PM6A 2EX2A 2ZM2A 1XP4A 4C75A 2P9VA 4HBTA 2Q9MA 3CG5A 3BM6A 3DW0A 3UY6A 2FFFB 1IYPA 1TVFA 2V20A 1SHVA 2QMIA 3Q81A 1LHYA 3FKVA 5HW3A 2Y2GA 1QMFA 2WGWA 4GDNA 4KQOA 4OPYA 3ZHHA 2XEPA 1GA9A 2ZQ9A 4QB8A 3UDFA 2JCHA 4DXBA 3NDGA 3IQAA 4X55A 3BLSA 1PYYA 4NK3A 1YMXA 5GHYA 1GHMA 4NETA 3G2ZA 2ZMAA 1JTDA 1BLSA 4L0LA 4OQ0A 4P0MA 4Z9QA 5FAQA 5TGFA 3VP1A 4DKIA 2WAFA 4WYYA 3EQVA 4C6YA 1GA0A 3WRTA 1W79A 1XKZA 3IHBA 4R1GA 4EBPA 2V1ZA 4BJPA 1O07A 1LLBA 1XXMA 4LV0A 5KSHA 4LENA 4MBFA 3IWIA 1NZUA 1PI5A 5M19A 3OZHA 2OLUA 3IF6C 2ZQ7A 1BLPA 4WZ4A 3IXBA 4JXGA 3GTCA 5FQJA 2DCFA 4EUZA 5KZHA 2V2FF 4RA7A 1YLPA 3VP0A 2H5SA 3O3VA 2Y2HA 2JC7A 2Q9NA 3HLEA 5CTMA 5KSCA 4M3KA 5HAPA 4JLFA 5FASA 2Y2MA 2P9VB 5CECA 3UPOA 3Q1FA 1K54C 3A3JA 1BTLA 4R3JA 4OH0A 4WM9A 4KZ9A 3ZVWA 4EBNA 4OQIA 3OPRA 3SH7A 1FR6A 2B5RA 5U47A 5F1FA 4X69A 1K57A 1SCWA 4KENB 3VFFA 4IVIA 1C3BA 1O7EA 3ZGAB 3HLWA 4FD8A 4OP8A 1K55A 1W8YA 3ZVTA 4IBRA 2I72A 1ERMA 2HP9A 4P85A 1ALQA 2Y2LA 3UO9A 2EX6A 1HTZA 5F82A 1YQSA 2ZJ9A 1W7FA 1Z6FA 4GB7A 2XD5A 4JBFA 2EXBA 2R9XA 3N8RA 2WYXA 4WBGA 1BULA 3UDIA 4OVDA 3W4PA 1K4FA 1ZG4A 4QY6A 2HDRA 3IXHA 3OC2A 5HAQA 4QU3A 3G2YA 4HESA 2XDMA 2X01A 4GDBA 3N4IA 3W8KA 3ZG5A 4JF4A 3IH8A 1M40A 5FQKA 4S2PA 5JYOA 3E2KA 4OOMA 5EECA 3WS1A 4KG6A 5TR7A 1PZPA 4S2MA 1MWTA 1ZC2A 5EPHA 3UN7A 2ZC5B 5FQIA 3NDEA 4MNRA 4OPZA 4N1HA 5FSRA 3IF5A 4N92A 5FAPA 4MEZA 1PI4A 2Y59A 4K0XA 1H8ZA 4YFMA 3P09A 4RX2A 1L0FA 1CEGA 2IWDA 1ONGA 4FCFA 3NY4A 4BD0A 1K57C 3BFFA 3UE3A 4DE3A 1Y54A 1EROA 4JF6A 4S2OA 3MBZA 3FZCA 4U0TA 4LV1A 1FCNA 3CZDA 4S2KA 2EXAA 4PM7A 1YLJA 4LV2A 3Q7ZA 5GLBA 3V5MA 3M6HA 1KE0A 5CGWA 1PW8A 5CRFA 3HVFA 5IHVA 1NYMA 3TOIA 3A3DA 3GQZA 1IKIA 2WKHA 3WS5A 2ZC7A 3NBLA 3WS2A 3BECA 3GR2A 1QMEA 3DWKA 2WZZA 1ZKJA 3DWZA 4KZBA 1NY0A 5J8XA 1XGJA 3VP3A 3A3FA 1WE4A 4N9LA 5D3OA 4BLMA 3V3RA 1EWZA 2Y55A 2BG1A 5FATA 2XF3A 5BOHA 1ONHA 1BT5A 1XA7A 1LI9A 1DY6A 1ESUA 3UNWA 1XGIA 3BLMA 4DF6A 1SKFA 4LCMA 3WWXA 1RGYA 1WYBA 3BFEA 4ZAMA 1L0EA 3ZCZA 1ES5A 4HBUA 2X71A 5E2FA 5EVIB 2Y2IA 3Q07A 1FR1A 3C4OA 3IT9A 3WS4A 4GZBA 2PU4A 4C3QA 3B3XA 1FSYA 1LL5A 2EFXA 1SDNA 3PBSA 3MXRA 4FSFA 4GOGA 1FQGA 4UHUA 1KVLA 1XPBA 3E2LA 3V50A 1HD8A 1ESIA 5EVID 3W4QA 4QD4A 4B4XA 4QJGA 3TSGA 4E3LA 5DTSA 1Q2PA 1YM1A 3NI9A 3N8LA 5E2EA 1IEMA 3D4FA 1KGEA 3IHAA 3IH9A 3ITBA 2J7VA 2ZC6B 5CHJA 3G30A 3JYIA 5TFQA 3VMAA 4BQMA 4WELA 1JWZA 3LO7A 4E6XA 2J9OA 2A49A 2ZQAA 4KZAA 4E3KA 2WKIA 1S6RA 4A5RA 1NYYA 4CJNA 1S0WA 4GD8A 1K4EA 4UA7A 3M2JA 3OCLA 3HUOA 4X53A 1BLCA 2Y2PA 3BRMA 2HDQA 1GHIA 3VP2A 1K6RA 1KDSA 4U3TA 4E3MA 3ISGA 4DDYA 3GVBA 1K55C 3AGDA 1L0DA 3S4XA 3SOIA 3VSKA 2EFUA 2XLNA 2DRWA 3NCKA 5CHMA 3QNCA 3V3SA 3P98A 1FSWA 4ZTKA 4DDSA 3HLGA 1BUEA 5M1AA 1JVJA 3QNBA 2HDSA 5DF7A 4F94A 5DTKA 3S22A 3ZG9B 4O7DA 2WGIA 5EOOA 3RXWA 3SS4A 2WGVA 2C5WB 4XXRA 4KZ5A 5GLCA 3UE0A 1DJAA 2ZC3B 5GLAA 3OPHA 3IF6B 5EVIC 1YLYA 5HARA 1IYOA 1YLWA 3N8SA 3NIAA 2Y2KA 3HBRA 2Z2LB 3QHYA 4WZ5A 3VSLA 1K56D 2VGKA 3G34A 1PWDA 3BFDA 5M18A 4ZDXA 5FAOA 2EX8A 4DRTA 3MKEA 3A3EA 5I94A 2C6WB 3GV9A 1L2SA 1BZAA 1KGFA 4E3OA 1DJCA 4WEJA 3V39A 3PBQA 5FA7A 4MLLA 4LV3A 1BLHA 4H8RA 4UA6A 4KZ3A 2A3UA 1N4OA 4EV4A 1K25A 4GN2A 3GRJA 2XR0A 1HVBA 1ERQA 4QHCA 4R0QA 3LY4A 4YINA 4E3NA 3HUMA 1GHPA 1LI0A 5JYPA 1JWPA 4HEFA 2RL3A 4JXVA 2QZ6A 2WK0A 2Z2MB 3BFGA 5DVAA 3G35A 4PM8A 5EUAA 2JBFA 5F1GA 1IYQA 2XQZA 4DXCA 1MWRA 2PBYA 4WEKA 5FQ9A 2IWBA 1PWGA 4D2OA 1IKGA 1NXYA 3ZFZA 1EI5A 2JE5A 1MKIA 2OLVA 3OCNA 2H0YA 3ZG7B 1KGGA 3C4PA 4KZ8A 1ES2A 3MZEA 4IEDA 5FDHA 3A3IA 3ZG8B 3IF6A 1G68A 4RVAA 2WGWB 4PM5A 4Q8IA 3IXDA 1PZOA 3C7VA 1MY8A 1RGZA 2G2WA 4OQHA 1SDEA 4JXSA 5CTNA 3NC8A 4OOYA 2WUQA 1E4DA 4IBXA 4EWFA 5FI7A 1CK3A 3FWLA 3PBRA 4BENA 3FV7A 2XFTA 2XH9A 1E3UD 1CI8A 1M6KA 2H0TA 2P74A 3PAEA 5FI2A 3FKWA 2ZQDA 3GSGA 3TG9A 3CJMA 5A92A 1MPLA 1CI9A 4R23A 1W5DA 3O88A 4P6BA 3UE1A 4FH2A 4BL3A 3Q7VA 5A90A 3UPPA 4N1XA 5DTTA 1MWSA 3O87A 2HPBA 1IELA 3PBOA 3VOZA 4MBKA 1E25A 4JKTA 2H10A 4WMCA 2Y2JA 4Y7PA 3C5AA 3PAGA 1I2SA 1ZG6A 2QPNA 4N9KA 4FH4A 1XA1A 3Q7VB 1AXBA 4WZ5C
chains in the Genus database with same CATH superfamily
4OKPA 5HD3A 5AQ9A 1P3KD 3X1SD 3W99C 3PBNA 3HUNA 3KSHA 1IYSA 1DP9A 4GH9A 4X1MA 5B33B 4H9OB 2HDUA 4D60A 4HP4A 5B2ID 5AV5D 2YFVB 3M2KA 3S7PA 2VV7A 4B93A 5DNND 3EPKA 3HL9A 3EQUA 1CEFA 1EQZB 5GSUC 4RQ9A 4OONA 2XSSA 2HUEB 1XFNA 1F98A 4EBLA 5KDMA 1PW1A 3H0MC 1VM1A 1W8QA 5E43A 2NZDD 4ZBJC 3A6ND 2F8NB 4BL2A 2EA9A 3CMZA 5J3WA 1OT9A 1KX5C 4ZJ1A 2BASA 1TAFB 4KHAA 1S4RA 3HLDA 1WYCA 4DE0A 3RTYA 3C2WA 1E3UA 1OT6A 4WU8B 4LFUA 4IVKA 4X23C 3MZFA 4LGWA 2GDNA 5GSUB 4ZJ3A 2WADA 2CV5D 3MGPD 3H82A 3IWQA 4UAAA 5C5KA 4E6WA 1TDLA 5G18A 3W96D 1KE3A 2ZC4B 3W98D 4XT2B 3MQLA 2Y2QA 5B24B 3LELC 3REKD 2FJ7A 2WZXA 4XUZA 4GNUA 2XFSA 3DTMA 3MJQA 3MGRD 2L1MA 1ID3A 1N1JB 5GL9A 4PPRA 4ESPA 4ZJ2A 5CEDA 4R6LA 5FL3A 3LZ1C 4WU9B 3H7WB 5HL1A 3NQJA 2ZLYA 5KMWA 1TAFA 3AZLC 4OJOA 2ZOHA 1DJBA 3W99D 3REJD 4IBBA 5CGSA 4QLCA 2XROA 3G31A 1KE4A 2XK1A 2IOUA 4JGRA 4Y0TA 1NJ4A 3K2NA 5BT1D 4WU9A 1N9LA 1LL9A 1PFLA 1P34B 3ZNYA 4JPMA 3B33A 2R9WA 4DE1A 3AN2B 1VQQA 4Y13A 5BT1C 4I5SA 5CPIB 5FI6A 4J8WC 1L0GA 2UWXA 1MXOA 1PWCA 5FQMA 4WU8C 1G6AA 1Z09A 1MBLA 3R7WA 2ZM5A 3TW8A 5A91A 1M1AD 3C38A 2ZM2A 3FKEA 3VOLA 3EGDC 3DW0A 2RIQA 3B0CT 1IYPA 4QLCB 4QNLA 1QMFA 4KQOA 4JJND 3AFAA 3MFXA 3ZHHA 2ZQ9A 3AZMC 2V1BA 4JJNB 3AZLA 4NK3A 3F1PB 5GHYA 3QP2A 2ZMAA 1JTDA 3LZ0D 2QYBA 5FAQA 5TGFA 4EXOA 1W79A 4BJPA 1LLBA 1XXMA 5CHLB 1NWZA 4LENA 5JA4B 3JPUA 2PYOA 1BH9A 3OZHA 1P3PD 3IF6C 4IUKA 2HJ9C 3GTCA 5FQJA 1MZUA 4Z2KA 2V2FF 5HPFA 3VP0A 1G28A 2H5SA 3FG8A 2Q9NA 5KSCA 1T1AA 1D7EA 4IUHA 3UPOA 3X1SC 4WU9D 1J7MA 3A3JA 3F1NA 3OPRA 1FR6A 1P0ZA 3B6FD 5U47A 5F1FA 4X69A 5FUGA 1A0KA 2PDRA 1C3BA 3S7OA 4FD8A 2W27A 1W8YA 4L9GA 4IBRA 4NXGA 4YM6C 1D06A 4I39A 4H9QB 1HQ3D 3C30A 3VH5W 1HTZA 5E5AD 2ZJ9A 4J8XD 3X1SB 2XD5A 3C1CC 3W99A 2VV6A 2K7SA 4HESA 5HWVA 3ZG5A 5TJJA 3E2KA 4OOMA 3X1SA 3WD1A 4NEED 2XRNA 3KSFA 5AVEA 2XA7S 3UMEA 5B40A 5DNMC 1MWTA 4GJ4A 3UN7A 5B32G 4MNRA 5A8BA 3WTPE 1ACFA 5AV5A 5B2IA 3W96B 3EWKA 3MGRA 1H8ZA 4YFMA 3U2AA 5DKKA 1L0FA 2IWDA 1E8BA 3W97B 1WWSA 3MNNA 3CPTB 3BQ8A 1EROA 3P01A 3IBRA 1FCNA 5B31A 1YLJA 4LV2A 3Q7ZA 5F68A 4CLCD 4GW9A 3UTAC 1S1YA 2P7JA 4HOIA 3WS5A 2OAQ1 3DTKA 1QMEA 1NY0A 5B40D 3W99B 1BYWA 2Y55A 1ONHA 1BT5A 4X1LA 4HQAA 2Y8HA 3IS2B 3H7WA 1RGYA 3WD0A 1L0EA 3ZCZA 3SZTA 4AWLB 4YM6A 4I3IA 2ZL1B 3A0SA 3MGRB 2BYMB 3TU4D 3L28A 4GOGA 3MXRA 1XPBA 3LIAA 3HSHA 3S7NA 4QD4A 3UTAA 4B4XA 1P34A 1YM1A 3N8LA 3D4FA 3JVVA 5B31C 2ZC6B 3VMAA 1AOID 3LO7A 5CPIA 1WA9A 2J9OA 2A49A 3BJNA 4E3KA 1P3KA 1P3BD 3S7QA 4CJNA 2INWA 3M2JA 1B6WA 3HUOA 2HDQA 5B40C 1IOUA 3DTIA 5AV9D 4AFIA 3B6FA 3AGDA 5B24C 3A6NB 5GT3D 3VSKA 4GLQA 4J8XB 5BNVB 2VK3A 4II7A 4CLCC 4MCWA 1FSWA 3CWFA 4DDSA 1BUEA 5M1AA 5AV8A 5DF7A 4KUDA 3SW1A 3HJIA 2I9VA 3F1PA 4O7DA 4H9SC 5CPKC 3PHYA 3UE0A 3AZHB 5GLAA 1F66B 3WA9C 3MGSD 4R38A 5BNVA 4NXEA 2M1CA 3NIAA 2Y2KA 2KLIA 1OGGA 2PR6A 5B2JD 3LR4A 1K56D 1PWDA 3W2ZA 4BMWA 4DRTA 3REHD 2C6WB 1OJ5A 1KGFA 4X23B 1DJCA 3MGSC 3T4KA 2BYKB 3T4LA 4MLLA 1BLHA 4EV4A 4J8WD 1K25A 2DF4C 3AZHC 1ERQA 5B0ZB 1HLUP 4H9RA 1OGBA 3X1UA 1P3IA 1JWPA 4YS3D 2OWHA 5EUAA 1M19B 1Q9CA 1IYQA 3IP4C 5BS7A 3UB8A 5DNMD 1H3QA 4WEKA 3AZFA 5FUGB 5FQ9A 1NXYA 2UV0E 2JE5A 2OLVA 2VJWA 4LD9D 1P9WA 3MGQB 2LY8A 4GHLA 4IEDA 5HL6A 3WAAB 1G68A 2WGWB 4Q8IA 1PZOA 3C7VA 5EFWA 2O99A 5L07A 1P3BC 1S1ZA 1VEUA 4IBXA 3PBRA 1Z2CB 3WKJB 3LZ1D 2H0TA 3MQ0A 2W3EA 3TG9A 5MC7A 3MGQA 4NE6A 1CI9A 3H9WA 4R23A 3UT9C 3O88A 4XUJC 3UE1A 3KUYD 3UPPA 3O62B 5B40B 1MWSA 3MGRC 2HPBA 3PBOA 1E25A 4Z66D 2VQRA 3PAGA 5TBMA 4WN5A 4E04A 4IBKA 3WA9D 1AXBA 1P3MC 2VA0A 3AZIB 5B31B 1I2WA 2G5IC 3E0YA 3LZ1A 3WAAA 5AVCD 1UR9A 5B0YA 3AV2A 4B4ZA 2FFYA 2HP5A 1H8PA 2PT7A 1YUEA 2V0WA 3E98A 3X1TC 1TS6A 4O8GA 3REJB 3G32A 1T1BA 4HIAA 5EE8A 5C3IC 2ZY3A 5FEGA 2O9AA 3NJAA 5BO0B 3VH6A 4OP5A 3FDDA 5HX9A 2KDKA 3AZGC 5CXWA 3AZFD 3R45B 1KX5B 4Y0OA 3T1RA 1A7WA 3VP4A 1L6JA 4LCLA 1P97A 3HLFA 1YSQA 4E3IA 4JJNC 4OLDA 1S32B 1MKMA 3MFDA 4E3JA 4P87A 4O01A 4HH3A 1GOIA 3QP8A 3HONA 3BEBA 3ZNTA 5B32B 5C3IB 2PYPA 3W4OA 5FDSA 4QLCD 4IBDA 3MGPB 5CP6D 1STZA 3AYWA 3UTBC 1FCOA 1OMEA 2ZMVA 3MVDB 4KQRA 3BW6A 2Y2NA 5F83A 3KUYC 1EQZC 4G3KA 1WWIA 3EPLA 2QWSA 1VETB 3VOYA 4HNBA 3T50A 2F8ND 2R78A 5AQAA 4UUZA 2PRFA 1P3FC 1S66L 3X1TA 3AZKB 1XX2A 1ED7A 2Y4AA 5LBRA 5B31D 4R3BA 1RP5A 4R8PD 2JKRI 1H5XA 3OPPA 3LR0A 2O9CA 4LPZA 3SS5A 1TZYC 1K38A 1ES3A 3T4TA 1V9YA 3REID 2ZOIA 4XUXA 2J8YA 2L5AA 1K0KA 3EGXC 3FYZA 4RX3A 3UTBA 3MXQA 3K3DA 2O9BA 3LEQA 3WRZA 3D3OA 4HMCA 3LCEA 4F3LB 5CP6B 2J80A 1W2EA 5GT3A 5B24A 2BYKA 2FJ7B 4ETXA 3TU4A 4B88A 3A0VA 5GXQC 1ID3B 5B33A 1NLZA 5B31G 3MZDA 4LRYC 5HSQA 4F3LA 4QLCC 4R8PA 1M19C 3P7NA 3M6BA 4PAUA 2HZ5A 5AVCB 2BLSA 2E8JA 2EX2A 1XP4A 5HD5A 3MVDC 1EQZA 3KSIA 3KYEA 4M4XA 2Y79A 3UY6A 4BBUA 1SHVA 1TZYD 5KDMB 3FKVA 1ZTUA 2WGWA 2NZDC 4GHAA 4WL9A 2F8NA 2XEPA 4QB8A 4Y5FA 2GJ3A 3IQAA 4X55A 3QP6A 4ZUXD 4KHAB 3U4LP 3G2ZA 4WUJA 1P3FD 5AVCC 4DKIA 1GA0A 5GT0D 3UT9D 3L29A 3IHBA 3X1TD 1DRMA 2YKHA 2EWVA 5KSHA 3QP4A 4Z5TB 5M19A 3HJKA 5BPVA 1PDCA 1GPFA 4WZ4A 3IXBA 4NYUA 2CV5A 1YLPA 3EEHA 3O3VA 2JC7A 5CTMA 3A6NC 5HAPA 4KGCB 5CECA 3Q1FA 3O62C 4R3JA 3MSHA 4EW7A 4EBNA 4G92C 4OQIA 3N3FA 2B5RA 3AN2A 2CV5B 1SCWA 4KENB 1JFIB 5G49B 4IVIA 3VFFA 3ZGAB 4M6BA 3NULA 5DNNC 3AZNB 4NZ5A 2I72A 1H0GA 2HP9A 1P3PA 2EX6A 5GXQA 5F82A 2B18A 3NQUA 4JBFA 1QO6A 1JFIA 2J3WA 5CPJC 1T3UA 1P3KC 1BULA 3UDIA 4OUIA 4OVDA 3W4PA 1K4FA 4CLCA 4NG2A 5JA4A 1ZG4A 3OC2A 3AYWD 4QU3A 4HHDA 3KXBC 4GDBA 3L9KA 3W8KA 4JF4A 4KG6A 5IS1A 1E15A 4S2MA 3AFAB 3VH6T 2ZC5B 3NDEA 5B0ZC 3EPJA 4JJNA 4OPZA 4N1HA 4J8VA 1CQAA 5AV6A 1XJ6A 1XJ4A 2B95A 4N92A 3AZEA 5G4YA 3AZMB 3BFFA 2HV1A 4DE3A 4CQHA 1Y54A 5G49A 4S2OA 3FZCA 5GT0C 2EXAA 4PM7A 3CUEC 4HI4A 1GSVA 3HVFA 1TS0A 3TOIA 2GZAA 5E5AA 5GXQB 3GQZA 3BECA 2HGVA 3DWKA 1BFMA 1ZKJA 3NOPC 3VP3A 2F2AC 1YU2A 3C1CA 4CLCB 2A2LA 5D3OA 5CPJA 5FATA 5BOHA 5F99A 4DRAA 1XA7A 1KX3C 2W3FA 5AV6D 5GT0B 3X1VA 3C1BD 1XGIA 3BLMA 1SKFA 4LCMA 4Q0HA 1WYBA 3BFEA 3WTPA 4ZAMA 5CPKB 3MR0A 3REJC 3W98C 1ES5A 2X71A 3W96C 3Q07A 3F1OB 1FIKA 4GZBA 3BY8A 3UB7A 2ZY4A 5HDSA 5F99B 1YU4A 4C3QA 5B1LA 3B3XA 1FSYA 2EFXA 4H9QA 1LL5A 4UQIS 4UHUA 3E2LA 4QJGA 4XUJD 3MNNB 1Q2PA 3F1OA 5E2EA 1UWNX 3V9RA 2FZ0A 3IH9A 5B1LB 2KOIA 5E5AB 4KGCD 2Q0OA 4E6XA 2WKIA 4A5RA 4NZ4A 3WD4A 4I3JA 4GD8A 3OCLA 3LELD 1XJ3A 3CUEA 1W1YA 2Y2PA 3A1KA 1M1AC 1GHIA 2JN7A 3VP2A 4E3MA 5F69A 3KX0X 1KX3A 4DDYA 3IS2A 1K55C 3LIBA 3S4XA 5AV9A 2EFUA 1N1JA 1SZVA 4ETZA 4HMEA 3FC7A 4XUJA 3T4SA 4EETB 5AJGA 1P3FB 4ZTKA 4ZUXB 3BWLA 4TX8A 3ZG9B 3T4OA 3SS4A 5GT3C 4KZ5A 2NUPC 3X1VD 4CLCE 2YFWA 1Y4OA 3V9RB 4XT2A 3HBRA 2P08A 4CAYA 1KX4D 1X0OA 2HIOC 4PHTA 3KS4A 5M18A 3WA9A 4ZDXA 5FAOA 4MB3A 1KX3D 3MKEA 5I94A 1BZAA 3LFVA 4E3OA 3V39A 3PBQA 2YFWB 4LV3A 4WLAA 2A3UA 1N4OA 1E6ZA 4H6JA 3GRJA 3NQJB 4QHCA 4LD9C 4R0QA 4YINA 3EPHA 3HUMA 5EM1A 2WK0A 4DXCA 3KUYA 2JBFA 3R7WB 2QKPA 2HIOB 1P3FA 2JKFA 3KSGA 3B0DB 2IWBA 2L0WA 1PWGA 1IKGA 1ID3C 5B32D 1YKDA 1EI5A 1MKIA 5AV8B 3OCNA 3B0CW 4BWIA 3C4PA 1ES2A 3MZEA 3A3IA 3ZG8B 4EU0A 4PM5A 3IXDA 3AZHA 2G5HC 1RGZA 1SDEA 5CTNA 4OOYA 4Y15A 5FI7A 2JSSA 4BENA 3FV7A 4GHIB 1CI8A 1M6KA 5HWTA 4E45A 2P74A 1EAKA 3FKWA 3AYWC 2ZQDA 2D02A 4IBGA 3GDIA 1LSXA 4BL3A 1J3WA 3Q7VA 4N1XA 4XZQC 3O87A 4Z66B 1IELA 3MGSA 2AVXA 3C1BC 2H10A 1KS0A 5B0ZA 2Z6DA 1I2SA 3KUYB 4N9KA 2LB9A 4FH4A 2HIOA 2NQBD 3MNNC 1XA1A 3AZID 2W3GA 2WKRA 3Q7VB 5K5BA 4EO5B 4Y3IA 2HIOD 2NQBA 4PM9A 4LD9A 3KXBA 1KX4C 4DMZA 4EUVA 4BD1A 3D9YA 1YLTA 2A24A 2E8IA 1W1VA 3Q82A 2OV5A 4IJFA 2ZMFA 4EESA 3GECA 3WAAC 4LD9B 1FOFA 4OLGA 5DKLA 1U60A 1P3LA 5CHUA 4XZQA 4NXFA 3LGOA 3SH9A 1FCMA 2FN2A 1NZOA 1JTGA 1M19A 4S2NC 4IBFA 3AN2D 3C8CA 3WD3A 5EVIA 3A1IA 3KWQC 2K31A 1GSWA 1N9BA 1ES4A 3WS0A 4U0XA 5AY8A 2WKEA 3ITAA 3B42A 4DE2A 1J9MA 4GD6A 2J9PA 1T1CA 4ZBEA 3HLCA 4X6TA 4X23A 2MJ6A 3BFCA 3F6TA 3G4PA 1YLZA 4R4RA 3KSYA 3O86A 4JGPA 4S2JA 1E88A 3KXBB 4GKUA 5F5YA 5DNMB 1K54A 5AQBA 5J4EA 1D1JA 2PD7A 5CX7A 1G6OA 2Y2OA 2JKRM 3L7HA 5HFOA 3MS6A 4J8XC 3UB5P 3W97A 3GMWA 3KO6A 3AL0C 1F9IA 4KG5A 3CPTA 1N9OA 4QY5A 3WTPD 4S2IA 3TRCA 3FPWA 5L2FA 5L09A 2VEAA 1P3LB 1RCJA 4YS3A 1KDWA 3CLOA 3TE8A 3VV4A 4R70A 5HAIA 3LZ0C 1BH8A 4ME4A 4WMCD 3HREA 4DJ2A 3S1YA 4NYYA 4IBJA 3QP5A 1F1EA 3P5JB 2IWCA 5DF8A 4HGAC 3M7PA 4NE3A 1KOUA 3LZ1B 1F66D 3LEZA 3VE3A 3HLBA 2VGJA 4S2NA 5E2GA 3REHA 3EEAA 1BH8B 5GLDA 4CPKA 2XD1A 4QPRA 3N6IA 3L2AA 3LJAB 2PYRA 3ULFA 2Y91A 5HDCA 4YM6B 3MGQD 1Q2QA 1TDGA 3RJUA 3W98B 3AYWB 4CAYB 1BSGA 1PRQA 2HP6A 3A0RA 1PIOA 1TEMA 5GHZA 3UB6A 1HZOA 4I3AA 2XGNA 3LJAA 1VB6A 2PHYA 5A93A 3B6GA 4FUWA 2ZM0A 1P3AA 3LJAD 5IT5A 3ZDJA 4K0WA 2OSUA 2ZM8A 1U35D 4K91A 4H6JB 5B0YB 3AV2B 4ID4A 4Q0JA 3UPNA 1K56A 3AV1B 1U35A 1AIWA 3IX8A 4WZSB 4X23D 4KZ4A 4RYEA 4EQIA 2RCXA 1ZLAA 2Z6CA 3PBTA 3E4OA 5AQ7A 4PM6A 2NZDB 5BO0A 3HCYA 2P9VA 3T1QB 2Q9MA 3W97C 2D01A 3BM6A 2M7VA 1S67L 2JKGA 5F6AA 3UTBD 5B1MD 2V20A 5KIZA 1EQZD 2Y2GA 5JRGA 3UTAB 4GDNA 1ZLAB 3AV1D 5B0YC 3AV2C 1VETA 1GA9A 1XFQA 4J8UD 3NECA 3NDGA 3AFAD 3BLSA 1PYYA 1YMXA 2L4RA 2VGLS 1GHMA 1W1PA 1YU3A 4L0LA 4HMDA 2DQNC 3VP1A 2WAFA 4WYYA 4C6YA 3X1TB 3WRTA 1P34C 1F66A 4R1GA 2HJEA 2V1ZA 1O07A 4LV0A 5GT3B 4MBFA 3IWIA 1NZUA 4ZRRA 3MVDA 2OLUA 4DN0A 3AZGA 2FJ7C 3AZJC 1U35B 2DCFA 4IBIA 5KZHA 4B9OA 1TZYB 5F99D 3HLEA 4M3KA 4ARZA 3ZQ5A 3T1SA 2Y2MA 3LIEA 3W97D 3IBJA 3T1XA 5CPKD 4H9OA 1BTLA 4OH0A 4H9RB 4PKYG 3SH7A 3C1BB 2YFVA 1K57A 1P3OA 1PZRA 3HLWA 5AVBD 1ID3D 4ARZB 1P3LC 4OP8A 3TU4B 2CWEA 3AZJB 1U35C 1ERMA 1ALQA 4KUKA 3UO9A 3LUQA 2FH5A 1Y28A 1YQSA 4GB7A 1W7FA 1Z6FA 2IO5B 2EXBA 2R9XA 2WYXA 4MMNA 3KWQD 5AVCA 4HP9A 1F2KA 4Z5TA 3CAXA 3UTBB 3MQQA 2HDRA 5AY8B 3CITA 5HAQA 3G2YA 2XDMA 1G5UA 3N4IA 4KGCC 3OOVA 1M40A 1HQ3B 5FQKA 5JYOA 5EECA 3WS1A 2B02A 4KUDC 3B0BA 5EPHA 5FQIA 4WF0A 5B0YD 3AV2D 1XJ2A 4H9NA 5FSRA 2IA2A 1PI4A 3AZLD 4K0XA 5EM0A 3P09A 1HQ3A 1ONGA 4FCFA 3NY4A 4BD0A 3UE3A 3MQOA 3KS8A 4S2KA 5EVEA 1W63Q 3V5MA 5CGWA 2HF6A 1PW8A 4G3WA 3V67A 1IKIA 4MB5A 1P3PB 2ZC7A 3GR2A 1P3OC 5AV8D 4YS3C 1N9NA 3AV1C 2BTFP 3A3FA 4N9LA 3V3RA 3AFAC 1LI9A 4ZUXC 1DY6A 1ESUA 3AZFC 4Q0IA 2JKTI 3R45A 5E2FA 4MN7A 3WS4A 1W63M 2PU4A 3AZNA 1P3LD 3W98A 3UT9A 1OPXA 1UWPX 1SDNA 3PBSA 4R3AA 1KVLA 5E5AC 4OJ5A 3W4QA 5EVID 2V1AA 4E3LA 5DTSA 2RVQC 1KX4B 5B32A 1IEMA 4KGCA 1KGEA 3AZLB 2ZY5A 3IHAA 5CPJD 5CHJA 5TFQA 3KFUG 3LJAC 3G30A 3JYIA 3UT9B 3VH5T 4WELA 5B2JA 4Z1WA 2ZQAA 4KZAA 1E6RA 3KXBD 1KX5A 5CPID 1CXWA 1K4EA 1BLCA 1YU1A 4GS9A 4NY2A 1S32A 4J8VB 1K6RA 4U3TA 4WNNA 5FEFA 1P3GB 1YAXA 1L0DA 5EV0A 1O6IA 2J3TC 2XLNA 2DRWA 3VE4A 3NCKA 4Z2MH 4GS9B 4IBEA 3LELB 3LZ0B 1MC0A 4WV4B 3HLGA 3DTEA 4NZ3A 1OTBA 3QNBA 4UPKA 3O62D 2WGIA 5EOOA 5B24D 3REKB 4IBCA 3B6GC 2WGVA 3F1NB 3AZGD 1P3AD 4XXRA 5GLCA 2ZC3B 3RELC 1KX4A 1OTAA 5EVIC 1YLYA 5HARA 1IYOA 1OJGA 1YLWA 3LELA 3UB9A 3VSLA 2V8FA 4Z2GA 2J8PA 5HZHA 1KX5D 1S32C 1YSPA 4UUZB 1P3PC 4H9SA 5CPKA 4BBVA 3GV9A 1P3GD 1L2SA 2YKFA 4LRZE 3RELD 3AZKA 1S4SA 5L10A 4O0PA 5FA7A 3WAAD 4H8RA 4UA6A 1TZYA 1LL8A 2VV8A 4KZ3A 5B2JC 4E44A 2XR0A 1HVBA 5AV9C 1EW0A 1LI0A 2KX6A 2QJ5A 2QZ6A 4WJ3C 2Z2MB 3G35A 3C1CB 5F1GA 2XQZA 2PBYA 5CPJB 3LZ0A 1P34D 1UGUA 4R8PB 3FPVA 5GT0A 3X1VB 4J8WB 3AZJA 4KZ8A 3LIDA 4RVAA 5B2IC 5AV5C 3CHWP 4J8VC 1L3LA 4WU8A 5CP6A 4EWFA 5B1MB 5B33C 1AWIA 4L9EA 1E3UD 2XFTA 3VFHA 3IX4A 4J8WA 5FI2A 4Z66C 5A92A 3CJMA 2F8NH 1MPLA 3UE6A 1W5DA 5JRGD 4FH2A 4IJGA 4XUJB 3MNND 4G92B 2OWJA 5DTTA 3W96A 5B2IB 5AV5B 3WD2A 4JGQA 2GNXA 5AV6C 4DRBA 4MBKA 3MF0A 2V5OA 4Y7PA 3LICA 3C5AA 3T4QA 2K2NA 2ZL1A 5F99C 4WZ5C 4IJEA 3QP1A 5CGXA 2X02A 3IXGA 5GSUA 3NOUC 4GCZA 2WAEA 1KX3B 5EVLA 2LB5A 5GSUD 3LY3A 3WX7A 3B6FC 4WU8D 3UDXA 3OPLA 3D72A 5AV8C 3AZED 5B1MA 1TD5A 4UA9A 5EOEA 3SS3A 1T18A 1P3MD 3R4KA 1JWVA 2VZWA 3MMHA 2VX8A 4JF5A 4AWLC 3I7JA 3H0LC 1GSXA 1ZLAC 5AY8D 2PYOC 5I5LA 3PYPA 1H8MA 4Z66A 3LYXA 1F66C 3WA9B 1YMSA 2EX9A 4UEYA 4OPQA 3MGSB 1SKOA 4OOLA 3A6NA 5E2HA 3UMDA 1FILA 2PAVP 3AGFA 2V8CA 5GXQD 2ZD8A 4Z2JA 3MXSA 1ZLAD 1H0IA 3C7UA 2NQBC 5B33D 3PTEA 2VKSA 4KG2A 4KUDB 1SKOB 2PYOB 1YT4A 1P3KB 1DP8A 3BYDA 2QHKA 4Y0UA 4JGOA 1P9RA 4KUOA 5G4ZA 4H9PB 2WKPA 3RXXA 3NQUB 1I5QA 2PU2A 2DNSA 4JXWA 2P04A 4PKYA 3N7WA 4PMAA 2W8SA 1W1TA 1P3GC 4Z2MG 1MWUA 4LLOB 4H9PA 1AOIB 2W3DA 5FQQA 5AY8C 1E6PA 4OQGA 3ZYTA 4HJ4A 1LSWA 4HJ3A 4FTXA 3T12B 4X56A 2CC1A 4P6ZS 5AV6B 3G6OA 2EWWA 3X1UB 3AZMA 1P3IB 3AGEA 4YOFA 1NRFA 2G2UA 5CEBA 1AOIA 3WKJC 4S2LA 5HDDA 5CERA 4XZQD 3IWOA 4G91B 5BS7C 3E4QA 4KZ7A 5BNXB 3SH8A 4R4SA 5GHXA 4KUDD 5AVBC 3MKFA 4Z5TC 4G3VA 3B0DC 3L27A 2V0UA 2ZQ8A 4KZ6A 3MGQC 4OPRA 1K6SA 5DF9A 2O0YA 1BH9B 3DBAA 1GCEA 2A24B 4KQQA 3OBFA 4X68A 1H8YA 3LIFA 3WTPB 1KVMA 2PD8A 3H0RC 3ZG0A 4MBHA 2ZQCA 2VGLM 4Z5TD 2WKQA 4EEUA 4R8PC 4C75A 4HBTA 1B67A 3C1CD 3RELA 3AZKD 3CG5A 2PBDP 3TJZC 2FFFB 1ODVA 1TVFA 3Q81A 2QMIA 5HPIA 1LHYA 5HW3A 5AV9B 4OPYA 3UDFA 2JCHA 4YM6D 4DXBA 3EG5B 3RELB 4NETA 1M18C 5BNXA 5DFYA 3AZND 4P0MA 1BLSA 4OQ0A 4Z9QA 1VHMA 3EQVA 1UR8A 1XKZA 4EBPA 3B6GB 5CP6C 2QJ7A 1PI5A 1M18D 2F8NK 2ZQ7A 1BLPA 2W1RA 4I38A 3VH6W 3L25A 3REIB 4JXGA 3AN2C 4EUZA 1LT0A 1KU5A 3EOIA 4RA7A 3AZIC 2Y2HA 4JLFA 2ACGA 4NE5A 5FASA 2P9VB 4Y2FA 4ZUXA 3JVUA 1K54C 3X1UC 1P3IC 1YU0A 1M1AB 4WM9A 4KZ9A 3ZVWA 4P6ZM 1O7EA 4L9FA 5IU1A 1K55A 3ZVTA 3T4JA 4LRXC 2BYMA 4WU9C 4P85A 2Y2LA 4BBTA 1M1AA 2G7UA 2OAP1 3RH8B 2AROB 3N8RA 4WBGA 1HTAA 1LSVA 3VH5A 3MVDD 1M18A 4QY6A 5DFXA 3IXHA 1CJFA 1F5MA 2X01A 1TF1A 3IH8A 4S2PA 2D49A 5B1MC 5TR7A 1PZPA 4Y17A 2AROA 4J8UC 1ZC2A 1P3AB 4EERA 1M18B 3PXPA 3RFBA 3IF5A 5FAPA 4Z2IA 4MEZA 2Y59A 4RX2A 3REHC 1CEGA 1S32D 1P3OD 1K57C 4NFTA 4HJ6A 3WKJD 2J3TD 4JF6A 4J8XA 4OJLA 3MBZA 1E6NA 4U0TA 1P3OB 4LV1A 3CZDA 4CSRB 5GLBA 4DQYB 3M6HA 1KE0A 3BY9A 5CRFA 4GHIA 2NQBB 5IHVA 1NYMA 1P3AC 3A3DA 3AZGB 2WKHA 3NBLA 1YPRA 5CPIC 3WS2A 2WZZA 3DWZA 4KZBA 5J8XA 1XGJA 4CSRA 1NRJA 1WE4A 2F8NG 5HWWA 1EWZA 3B47A 2BG1A 2XF3A 2RTSA 2JKTM 3UNWA 3B6FB 4DF6A 4EO5C 3WWXA 1CF0A 2V9AA 3DAVA 2H28A 2AROD 3C1BA 4HBUA 1H3OB 5EVIB 2Y2IA 4J8VD 1FR1A 3C4OA 3IT9A 3ICYA 4G91C 4FSFA 1FQGA 3V50A 4K08A 4X25A 4DJ3A 1HD8A 3KYZA 1ESIA 2AROC 2W0NA 5JRGC 3TSGA 1DP6A 3NI9A 2DMWA 3LI9A 4FOFA 3AZMD 2CV5C 3ITBA 2J7VA 3H82B 4BQMA 1CK7A 3CI6A 5B1LC 1JWZA 2IO5C 1T19A 5DNNB 3AZNC 4XZQB 1S6RA 1NYYA 1GXDA 3REIC 5TBMB 1S0WA 4UA7A 4MB4A 3E4PA 2GX5A 4X53A 3BRMA 1VEUB 4H9NB 4J8UA 1KDSA 1OTDA 3ISGA 1AOIC 3WKJA 5B1LD 3GVBA 5DNNA 3B6GD 5AVFA 3SOIA 5AVBA 1H3OA 5CHMA 3K3CA 4MN6A 3O5YA 3QNCA 3V3SA 3L26A 3P98A 3AZFB 5B32C 2W1TB 1NLYA 2ZBBA 3O62A 5DNMA 5J7EA 1JVJA 1ZHHB 2NUTC 2HDSA 2CMNA 4F94A 1P3BB 5DTKA 3MGPC 3S22A 3RXWA 3X1UD 1P3ID 2C5WB 5DJUA 3KYQA 3KWQA 1DJAA 3OPHA 3IF6B 3N8SA 4MN5A 2W1TA 2Z2LB 3QHYA 4OJPA 4WZ5A 2M7UA 2VGKA 3G34A 3BFDA 4YS3B 2XA7M 2EX8A 5B2JB 4KQDA 3A3EA 3KWQB 3BQAA 3IX3A 1TS8A 4Z2HA 4WEJA 2HUEC 4YWZA 4EQ1A 3REIA 4J8UB 1OTEA 4ZBJB 4NZ1A 1H0MA 4GN2A 4WNNB 3UTAD 3NOTC 4YNRA 3NHQA 4NXBA 4EEPA 3LY4A 4E3NA 1P3MA 5AVBB 1GHPA 5JYPA 3REHB 4IHQA 4HEFA 2RL3A 4JXVA 2PYOD 3BFGA 3LR3A 4UQIM 5DVAA 4BLMA 4PM8A 4NKPA 1MWRA 1R4VA 1ULYA 2RVQD 3WTPC 1TS7A 4D2OA 3REKC 3AZIA 1P3BA 3ZFZA 4LG2A 2H0YA 3ZG7B 3AZHD 1KGGA 1P3MB 2PR5A 1HQ3C 5FDHA 4MDZA 3IF6A 1JNUA 3AZEC 4Z2LA 1MY8A 3AZJD 2G2WA 4OQHA 4JXSA 3PR6A 3NC8A 3REJA 5DJTA 2JHEA 1E4DA 2WUQA 1V9ZA 1CK3A 3FWLA 3MGPA 2XH9A 3LR5A 3TU4C 3PAEA 2ZY2A 3GSGA 1P3GA 2OOLA 4P6BA 3AV1A 4HGAB 4HY8A 1M19D 4OJ6A 5A90A 5B0ZD 3AZEB 2NZDA 1PNEA 3VOZA 2VLGA 3AZKC 3LI8A 4JKTA 4WMCA 1OTIA 3REKA 2Y2JA 2FJ7D 5L8MA 1ZG6A 1IFQA 2QPNA 3X1VC 2W3HA 4HH2A 4QWOA 5JRGB 3OLOA
chains in the Genus database with same CATH topology
4OKPA 5AQ9A 1P3KD 3X1SD 3W99C 3PBNA 3HUNA 1IYSA 4GH9A 5B33B 4H9OB 2HDUA 5B2ID 5AV5D 2YFVB 3M2KA 5DNND 3EPKA 3HL9A 3EQUA 1CEFA 1EQZB 5GSUC 4OONA 2HUEB 4EBLA 5KDMA 1PW1A 3H0MC 1VM1A 1W8QA 5E43A 2NZDD 4ZBJC 3A6ND 2F8NB 4BL2A 3CMZA 1KX5C 4ZJ1A 1TAFB 4KHAA 3HLDA 4DE0A 1WYCA 1E3UA 4WU8B 4IVKA 4X23C 3MZFA 2GDNA 5GSUB 4ZJ3A 2WADA 2CV5D 3MGPD 3IWQA 4UAAA 4E6WA 1TDLA 5G18A 3W96D 1KE3A 2ZC4B 3W98D 2Y2QA 5B24B 3LELC 3REKD 2FJ7A 2WZXA 4XUZA 4GNUA 2XFSA 3DTMA 3MGRD 1ID3A 1N1JB 5GL9A 4PPRA 4ZJ2A 5CEDA 3LZ1C 4WU9B 5HL1A 3NQJA 2ZLYA 5KMWA 1TAFA 3AZLC 4OJOA 1DJBA 3W99D 3REJD 4IBBA 5CGSA 4QLCA 3G31A 1KE4A 2XK1A 2IOUA 4Y0TA 1NJ4A 5BT1D 4WU9A 1LL9A 1P34B 3ZNYA 4JPMA 2R9WA 4DE1A 3AN2B 1VQQA 5BT1C 5FI6A 5CPIB 1L0GA 4J8WC 2UWXA 1MXOA 1PWCA 5FQMA 4WU8C 1G6AA 1MBLA 2ZM5A 5A91A 1M1AD 2ZM2A 3FKEA 3DW0A 2RIQA 3B0CT 1IYPA 4QLCB 4QNLA 1QMFA 4KQOA 4JJND 3AFAA 3ZHHA 2ZQ9A 3AZMC 4JJNB 3AZLA 4NK3A 5GHYA 2ZMAA 1JTDA 3LZ0D 5TGFA 5FAQA 1W79A 4BJPA 1LLBA 1XXMA 5CHLB 4LENA 5JA4B 2PYOA 1BH9A 3OZHA 1P3PD 3IF6C 3GTCA 5FQJA 2V2FF 3VP0A 2H5SA 2Q9NA 5KSCA 3UPOA 3X1SC 4WU9D 3A3JA 3OPRA 1FR6A 3B6FD 5U47A 5F1FA 4X69A 5FUGA 1C3BA 4FD8A 1W8YA 4IBRA 4YM6C 4H9QB 1HQ3D 3VH5W 1HTZA 5E5AD 2ZJ9A 4J8XD 3X1SB 2XD5A 3C1CC 3W99A 4HESA 3ZG5A 3E2KA 4OOMA 3X1SA 5B40A 5DNMC 1MWTA 3UN7A 5B32G 4MNRA 3WTPE 5AV5A 5B2IA 3W96B 3MGRA 1H8ZA 4YFMA 1L0FA 2IWDA 3W97B 1WWSA 3MNNA 1EROA 1FCNA 5B31A 1YLJA 4LV2A 3Q7ZA 3UTAC 3WS5A 1QMEA 1NY0A 5B40D 3W99B 2Y55A 1ONHA 1BT5A 1RGYA 1L0EA 3ZCZA 4AWLB 4YM6A 3MGRB 2BYMB 3TU4D 3L28A 4GOGA 3MXRA 1XPBA 3HSHA 4QD4A 3UTAA 4B4XA 1P34A 1YM1A 3N8LA 3D4FA 5B31C 2ZC6B 3VMAA 1AOID 3LO7A 5CPIA 2J9OA 2A49A 4E3KA 1P3KA 1P3BD 4CJNA 3M2JA 1B6WA 3HUOA 2HDQA 5B40C 5AV9D 3B6FA 3AGDA 5B24C 3A6NB 5GT3D 3VSKA 4J8XB 5BNVB 1FSWA 4DDSA 1BUEA 5M1AA 5AV8A 5DF7A 4KUDA 4O7DA 4H9SC 5CPKC 3UE0A 3AZHB 5GLAA 1F66B 3WA9C 3MGSD 5BNVA 3NIAA 2Y2KA 5B2JD 1K56D 1PWDA 4DRTA 3REHD 2C6WB 1KGFA 4X23B 1DJCA 3MGSC 2BYKB 4MLLA 1BLHA 4EV4A 4J8WD 1K25A 2DF4C 3AZHC 1ERQA 5B0ZB 4H9RA 3X1UA 1P3IA 1JWPA 4YS3D 5EUAA 1M19B 1Q9CA 1IYQA 3IP4C 5BS7A 5DNMD 4WEKA 3AZFA 5FUGB 5FQ9A 1NXYA 2JE5A 2OLVA 4LD9D 3MGQB 2LY8A 4GHLA 4IEDA 3WAAB 1G68A 2WGWB 4Q8IA 1PZOA 3C7VA 1P3BC 4IBXA 3PBRA 1Z2CB 3WKJB 3LZ1D 2H0TA 3TG9A 3MGQA 4NE6A 1CI9A 4R23A 3UT9C 3O88A 4XUJC 3UE1A 3KUYD 3UPPA 3O62B 5B40B 1MWSA 3MGRC 2HPBA 3PBOA 1E25A 4Z66D 2VQRA 3PAGA 4IBKA 3WA9D 1AXBA 1P3MC 3AZIB 5B31B 1I2WA 2G5IC 3LZ1A 3WAAA 5AVCD 4B4ZA 5B0YA 3AV2A 2FFYA 2HP5A 1YUEA 3X1TC 3REJB 3G32A 5EE8A 5C3IC 2ZY3A 5BO0B 3VH6A 4OP5A 3FDDA 5HX9A 3AZGC 5CXWA 3AZFD 3R45B 1KX5B 4Y0OA 1A7WA 3VP4A 4LCLA 3HLFA 4E3IA 4JJNC 4OLDA 1S32B 3MFDA 4E3JA 4P87A 3HONA 3BEBA 3ZNTA 5B32B 5C3IB 3W4OA 4QLCD 4IBDA 3MGPB 5CP6D 3AYWA 3UTBC 1FCOA 1OMEA 3MVDB 4KQRA 2Y2NA 5F83A 3KUYC 1EQZC 1WWIA 3EPLA 3VOYA 2F8ND 5AQAA 4UUZA 1P3FC 3X1TA 3AZKB 1XX2A 2Y4AA 5B31D 4R3BA 1RP5A 4R8PD 1H5XA 3OPPA 3SS5A 1TZYC 1K38A 1ES3A 3REID 4XUXA 2J8YA 2L5AA 3FYZA 4RX3A 3UTBA 3WRZA 3LCEA 5CP6B 1W2EA 5GT3A 5B24A 2BYKA 2FJ7B 3TU4A 4B88A 5GXQC 1ID3B 5B33A 5B31G 3MZDA 4QLCC 4R8PA 1M19C 3M6BA 5AVCB 2BLSA 2EX2A 1XP4A 3MVDC 1EQZA 3UY6A 1SHVA 1TZYD 5KDMB 3FKVA 2WGWA 2NZDC 4GHAA 2F8NA 2XEPA 4QB8A 3IQAA 4X55A 4ZUXD 4KHAB 3G2ZA 1P3FD 5AVCC 4DKIA 1GA0A 5GT0D 3UT9D 3L29A 3IHBA 3X1TD 5KSHA 4Z5TB 5M19A 5BPVA 4WZ4A 3IXBA 4NYUA 2CV5A 1YLPA 3O3VA 2JC7A 5CTMA 3A6NC 5HAPA 4KGCB 5CECA 3Q1FA 3O62C 4R3JA 4EBNA 4G92C 4OQIA 3N3FA 2B5RA 3AN2A 2CV5B 1SCWA 4KENB 1JFIB 5G49B 4IVIA 3VFFA 3ZGAB 4M6BA 5DNNC 3AZNB 4NZ5A 2I72A 2HP9A 1P3PA 2EX6A 5GXQA 5F82A 3NQUA 4JBFA 1JFIA 5CPJC 1T3UA 1P3KC 1BULA 3UDIA 4OUIA 4OVDA 3W4PA 1K4FA 5JA4A 1ZG4A 3OC2A 3AYWD 4QU3A 3KXBC 4GDBA 3W8KA 4JF4A 4KG6A 4S2MA 3AFAB 3VH6T 2ZC5B 3NDEA 5B0ZC 3EPJA 4JJNA 4OPZA 4N1HA 4J8VA 5AV6A 4N92A 3AZEA 3AZMB 3BFFA 4DE3A 1Y54A 5G49A 4S2OA 3FZCA 5GT0C 2EXAA 4PM7A 3HVFA 3TOIA 3GQZA 5E5AA 5GXQB 3BECA 3DWKA 1BFMA 1ZKJA 3VP3A 2F2AC 1YU2A 3C1CA 5D3OA 5CPJA 5FATA 5BOHA 5F99A 4DRAA 1XA7A 1KX3C 5AV6D 5GT0B 3X1VA 3C1BD 1XGIA 3BLMA 1SKFA 4LCMA 1WYBA 3BFEA 3WTPA 4ZAMA 5CPKB 3REJC 3W98C 1ES5A 2X71A 3W96C 3Q07A 4GZBA 2ZY4A 5F99B 1YU4A 4C3QA 5B1LA 3B3XA 1FSYA 2EFXA 4H9QA 1LL5A 4UHUA 3E2LA 4QJGA 4XUJD 3MNNB 1Q2PA 5E2EA 3V9RA 3IH9A 5B1LB 5E5AB 4KGCD 4E6XA 2WKIA 4A5RA 4NZ4A 4GD8A 3OCLA 3LELD 2Y2PA 3A1KA 1M1AC 1GHIA 3VP2A 4E3MA 1KX3A 4DDYA 1K55C 3S4XA 5AV9A 2EFUA 1N1JA 4XUJA 1P3FB 4ZTKA 4ZUXB 3ZG9B 3SS4A 5GT3C 4KZ5A 3X1VD 2YFWA 3V9RB 3HBRA 4CAYA 1KX4D 2HIOC 3KS4A 5M18A 3WA9A 4ZDXA 5FAOA 1KX3D 3MKEA 5I94A 1BZAA 4E3OA 3V39A 3PBQA 2YFWB 4LV3A 2A3UA 1N4OA 3GRJA 3NQJB 4QHCA 4LD9C 4R0QA 4YINA 3EPHA 3HUMA 2WK0A 4DXCA 3KUYA 2JBFA 2HIOB 1P3FA 3B0DB 2IWBA 1PWGA 1IKGA 1ID3C 5B32D 1EI5A 1MKIA 5AV8B 3OCNA 3B0CW 3C4PA 1ES2A 3MZEA 3A3IA 3ZG8B 4PM5A 3IXDA 3AZHA 2G5HC 1RGZA 1SDEA 5CTNA 4OOYA 5FI7A 2JSSA 4BENA 3FV7A 1CI8A 1M6KA 4E45A 2P74A 3FKWA 3AYWC 2ZQDA 4IBGA 4BL3A 3Q7VA 4N1XA 4XZQC 3O87A 4Z66B 1IELA 3MGSA 3C1BC 2H10A 5B0ZA 1I2SA 3KUYB 4N9KA 4FH4A 2HIOA 2NQBD 3MNNC 1XA1A 3AZID 3Q7VB 4EO5B 2HIOD 2NQBA 4PM9A 4LD9A 3KXBA 1KX4C 4BD1A 1YLTA 2E8IA 3Q82A 2OV5A 4IJFA 3WAAC 4LD9B 1FOFA 4OLGA 1U60A 1P3LA 5CHUA 4XZQA 3SH9A 1FCMA 1NZOA 4S2NC 1JTGA 1M19A 4IBFA 3AN2D 5EVIA 3A1IA 3KWQC 1N9BA 3WS0A 1ES4A 4U0XA 5AY8A 2WKEA 3ITAA 4DE2A 1J9MA 4GD6A 2J9PA 4ZBEA 3HLCA 4X6TA 4X23A 3BFCA 3F6TA 3G4PA 1YLZA 4R4RA 3KSYA 3O86A 4S2JA 3KXBB 4GKUA 5DNMB 1K54A 5AQBA 2Y2OA 5HFOA 4J8XC 3W97A 3GMWA 3AL0C 4KG5A 4QY5A 3WTPD 4S2IA 5L2FA 1P3LB 1RCJA 4YS3A 1KDWA 5HAIA 3LZ0C 1BH8A 4WMCD 3HREA 3S1YA 4NYYA 4IBJA 1F1EA 3P5JB 2IWCA 5DF8A 4HGAC 4NE3A 3LZ1B 1F66D 3LEZA 3HLBA 2VGJA 4S2NA 5E2GA 3REHA 1BH8B 5GLDA 4CPKA 2XD1A 3N6IA 3L2AA 3LJAB 2Y91A 4YM6B 3MGQD 1Q2QA 1TDGA 3RJUA 3W98B 3AYWB 4CAYB 1BSGA 2HP6A 1PIOA 1TEMA 5GHZA 1HZOA 2XGNA 3LJAA 5A93A 3B6GA 2ZM0A 1P3AA 3LJAD 3ZDJA 4K0WA 2OSUA 2ZM8A 1U35D 4K91A 5B0YB 3AV2B 4ID4A 3UPNA 1K56A 3AV1B 1U35A 4RYEA 4WZSB 4X23D 4KZ4A 4EQIA 2RCXA 1ZLAA 3PBTA 5AQ7A 4PM6A 2NZDB 5BO0A 2P9VA 2Q9MA 3W97C 3BM6A 3UTBD 5B1MD 2V20A 1EQZD 2Y2GA 5JRGA 3UTAB 4GDNA 1ZLAB 3AV1D 5B0YC 3AV2C 1GA9A 4J8UD 3NDGA 3AFAD 3BLSA 1PYYA 1YMXA 1GHMA 1YU3A 4L0LA 2DQNC 3VP1A 2WAFA 4WYYA 4C6YA 3X1TB 3WRTA 1P34C 1F66A 4R1GA 2V1ZA 1O07A 4LV0A 5GT3B 4MBFA 3IWIA 1NZUA 3MVDA 2OLUA 3AZGA 2FJ7C 3AZJC 1U35B 2DCFA 4IBIA 5KZHA 1TZYB 5F99D 3HLEA 4M3KA 2Y2MA 3W97D 5CPKD 4H9OA 1BTLA 4OH0A 4H9RB 3SH7A 3C1BB 2YFVA 1K57A 1P3OA 1PZRA 3HLWA 5AVBD 1ID3D 1P3LC 4OP8A 3TU4B 2CWEA 3AZJB 1U35C 1ERMA 1ALQA 3UO9A 1YQSA 4GB7A 1W7FA 1Z6FA 2IO5B 2EXBA 2R9XA 2WYXA 3KWQD 5AVCA 4Z5TA 3UTBB 2HDRA 5AY8B 5HAQA 3G2YA 2XDMA 3N4IA 4KGCC 1M40A 1HQ3B 5FQKA 5JYOA 5EECA 3WS1A 4KUDC 3B0BA 5EPHA 5FQIA 5B0YD 3AV2D 4H9NA 5FSRA 1PI4A 3AZLD 4K0XA 3P09A 1HQ3A 1ONGA 4FCFA 3NY4A 4BD0A 3UE3A 3KS8A 4S2KA 3V5MA 5CGWA 1PW8A 1IKIA 1P3PB 2ZC7A 3GR2A 1P3OC 5AV8D 4YS3C 3AV1C 3A3FA 4N9LA 3V3RA 3AFAC 1LI9A 4ZUXC 1DY6A 1ESUA 3AZFC 3R45A 5E2FA 3WS4A 2PU4A 3AZNA 1P3LD 3W98A 3UT9A 1SDNA 3PBSA 1KVLA 5E5AC 4OJ5A 3W4QA 5EVID 4E3LA 5DTSA 2RVQC 1KX4B 5B32A 1IEMA 4KGCA 1KGEA 3AZLB 2ZY5A 3IHAA 5CPJD 5CHJA 5TFQA 3KFUG 3LJAC 3G30A 3JYIA 3UT9B 3VH5T 4WELA 5B2JA 2ZQAA 4KZAA 3KXBD 1KX5A 5CPID 1K4EA 1BLCA 1YU1A 4NY2A 1S32A 4J8VB 1K6RA 4U3TA 4WNNA 1P3GB 1L0DA 2XLNA 2DRWA 3NCKA 4Z2MH 4IBEA 3LELB 3LZ0B 3HLGA 4WV4B 4NZ3A 3QNBA 4UPKA 3O62D 2WGIA 5EOOA 2WGVA 5B24D 3REKB 3B6GC 4IBCA 4XXRA 3AZGD 1P3AD 5GLCA 2ZC3B 3RELC 1KX4A 5EVIC 1YLYA 5HARA 1IYOA 1YLWA 3LELA 3VSLA 2J8PA 1KX5D 1S32C 4UUZB 1P3PC 4H9SA 5CPKA 3GV9A 1P3GD 1L2SA 3RELD 3AZKA 5FA7A 3WAAD 4H8RA 4UA6A 1TZYA 4KZ3A 5B2JC 4E44A 2XR0A 1HVBA 5AV9C 1LI0A 2QZ6A 4WJ3C 2Z2MB 3G35A 3C1CB 5F1GA 2XQZA 2PBYA 5CPJB 3LZ0A 1P34D 4R8PB 5GT0A 3X1VB 4J8WB 3AZJA 4KZ8A 4RVAA 5B2IC 5AV5C 4J8VC 4WU8A 5CP6A 4EWFA 5B1MB 5B33C 2XFTA 1E3UD 3VFHA 4J8WA 5FI2A 4Z66C 5A92A 3CJMA 2F8NH 1MPLA 1W5DA 5JRGD 4FH2A 4XUJB 3MNND 4G92B 5DTTA 3W96A 5B2IB 5AV5B 5AV6C 4DRBA 4MBKA 4Y7PA 3C5AA 5F99C 4WZ5C 4IJEA 5CGXA 2X02A 3IXGA 5GSUA 2WAEA 1KX3B 5EVLA 5GSUD 3LY3A 3WX7A 3B6FC 4WU8D 3UDXA 3OPLA 5AV8C 3AZED 5B1MA 4UA9A 5EOEA 3SS3A 1P3MD 1JWVA 4JF5A 4AWLC 3I7JA 3H0LC 1ZLAC 5AY8D 2PYOC 4Z66A 1F66C 3WA9B 1YMSA 2EX9A 4OPQA 3MGSB 4OOLA 3A6NA 5E2HA 3AGFA 5GXQD 2ZD8A 3MXSA 1ZLAD 3C7UA 2NQBC 5B33D 3PTEA 4KG2A 4KUDB 2PYOB 1YT4A 1P3KB 3BYDA 4Y0UA 4H9PB 3RXXA 3NQUB 1I5QA 2PU2A 2DNSA 4JXWA 3N7WA 4PMAA 2W8SA 1P3GC 4Z2MG 1MWUA 4H9PA 1AOIB 5FQQA 5AY8C 4OQGA 4X56A 2CC1A 5AV6B 3X1UB 3AZMA 1P3IB 3AGEA 1NRFA 2G2UA 5CEBA 1AOIA 3WKJC 4S2LA 5CERA 4XZQD 3IWOA 4G91B 5BS7C 4KZ7A 5BNXB 3SH8A 4R4SA 5GHXA 4KUDD 5AVBC 3MKFA 4Z5TC 3B0DC 3L27A 4KZ6A 2ZQ8A 3MGQC 4OPRA 1K6SA 5DF9A 1BH9B 1GCEA 4KQQA 4X68A 1H8YA 3WTPB 1KVMA 3H0RC 3ZG0A 4MBHA 2ZQCA 4Z5TD 4R8PC 4C75A 4HBTA 1B67A 3C1CD 3RELA 3AZKD 3CG5A 2FFFB 1TVFA 3Q81A 2QMIA 1LHYA 5HW3A 5AV9B 4OPYA 3UDFA 2JCHA 4YM6D 4DXBA 3EG5B 3RELB 4NETA 1M18C 5BNXA 3AZND 4P0MA 1BLSA 4OQ0A 4Z9QA 3EQVA 1XKZA 4EBPA 3B6GB 5CP6C 1PI5A 1M18D 2F8NK 2ZQ7A 1BLPA 3VH6W 3L25A 3REIB 4JXGA 3AN2C 4EUZA 1KU5A 4RA7A 3AZIC 2Y2HA 4JLFA 4NE5A 5FASA 2P9VB 4ZUXA 1K54C 3X1UC 1P3IC 1YU0A 1M1AB 4WM9A 4KZ9A 3ZVWA 1O7EA 1K55A 3ZVTA 2BYMA 4WU9C 4P85A 2Y2LA 1M1AA 2AROB 3N8RA 4WBGA 1HTAA 3VH5A 3MVDD 1M18A 4QY6A 3IXHA 2X01A 3IH8A 4S2PA 5B1MC 5TR7A 1PZPA 2AROA 4J8UC 1ZC2A 1P3AB 1M18B 3IF5A 5FAPA 4MEZA 2Y59A 4RX2A 3REHC 1CEGA 1S32D 1P3OD 1K57C 4NFTA 3WKJD 4JF6A 4J8XA 4OJLA 3MBZA 4U0TA 1P3OB 4LV1A 3CZDA 4CSRB 5GLBA 4DQYB 3M6HA 1KE0A 5CRFA 5IHVA 2NQBB 1NYMA 1P3AC 3A3DA 3AZGB 2WKHA 3NBLA 3WS2A 5CPIC 2WZZA 3DWZA 4KZBA 5J8XA 1XGJA 4CSRA 1WE4A 2F8NG 1EWZA 2BG1A 2XF3A 3UNWA 3B6FB 4DF6A 4EO5C 3WWXA 2AROD 3C1BA 4HBUA 1H3OB 5EVIB 2Y2IA 4J8VD 1FR1A 3C4OA 3IT9A 4G91C 4FSFA 1FQGA 3V50A 1HD8A 1ESIA 2AROC 3TSGA 5JRGC 3NI9A 3AZMD 3ITBA 2CV5C 2J7VA 4BQMA 5B1LC 1JWZA 2IO5C 5DNNB 3AZNC 4XZQB 1S6RA 1NYYA 3REIC 1S0WA 4UA7A 4X53A 3BRMA 4H9NB 4J8UA 1KDSA 3ISGA 1AOIC 3WKJA 5B1LD 3GVBA 5DNNA 3B6GD 3SOIA 5AVBA 1H3OA 5CHMA 3QNCA 3V3SA 3L26A 3P98A 3AZFB 5B32C 3O62A 5DNMA 1JVJA 4F94A 2HDSA 1P3BB 5DTKA 3MGPC 3S22A 3RXWA 3X1UD 1P3ID 2C5WB 3KWQA 1DJAA 3OPHA 3IF6B 3N8SA 2Z2LB 3QHYA 4OJPA 4WZ5A 2VGKA 3G34A 3BFDA 4YS3B 2EX8A 5B2JB 3A3EA 3KWQB 4WEJA 2HUEC 3REIA 4J8UB 4ZBJB 4NZ1A 4GN2A 4WNNB 3UTAD 3LY4A 4E3NA 1P3MA 5AVBB 1GHPA 5JYPA 3REHB 4HEFA 2RL3A 4JXVA 3BFGA 2PYOD 5DVAA 4BLMA 4PM8A 1MWRA 1R4VA 1ULYA 2RVQD 3WTPC 4D2OA 3REKC 3AZIA 1P3BA 3ZFZA 4LG2A 2H0YA 3ZG7B 3AZHD 1KGGA 1P3MB 1HQ3C 5FDHA 3IF6A 3AZEC 1MY8A 3AZJD 2G2WA 4OQHA 4JXSA 3NC8A 3REJA 2WUQA 1E4DA 1CK3A 3FWLA 3MGPA 2XH9A 3PAEA 3TU4C 2ZY2A 3GSGA 1P3GA 4P6BA 3AV1A 4HGAB 1M19D 4OJ6A 5A90A 5B0ZD 3AZEB 2NZDA 3VOZA 3AZKC 4JKTA 4WMCA 3REKA 2Y2JA 2FJ7D 1ZG6A 2QPNA 3X1VC 5JRGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKP A;  5CGX A;  2X02 A;  3IXG A;  3VFH A;  2WAE A;  4PM9 A;  5AQ9 A;  1I2W A;  5EVL A;  4BD1 A;  3PBN A;  3HUN A;  1YLT A;  1IYS A;  3LY3 A;  4B4Z A;  2E8I A;  2FFY A;  2HP5 A;  2HDU A;  3Q82 A;  3OPL A;  3UDX A;  2OV5 A;  4UA9 A;  5EOE A;  3SS3 A;  3M2K A;  3G32 A;  5EE8 A;  1FOF A;  3HL9 A;  1JWV A;  4OLG A;  3EQU A;  4OP5 A;  1U60 A;  5HX9 A;  1CEF A;  4JF5 A;  5CHU A;  3SH9 A;  1FCM A;  3I7J A;  5CXW A;  4Y0O A;  1NZO A;  4S2N C;  1JTG A;  4OON A;  5EVI A;  3VP4 A;  4EBL A;  4LCL A;  1PW1 A;  1W8Q A;  1VM1 A;  3HLF A;  5E43 A;  4E3I A;  4OLD A;  1N9B A;  3WS0 A;  1ES4 A;  4U0X A;  4DE2 A;  2WKE A;  3ITA A;  3MFD A;  4BL2 A;  4E3J A;  1YMS A;  2EX9 A;  4P87 A;  1J9M A;  4GD6 A;  3CMZ A;  4OPQ A;  2J9P A;  4OOL A;  4ZBE A;  4ZJ1 A;  5E2H A;  3HLC A;  3AGF A;  2ZD8 A;  3HLD A;  4X6T A;  1WYC A;  3MXS A;  4DE0 A;  3BFC A;  3G4P A;  1E3U A;  3BEB A;  3ZNT A;  1YLZ A;  4R4R A;  3C7U A;  3W4O A;  4IVK A;  3O86 A;  3MZF A;  4S2J A;  4GKU A;  3PTE A;  2GDN A;  4KG2 A;  1K54 A;  5AQB A;  4ZJ3 A;  2WAD A;  1FCO A;  1YT4 A;  3IWQ A;  3BYD A;  4UAA A;  1OME A;  4KQR A;  2Y2O A;  4E6W A;  4Y0U A;  5HFO A;  1TDL A;  5G18 A;  2Y2N A;  1KE3 A;  5F83 A;  2ZC4 B;  3GMW A;  4KG5 A;  3RXX A;  1I5Q A;  4QY5 A;  2Y2Q A;  2PU2 A;  4S2I A;  2WZX A;  2DNS A;  4XUZ A;  3VOY A;  4JXW A;  5L2F A;  4GNU A;  2XFS A;  3DTM A;  1RCJ A;  5AQA A;  3N7W A;  1KDW A;  4PMA A;  5HAI A;  4WMC D;  3HRE A;  1MWU A;  1XX2 A;  4PPR A;  5GL9 A;  2Y4A A;  3S1Y A;  5FQQ A;  4OQG A;  4R3B A;  4ZJ2 A;  1RP5 A;  5CED A;  2IWC A;  5DF8 A;  1H5X A;  3OPP A;  4X56 A;  5HL1 A;  2CC1 A;  2ZLY A;  5KMW A;  3LEZ A;  3HLB A;  2VGJ A;  4S2N A;  3SS5 A;  5E2G A;  1DJB A;  1K38 A;  3AGE A;  5CGS A;  1NRF A;  5GLD A;  4CPK A;  1ES3 A;  2XD1 A;  2G2U A;  5CEB A;  3N6I A;  3G31 A;  4S2L A;  5CER A;  2Y91 A;  1KE4 A;  2XK1 A;  4XUX A;  2J8Y A;  3IWO A;  4Y0T A;  1NJ4 A;  1Q2Q A;  1TDG A;  3RJU A;  3FYZ A;  4RX3 A;  1BSG A;  2HP6 A;  4KZ7 A;  3WRZ A;  1LL9 A;  1PIO A;  1TEM A;  3ZNY A;  4JPM A;  5GHZ A;  3SH8 A;  1HZO A;  3LCE A;  2XGN A;  2R9W A;  4R4S A;  5GHX A;  4DE1 A;  3MKF A;  1VQQ A;  5A93 A;  4KZ6 A;  2ZQ8 A;  2ZM0 A;  4OPR A;  1K6S A;  5DF9 A;  5FI6 A;  1L0G A;  3ZDJ A;  4B88 A;  2UWX A;  1GCE A;  1MXO A;  4KQQ A;  4K0W A;  2OSU A;  2ZM8 A;  4K91 A;  4X68 A;  1PWC A;  4ID4 A;  1H8Y A;  3UPN A;  5FQM A;  3MZD A;  1KVM A;  1G6A A;  1K56 A;  1MBL A;  3ZG0 A;  4MBH A;  4RYE A;  4KZ4 A;  4EQI A;  2RCX A;  2ZQC A;  5A91 A;  3PBT A;  5AQ7 A;  3M6B A;  2BLS A;  4PM6 A;  2EX2 A;  2ZM2 A;  1XP4 A;  4C75 A;  2P9V A;  4HBT A;  2Q9M A;  3CG5 A;  3BM6 A;  3DW0 A;  3UY6 A;  2FFF B;  1IYP A;  1TVF A;  2V20 A;  1SHV A;  2QMI A;  3Q81 A;  1LHY A;  3FKV A;  5HW3 A;  2Y2G A;  1QMF A;  2WGW A;  4GDN A;  4KQO A;  4OPY A;  3ZHH A;  2XEP A;  1GA9 A;  2ZQ9 A;  4QB8 A;  3UDF A;  2JCH A;  4DXB A;  3NDG A;  3IQA A;  4X55 A;  3BLS A;  1PYY A;  4NK3 A;  1YMX A;  5GHY A;  1GHM A;  4NET A;  3G2Z A;  2ZMA A;  1JTD A;  1BLS A;  4L0L A;  4OQ0 A;  4P0M A;  4Z9Q A;  5FAQ A;  5TGF A;  3VP1 A;  4DKI A;  2WAF A;  4WYY A;  3EQV A;  4C6Y A;  1GA0 A;  3WRT A;  1W79 A;  1XKZ A;  3IHB A;  4R1G A;  4EBP A;  2V1Z A;  4BJP A;  1O07 A;  1LLB A;  1XXM A;  4LV0 A;  5KSH A;  4LEN A;  4MBF A;  3IWI A;  1NZU A;  1PI5 A;  5M19 A;  3OZH A;  2OLU A;  3IF6 C;  2ZQ7 A;  1BLP A;  4WZ4 A;  3IXB A;  4JXG A;  3GTC A;  5FQJ A;  2DCF A;  4EUZ A;  5KZH A;  2V2F F;  4RA7 A;  1YLP A;  3VP0 A;  2H5S A;  3O3V A;  2Y2H A;  2JC7 A;  2Q9N A;  3HLE A;  5CTM A;  5KSC A;  4M3K A;  5HAP A;  4JLF A;  5FAS A;  2Y2M A;  2P9V B;  5CEC A;  3UPO A;  3Q1F A;  1K54 C;  3A3J A;  1BTL A;  4R3J A;  4OH0 A;  4WM9 A;  4KZ9 A;  3ZVW A;  4EBN A;  4OQI A;  3OPR A;  3SH7 A;  1FR6 A;  2B5R A;  5U47 A;  5F1F A;  4X69 A;  1K57 A;  1SCW A;  4KEN B;  3VFF A;  4IVI A;  1C3B A;  1O7E A;  3ZGA B;  3HLW A;  4FD8 A;  4OP8 A;  1K55 A;  1W8Y A;  3ZVT A;  4IBR A;  2I72 A;  1ERM A;  2HP9 A;  4P85 A;  1ALQ A;  2Y2L A;  3UO9 A;  2EX6 A;  1HTZ A;  5F82 A;  1YQS A;  2ZJ9 A;  1W7F A;  1Z6F A;  4GB7 A;  2XD5 A;  4JBF A;  2EXB A;  2R9X A;  3N8R A;  2WYX A;  4WBG A;  1BUL A;  3UDI A;  4OVD A;  3W4P A;  1K4F A;  1ZG4 A;  4QY6 A;  2HDR A;  3IXH A;  3OC2 A;  5HAQ A;  4QU3 A;  3G2Y A;  4HES A;  2XDM A;  2X01 A;  4GDB A;  3N4I A;  3W8K A;  3ZG5 A;  4JF4 A;  3IH8 A;  1M40 A;  5FQK A;  4S2P A;  5JYO A;  3E2K A;  4OOM A;  5EEC A;  3WS1 A;  4KG6 A;  5TR7 A;  1PZP A;  4S2M A;  1MWT A;  1ZC2 A;  5EPH A;  3UN7 A;  2ZC5 B;  5FQI A;  3NDE A;  4MNR A;  4OPZ A;  4N1H A;  5FSR A;  3IF5 A;  4N92 A;  5FAP A;  4MEZ A;  1PI4 A;  2Y59 A;  4K0X A;  1H8Z A;  4YFM A;  3P09 A;  4RX2 A;  1L0F A;  1CEG A;  2IWD A;  1ONG A;  4FCF A;  3NY4 A;  4BD0 A;  1K57 C;  3BFF A;  3UE3 A;  4DE3 A;  1Y54 A;  1ERO A;  4JF6 A;  4S2O A;  3MBZ A;  3FZC A;  4U0T A;  4LV1 A;  1FCN A;  3CZD A;  4S2K A;  2EXA A;  4PM7 A;  1YLJ A;  4LV2 A;  3Q7Z A;  5GLB A;  3V5M A;  3M6H A;  1KE0 A;  5CGW A;  1PW8 A;  5CRF A;  3HVF A;  5IHV A;  1NYM A;  3TOI A;  3A3D A;  3GQZ A;  1IKI A;  2WKH A;  3WS5 A;  2ZC7 A;  3NBL A;  3WS2 A;  3BEC A;  3GR2 A;  1QME A;  3DWK A;  2WZZ A;  1ZKJ A;  3DWZ A;  4KZB A;  1NY0 A;  5J8X A;  1XGJ A;  3VP3 A;  3A3F A;  1WE4 A;  4N9L A;  5D3O A;  4BLM A;  3V3R A;  1EWZ A;  2Y55 A;  2BG1 A;  5FAT A;  2XF3 A;  5BOH A;  1ONH A;  1BT5 A;  1XA7 A;  1LI9 A;  1DY6 A;  1ESU A;  3UNW A;  1XGI A;  3BLM A;  4DF6 A;  1SKF A;  4LCM A;  3WWX A;  1RGY A;  1WYB A;  3BFE A;  4ZAM A;  1L0E A;  3ZCZ A;  1ES5 A;  4HBU A;  2X71 A;  5E2F A;  5EVI B;  2Y2I A;  3Q07 A;  1FR1 A;  3C4O A;  3IT9 A;  3WS4 A;  4GZB A;  2PU4 A;  4C3Q A;  3B3X A;  1FSY A;  1LL5 A;  2EFX A;  1SDN A;  3PBS A;  3MXR A;  4FSF A;  4GOG A;  1FQG A;  4UHU A;  1KVL A;  1XPB A;  3E2L A;  3V50 A;  1HD8 A;  1ESI A;  5EVI D;  3W4Q A;  4QD4 A;  4B4X A;  4QJG A;  3TSG A;  4E3L A;  5DTS A;  1Q2P A;  1YM1 A;  3NI9 A;  3N8L A;  5E2E A;  1IEM A;  3D4F A;  1KGE A;  3IHA A;  3IH9 A;  3ITB A;  2J7V A;  2ZC6 B;  5CHJ A;  3G30 A;  3JYI A;  5TFQ A;  3VMA A;  4BQM A;  4WEL A;  1JWZ A;  3LO7 A;  4E6X A;  2J9O A;  2A49 A;  2ZQA A;  4KZA A;  4E3K A;  2WKI A;  1S6R A;  4A5R A;  1NYY A;  4CJN A;  1S0W A;  4GD8 A;  1K4E A;  4UA7 A;  3M2J A;  3OCL A;  3HUO A;  4X53 A;  1BLC A;  2Y2P A;  3BRM A;  2HDQ A;  1GHI A;  3VP2 A;  1K6R A;  1KDS A;  4U3T A;  4E3M A;  3ISG A;  4DDY A;  3GVB A;  1K55 C;  3AGD A;  1L0D A;  3S4X A;  3SOI A;  3VSK A;  2EFU A;  2XLN A;  2DRW A;  3NCK A;  5CHM A;  3QNC A;  3V3S A;  3P98 A;  1FSW A;  4ZTK A;  4DDS A;  3HLG A;  1BUE A;  5M1A A;  1JVJ A;  3QNB A;  2HDS A;  5DF7 A;  4F94 A;  5DTK A;  3S22 A;  3ZG9 B;  4O7D A;  2WGI A;  5EOO A;  3RXW A;  3SS4 A;  2WGV A;  2C5W B;  4XXR A;  4KZ5 A;  5GLC A;  3UE0 A;  1DJA A;  2ZC3 B;  5GLA A;  3OPH A;  3IF6 B;  5EVI C;  1YLY A;  5HAR A;  1IYO A;  1YLW A;  3N8S A;  3NIA A;  2Y2K A;  3HBR A;  2Z2L B;  3QHY A;  4WZ5 A;  3VSL A;  1K56 D;  2VGK A;  3G34 A;  1PWD A;  3BFD A;  5M18 A;  4ZDX A;  5FAO A;  2EX8 A;  4DRT A;  3MKE A;  3A3E A;  5I94 A;  2C6W B;  3GV9 A;  1L2S A;  1BZA A;  1KGF A;  4E3O A;  1DJC A;  4WEJ A;  3V39 A;  3PBQ A;  5FA7 A;  4MLL A;  4LV3 A;  1BLH A;  4H8R A;  4UA6 A;  4KZ3 A;  2A3U A;  1N4O A;  4EV4 A;  1K25 A;  4GN2 A;  3GRJ A;  2XR0 A;  1HVB A;  1ERQ A;  4QHC A;  4R0Q A;  3LY4 A;  4YIN A;  4E3N A;  3HUM A;  1GHP A;  1LI0 A;  5JYP A;  1JWP A;  4HEF A;  2RL3 A;  4JXV A;  2QZ6 A;  2WK0 A;  2Z2M B;  3BFG A;  5DVA A;  3G35 A;  4PM8 A;  5EUA A;  2JBF A;  5F1G A;  1IYQ A;  2XQZ A;  4DXC A;  1MWR A;  2PBY A;  4WEK A;  5FQ9 A;  2IWB A;  1PWG A;  4D2O A;  1IKG A;  1NXY A;  3ZFZ A;  1EI5 A;  2JE5 A;  1MKI A;  2OLV A;  3OCN A;  2H0Y A;  3ZG7 B;  1KGG A;  3C4P A;  4KZ8 A;  1ES2 A;  3MZE A;  4IED A;  5FDH A;  3A3I A;  3ZG8 B;  3IF6 A;  1G68 A;  4RVA A;  2WGW B;  4PM5 A;  4Q8I A;  3IXD A;  1PZO A;  3C7V A;  1MY8 A;  1RGZ A;  2G2W A;  4OQH A;  1SDE A;  4JXS A;  5CTN A;  3NC8 A;  4OOY A;  2WUQ A;  1E4D A;  4IBX A;  4EWF A;  5FI7 A;  1CK3 A;  3FWL A;  3PBR A;  4BEN A;  3FV7 A;  2XFT A;  2XH9 A;  1E3U D;  1CI8 A;  1M6K A;  2H0T A;  2P74 A;  3PAE A;  5FI2 A;  3FKW A;  2ZQD A;  3GSG A;  3TG9 A;  3CJM A;  5A92 A;  1MPL A;  1CI9 A;  4R23 A;  1W5D A;  3O88 A;  4P6B A;  3UE1 A;  4FH2 A;  4BL3 A;  3Q7V A;  5A90 A;  3UPP A;  4N1X A;  5DTT A;  1MWS A;  3O87 A;  2HPB A;  1IEL A;  3PBO A;  3VOZ A;  4MBK A;  1E25 A;  4JKT A;  2H10 A;  4WMC A;  2Y2J A;  4Y7P A;  3C5A A;  3PAG A;  1I2S A;  1ZG6 A;  2QPN A;  4N9K A;  4FH4 A;  1XA1 A;  3Q7V B;  1AXB A;  4WZ5 C; 
#chains in the Genus database with same CATH topology
 4OKP A;  5HD3 A;  5AQ9 A;  1P3K D;  3X1S D;  3W99 C;  3PBN A;  3HUN A;  3KSH A;  1IYS A;  1DP9 A;  4GH9 A;  4X1M A;  5B33 B;  4H9O B;  2HDU A;  4D60 A;  4HP4 A;  5B2I D;  5AV5 D;  2YFV B;  3M2K A;  3S7P A;  2VV7 A;  4B93 A;  5DNN D;  3EPK A;  3HL9 A;  3EQU A;  1CEF A;  1EQZ B;  5GSU C;  4RQ9 A;  4OON A;  2XSS A;  2HUE B;  1XFN A;  1F98 A;  4EBL A;  5KDM A;  1PW1 A;  3H0M C;  1VM1 A;  1W8Q A;  5E43 A;  2NZD D;  4ZBJ C;  3A6N D;  2F8N B;  4BL2 A;  2EA9 A;  3CMZ A;  5J3W A;  1OT9 A;  1KX5 C;  4ZJ1 A;  2BAS A;  1TAF B;  4KHA A;  1S4R A;  3HLD A;  1WYC A;  4DE0 A;  3RTY A;  3C2W A;  1E3U A;  1OT6 A;  4WU8 B;  4LFU A;  4IVK A;  4X23 C;  3MZF A;  4LGW A;  2GDN A;  5GSU B;  4ZJ3 A;  2WAD A;  2CV5 D;  3MGP D;  3H82 A;  3IWQ A;  4UAA A;  5C5K A;  4E6W A;  1TDL A;  5G18 A;  3W96 D;  1KE3 A;  2ZC4 B;  3W98 D;  4XT2 B;  3MQL A;  2Y2Q A;  5B24 B;  3LEL C;  3REK D;  2FJ7 A;  2WZX A;  4XUZ A;  4GNU A;  2XFS A;  3DTM A;  3MJQ A;  3MGR D;  2L1M A;  1ID3 A;  1N1J B;  5GL9 A;  4PPR A;  4ESP A;  4ZJ2 A;  5CED A;  4R6L A;  5FL3 A;  3LZ1 C;  4WU9 B;  3H7W B;  5HL1 A;  3NQJ A;  2ZLY A;  5KMW A;  1TAF A;  3AZL C;  4OJO A;  2ZOH A;  1DJB A;  3W99 D;  3REJ D;  4IBB A;  5CGS A;  4QLC A;  2XRO A;  3G31 A;  1KE4 A;  2XK1 A;  2IOU A;  4JGR A;  4Y0T A;  1NJ4 A;  3K2N A;  5BT1 D;  4WU9 A;  1N9L A;  1LL9 A;  1PFL A;  1P34 B;  3ZNY A;  4JPM A;  3B33 A;  2R9W A;  4DE1 A;  3AN2 B;  1VQQ A;  4Y13 A;  5BT1 C;  4I5S A;  5CPI B;  5FI6 A;  4J8W C;  1L0G A;  2UWX A;  1MXO A;  1PWC A;  5FQM A;  4WU8 C;  1G6A A;  1Z09 A;  1MBL A;  3R7W A;  2ZM5 A;  3TW8 A;  5A91 A;  1M1A D;  3C38 A;  2ZM2 A;  3FKE A;  3VOL A;  3EGD C;  3DW0 A;  2RIQ A;  3B0C T;  1IYP A;  4QLC B;  4QNL A;  1QMF A;  4KQO A;  4JJN D;  3AFA A;  3MFX A;  3ZHH A;  2ZQ9 A;  3AZM C;  2V1B A;  4JJN B;  3AZL A;  4NK3 A;  3F1P B;  5GHY A;  3QP2 A;  2ZMA A;  1JTD A;  3LZ0 D;  2QYB A;  5FAQ A;  5TGF A;  4EXO A;  1W79 A;  4BJP A;  1LLB A;  1XXM A;  5CHL B;  1NWZ A;  4LEN A;  5JA4 B;  3JPU A;  2PYO A;  1BH9 A;  3OZH A;  1P3P D;  3IF6 C;  4IUK A;  2HJ9 C;  3GTC A;  5FQJ A;  1MZU A;  4Z2K A;  2V2F F;  5HPF A;  3VP0 A;  1G28 A;  2H5S A;  3FG8 A;  2Q9N A;  5KSC A;  1T1A A;  1D7E A;  4IUH A;  3UPO A;  3X1S C;  4WU9 D;  1J7M A;  3A3J A;  3F1N A;  3OPR A;  1FR6 A;  1P0Z A;  3B6F D;  5U47 A;  5F1F A;  4X69 A;  5FUG A;  1A0K A;  2PDR A;  1C3B A;  3S7O A;  4FD8 A;  2W27 A;  1W8Y A;  4L9G A;  4IBR A;  4NXG A;  4YM6 C;  1D06 A;  4I39 A;  4H9Q B;  1HQ3 D;  3C30 A;  3VH5 W;  1HTZ A;  5E5A D;  2ZJ9 A;  4J8X D;  3X1S B;  2XD5 A;  3C1C C;  3W99 A;  2VV6 A;  2K7S A;  4HES A;  5HWV A;  3ZG5 A;  5TJJ A;  3E2K A;  4OOM A;  3X1S A;  3WD1 A;  4NEE D;  2XRN A;  3KSF A;  5AVE A;  2XA7 S;  3UME A;  5B40 A;  5DNM C;  1MWT A;  4GJ4 A;  3UN7 A;  5B32 G;  4MNR A;  5A8B A;  3WTP E;  1ACF A;  5AV5 A;  5B2I A;  3W96 B;  3EWK A;  3MGR A;  1H8Z A;  4YFM A;  3U2A A;  5DKK A;  1L0F A;  2IWD A;  1E8B A;  3W97 B;  1WWS A;  3MNN A;  3CPT B;  3BQ8 A;  1ERO A;  3P01 A;  3IBR A;  1FCN A;  5B31 A;  1YLJ A;  4LV2 A;  3Q7Z A;  5F68 A;  4CLC D;  4GW9 A;  3UTA C;  1S1Y A;  2P7J A;  4HOI A;  3WS5 A;  2OAQ 1;  3DTK A;  1QME A;  1NY0 A;  5B40 D;  3W99 B;  1BYW A;  2Y55 A;  1ONH A;  1BT5 A;  4X1L A;  4HQA A;  2Y8H A;  3IS2 B;  3H7W A;  1RGY A;  3WD0 A;  1L0E A;  3ZCZ A;  3SZT A;  4AWL B;  4YM6 A;  4I3I A;  2ZL1 B;  3A0S A;  3MGR B;  2BYM B;  3TU4 D;  3L28 A;  4GOG A;  3MXR A;  1XPB A;  3LIA A;  3HSH A;  3S7N A;  4QD4 A;  3UTA A;  4B4X A;  1P34 A;  1YM1 A;  3N8L A;  3D4F A;  3JVV A;  5B31 C;  2ZC6 B;  3VMA A;  1AOI D;  3LO7 A;  5CPI A;  1WA9 A;  2J9O A;  2A49 A;  3BJN A;  4E3K A;  1P3K A;  1P3B D;  3S7Q A;  4CJN A;  2INW A;  3M2J A;  1B6W A;  3HUO A;  2HDQ A;  5B40 C;  1IOU A;  3DTI A;  5AV9 D;  4AFI A;  3B6F A;  3AGD A;  5B24 C;  3A6N B;  5GT3 D;  3VSK A;  4GLQ A;  4J8X B;  5BNV B;  2VK3 A;  4II7 A;  4CLC C;  4MCW A;  1FSW A;  3CWF A;  4DDS A;  1BUE A;  5M1A A;  5AV8 A;  5DF7 A;  4KUD A;  3SW1 A;  3HJI A;  2I9V A;  3F1P A;  4O7D A;  4H9S C;  5CPK C;  3PHY A;  3UE0 A;  3AZH B;  5GLA A;  1F66 B;  3WA9 C;  3MGS D;  4R38 A;  5BNV A;  4NXE A;  2M1C A;  3NIA A;  2Y2K A;  2KLI A;  1OGG A;  2PR6 A;  5B2J D;  3LR4 A;  1K56 D;  1PWD A;  3W2Z A;  4BMW A;  4DRT A;  3REH D;  2C6W B;  1OJ5 A;  1KGF A;  4X23 B;  1DJC A;  3MGS C;  3T4K A;  2BYK B;  3T4L A;  4MLL A;  1BLH A;  4EV4 A;  4J8W D;  1K25 A;  2DF4 C;  3AZH C;  1ERQ A;  5B0Z B;  1HLU P;  4H9R A;  1OGB A;  3X1U A;  1P3I A;  1JWP A;  4YS3 D;  2OWH A;  5EUA A;  1M19 B;  1Q9C A;  1IYQ A;  3IP4 C;  5BS7 A;  3UB8 A;  5DNM D;  1H3Q A;  4WEK A;  3AZF A;  5FUG B;  5FQ9 A;  1NXY A;  2UV0 E;  2JE5 A;  2OLV A;  2VJW A;  4LD9 D;  1P9W A;  3MGQ B;  2LY8 A;  4GHL A;  4IED A;  5HL6 A;  3WAA B;  1G68 A;  2WGW B;  4Q8I A;  1PZO A;  3C7V A;  5EFW A;  2O99 A;  5L07 A;  1P3B C;  1S1Z A;  1VEU A;  4IBX A;  3PBR A;  1Z2C B;  3WKJ B;  3LZ1 D;  2H0T A;  3MQ0 A;  2W3E A;  3TG9 A;  5MC7 A;  3MGQ A;  4NE6 A;  1CI9 A;  3H9W A;  4R23 A;  3UT9 C;  3O88 A;  4XUJ C;  3UE1 A;  3KUY D;  3UPP A;  3O62 B;  5B40 B;  1MWS A;  3MGR C;  2HPB A;  3PBO A;  1E25 A;  4Z66 D;  2VQR A;  3PAG A;  5TBM A;  4WN5 A;  4E04 A;  4IBK A;  3WA9 D;  1AXB A;  1P3M C;  2VA0 A;  3AZI B;  5B31 B;  1I2W A;  2G5I C;  3E0Y A;  3LZ1 A;  3WAA A;  5AVC D;  1UR9 A;  5B0Y A;  3AV2 A;  4B4Z A;  2FFY A;  2HP5 A;  1H8P A;  2PT7 A;  1YUE A;  2V0W A;  3E98 A;  3X1T C;  1TS6 A;  4O8G A;  3REJ B;  3G32 A;  1T1B A;  4HIA A;  5EE8 A;  5C3I C;  2ZY3 A;  5FEG A;  2O9A A;  3NJA A;  5BO0 B;  3VH6 A;  4OP5 A;  3FDD A;  5HX9 A;  2KDK A;  3AZG C;  5CXW A;  3AZF D;  3R45 B;  1KX5 B;  4Y0O A;  3T1R A;  1A7W A;  3VP4 A;  1L6J A;  4LCL A;  1P97 A;  3HLF A;  1YSQ A;  4E3I A;  4JJN C;  4OLD A;  1S32 B;  1MKM A;  3MFD A;  4E3J A;  4P87 A;  4O01 A;  4HH3 A;  1GOI A;  3QP8 A;  3HON A;  3BEB A;  3ZNT A;  5B32 B;  5C3I B;  2PYP A;  3W4O A;  5FDS A;  4QLC D;  4IBD A;  3MGP B;  5CP6 D;  1STZ A;  3AYW A;  3UTB C;  1FCO A;  1OME A;  2ZMV A;  3MVD B;  4KQR A;  3BW6 A;  2Y2N A;  5F83 A;  3KUY C;  1EQZ C;  4G3K A;  1WWI A;  3EPL A;  2QWS A;  1VET B;  3VOY A;  4HNB A;  3T50 A;  2F8N D;  2R78 A;  5AQA A;  4UUZ A;  2PRF A;  1P3F C;  1S66 L;  3X1T A;  3AZK B;  1XX2 A;  1ED7 A;  2Y4A A;  5LBR A;  5B31 D;  4R3B A;  1RP5 A;  4R8P D;  2JKR I;  1H5X A;  3OPP A;  3LR0 A;  2O9C A;  4LPZ A;  3SS5 A;  1TZY C;  1K38 A;  1ES3 A;  3T4T A;  1V9Y A;  3REI D;  2ZOI A;  4XUX A;  2J8Y A;  2L5A A;  1K0K A;  3EGX C;  3FYZ A;  4RX3 A;  3UTB A;  3MXQ A;  3K3D A;  2O9B A;  3LEQ A;  3WRZ A;  3D3O A;  4HMC A;  3LCE A;  4F3L B;  5CP6 B;  2J80 A;  1W2E A;  5GT3 A;  5B24 A;  2BYK A;  2FJ7 B;  4ETX A;  3TU4 A;  4B88 A;  3A0V A;  5GXQ C;  1ID3 B;  5B33 A;  1NLZ A;  5B31 G;  3MZD A;  4LRY C;  5HSQ A;  4F3L A;  4QLC C;  4R8P A;  1M19 C;  3P7N A;  3M6B A;  4PAU A;  2HZ5 A;  5AVC B;  2BLS A;  2E8J A;  2EX2 A;  1XP4 A;  5HD5 A;  3MVD C;  1EQZ A;  3KSI A;  3KYE A;  4M4X A;  2Y79 A;  3UY6 A;  4BBU A;  1SHV A;  1TZY D;  5KDM B;  3FKV A;  1ZTU A;  2WGW A;  2NZD C;  4GHA A;  4WL9 A;  2F8N A;  2XEP A;  4QB8 A;  4Y5F A;  2GJ3 A;  3IQA A;  4X55 A;  3QP6 A;  4ZUX D;  4KHA B;  3U4L P;  3G2Z A;  4WUJ A;  1P3F D;  5AVC C;  4DKI A;  1GA0 A;  5GT0 D;  3UT9 D;  3L29 A;  3IHB A;  3X1T D;  1DRM A;  2YKH A;  2EWV A;  5KSH A;  3QP4 A;  4Z5T B;  5M19 A;  3HJK A;  5BPV A;  1PDC A;  1GPF A;  4WZ4 A;  3IXB A;  4NYU A;  2CV5 A;  1YLP A;  3EEH A;  3O3V A;  2JC7 A;  5CTM A;  3A6N C;  5HAP A;  4KGC B;  5CEC A;  3Q1F A;  3O62 C;  4R3J A;  3MSH A;  4EW7 A;  4EBN A;  4G92 C;  4OQI A;  3N3F A;  2B5R A;  3AN2 A;  2CV5 B;  1SCW A;  4KEN B;  1JFI B;  5G49 B;  4IVI A;  3VFF A;  3ZGA B;  4M6B A;  3NUL A;  5DNN C;  3AZN B;  4NZ5 A;  2I72 A;  1H0G A;  2HP9 A;  1P3P A;  2EX6 A;  5GXQ A;  5F82 A;  2B18 A;  3NQU A;  4JBF A;  1QO6 A;  1JFI A;  2J3W A;  5CPJ C;  1T3U A;  1P3K C;  1BUL A;  3UDI A;  4OUI A;  4OVD A;  3W4P A;  1K4F A;  4CLC A;  4NG2 A;  5JA4 A;  1ZG4 A;  3OC2 A;  3AYW D;  4QU3 A;  4HHD A;  3KXB C;  4GDB A;  3L9K A;  3W8K A;  4JF4 A;  4KG6 A;  5IS1 A;  1E15 A;  4S2M A;  3AFA B;  3VH6 T;  2ZC5 B;  3NDE A;  5B0Z C;  3EPJ A;  4JJN A;  4OPZ A;  4N1H A;  4J8V A;  1CQA A;  5AV6 A;  1XJ6 A;  1XJ4 A;  2B95 A;  4N92 A;  3AZE A;  5G4Y A;  3AZM B;  3BFF A;  2HV1 A;  4DE3 A;  4CQH A;  1Y54 A;  5G49 A;  4S2O A;  3FZC A;  5GT0 C;  2EXA A;  4PM7 A;  3CUE C;  4HI4 A;  1GSV A;  3HVF A;  1TS0 A;  3TOI A;  2GZA A;  5E5A A;  5GXQ B;  3GQZ A;  3BEC A;  2HGV A;  3DWK A;  1BFM A;  1ZKJ A;  3NOP C;  3VP3 A;  2F2A C;  1YU2 A;  3C1C A;  4CLC B;  2A2L A;  5D3O A;  5CPJ A;  5FAT A;  5BOH A;  5F99 A;  4DRA A;  1XA7 A;  1KX3 C;  2W3F A;  5AV6 D;  5GT0 B;  3X1V A;  3C1B D;  1XGI A;  3BLM A;  1SKF A;  4LCM A;  4Q0H A;  1WYB A;  3BFE A;  3WTP A;  4ZAM A;  5CPK B;  3MR0 A;  3REJ C;  3W98 C;  1ES5 A;  2X71 A;  3W96 C;  3Q07 A;  3F1O B;  1FIK A;  4GZB A;  3BY8 A;  3UB7 A;  2ZY4 A;  5HDS A;  5F99 B;  1YU4 A;  4C3Q A;  5B1L A;  3B3X A;  1FSY A;  2EFX A;  4H9Q A;  1LL5 A;  4UQI S;  4UHU A;  3E2L A;  4QJG A;  4XUJ D;  3MNN B;  1Q2P A;  3F1O A;  5E2E A;  1UWN X;  3V9R A;  2FZ0 A;  3IH9 A;  5B1L B;  2KOI A;  5E5A B;  4KGC D;  2Q0O A;  4E6X A;  2WKI A;  4A5R A;  4NZ4 A;  3WD4 A;  4I3J A;  4GD8 A;  3OCL A;  3LEL D;  1XJ3 A;  3CUE A;  1W1Y A;  2Y2P A;  3A1K A;  1M1A C;  1GHI A;  2JN7 A;  3VP2 A;  4E3M A;  5F69 A;  3KX0 X;  1KX3 A;  4DDY A;  3IS2 A;  1K55 C;  3LIB A;  3S4X A;  5AV9 A;  2EFU A;  1N1J A;  1SZV A;  4ETZ A;  4HME A;  3FC7 A;  4XUJ A;  3T4S A;  4EET B;  5AJG A;  1P3F B;  4ZTK A;  4ZUX B;  3BWL A;  4TX8 A;  3ZG9 B;  3T4O A;  3SS4 A;  5GT3 C;  4KZ5 A;  2NUP C;  3X1V D;  4CLC E;  2YFW A;  1Y4O A;  3V9R B;  4XT2 A;  3HBR A;  2P08 A;  4CAY A;  1KX4 D;  1X0O A;  2HIO C;  4PHT A;  3KS4 A;  5M18 A;  3WA9 A;  4ZDX A;  5FAO A;  4MB3 A;  1KX3 D;  3MKE A;  5I94 A;  1BZA A;  3LFV A;  4E3O A;  3V39 A;  3PBQ A;  2YFW B;  4LV3 A;  4WLA A;  2A3U A;  1N4O A;  1E6Z A;  4H6J A;  3GRJ A;  3NQJ B;  4QHC A;  4LD9 C;  4R0Q A;  4YIN A;  3EPH A;  3HUM A;  5EM1 A;  2WK0 A;  4DXC A;  3KUY A;  2JBF A;  3R7W B;  2QKP A;  2HIO B;  1P3F A;  2JKF A;  3KSG A;  3B0D B;  2IWB A;  2L0W A;  1PWG A;  1IKG A;  1ID3 C;  5B32 D;  1YKD A;  1EI5 A;  1MKI A;  5AV8 B;  3OCN A;  3B0C W;  4BWI A;  3C4P A;  1ES2 A;  3MZE A;  3A3I A;  3ZG8 B;  4EU0 A;  4PM5 A;  3IXD A;  3AZH A;  2G5H C;  1RGZ A;  1SDE A;  5CTN A;  4OOY A;  4Y15 A;  5FI7 A;  2JSS A;  4BEN A;  3FV7 A;  4GHI B;  1CI8 A;  1M6K A;  5HWT A;  4E45 A;  2P74 A;  1EAK A;  3FKW A;  3AYW C;  2ZQD A;  2D02 A;  4IBG A;  3GDI A;  1LSX A;  4BL3 A;  1J3W A;  3Q7V A;  4N1X A;  4XZQ C;  3O87 A;  4Z66 B;  1IEL A;  3MGS A;  2AVX A;  3C1B C;  2H10 A;  1KS0 A;  5B0Z A;  2Z6D A;  1I2S A;  3KUY B;  4N9K A;  2LB9 A;  4FH4 A;  2HIO A;  2NQB D;  3MNN C;  1XA1 A;  3AZI D;  2W3G A;  2WKR A;  3Q7V B;  5K5B A;  4EO5 B;  4Y3I A;  2HIO D;  2NQB A;  4PM9 A;  4LD9 A;  3KXB A;  1KX4 C;  4DMZ A;  4EUV A;  4BD1 A;  3D9Y A;  1YLT A;  2A24 A;  2E8I A;  1W1V A;  3Q82 A;  2OV5 A;  4IJF A;  2ZMF A;  4EES A;  3GEC A;  3WAA C;  4LD9 B;  1FOF A;  4OLG A;  5DKL A;  1U60 A;  1P3L A;  5CHU A;  4XZQ A;  4NXF A;  3LGO A;  3SH9 A;  1FCM A;  2FN2 A;  1NZO A;  1JTG A;  1M19 A;  4S2N C;  4IBF A;  3AN2 D;  3C8C A;  3WD3 A;  5EVI A;  3A1I A;  3KWQ C;  2K31 A;  1GSW A;  1N9B A;  1ES4 A;  3WS0 A;  4U0X A;  5AY8 A;  2WKE A;  3ITA A;  3B42 A;  4DE2 A;  1J9M A;  4GD6 A;  2J9P A;  1T1C A;  4ZBE A;  3HLC A;  4X6T A;  4X23 A;  2MJ6 A;  3BFC A;  3F6T A;  3G4P A;  1YLZ A;  4R4R A;  3KSY A;  3O86 A;  4JGP A;  4S2J A;  1E88 A;  3KXB B;  4GKU A;  5F5Y A;  5DNM B;  1K54 A;  5AQB A;  5J4E A;  1D1J A;  2PD7 A;  5CX7 A;  1G6O A;  2Y2O A;  2JKR M;  3L7H A;  5HFO A;  3MS6 A;  4J8X C;  3UB5 P;  3W97 A;  3GMW A;  3KO6 A;  3AL0 C;  1F9I A;  4KG5 A;  3CPT A;  1N9O A;  4QY5 A;  3WTP D;  4S2I A;  3TRC A;  3FPW A;  5L2F A;  5L09 A;  2VEA A;  1P3L B;  1RCJ A;  4YS3 A;  1KDW A;  3CLO A;  3TE8 A;  3VV4 A;  4R70 A;  5HAI A;  3LZ0 C;  1BH8 A;  4ME4 A;  4WMC D;  3HRE A;  4DJ2 A;  3S1Y A;  4NYY A;  4IBJ A;  3QP5 A;  1F1E A;  3P5J B;  2IWC A;  5DF8 A;  4HGA C;  3M7P A;  4NE3 A;  1KOU A;  3LZ1 B;  1F66 D;  3LEZ A;  3VE3 A;  3HLB A;  2VGJ A;  4S2N A;  5E2G A;  3REH A;  3EEA A;  1BH8 B;  5GLD A;  4CPK A;  2XD1 A;  4QPR A;  3N6I A;  3L2A A;  3LJA B;  2PYR A;  3ULF A;  2Y91 A;  5HDC A;  4YM6 B;  3MGQ D;  1Q2Q A;  1TDG A;  3RJU A;  3W98 B;  3AYW B;  4CAY B;  1BSG A;  1PRQ A;  2HP6 A;  3A0R A;  1PIO A;  1TEM A;  5GHZ A;  3UB6 A;  1HZO A;  4I3A A;  2XGN A;  3LJA A;  1VB6 A;  2PHY A;  5A93 A;  3B6G A;  4FUW A;  2ZM0 A;  1P3A A;  3LJA D;  5IT5 A;  3ZDJ A;  4K0W A;  2OSU A;  2ZM8 A;  1U35 D;  4K91 A;  4H6J B;  5B0Y B;  3AV2 B;  4ID4 A;  4Q0J A;  3UPN A;  1K56 A;  3AV1 B;  1U35 A;  1AIW A;  3IX8 A;  4WZS B;  4X23 D;  4KZ4 A;  4RYE A;  4EQI A;  2RCX A;  1ZLA A;  2Z6C A;  3PBT A;  3E4O A;  5AQ7 A;  4PM6 A;  2NZD B;  5BO0 A;  3HCY A;  2P9V A;  3T1Q B;  2Q9M A;  3W97 C;  2D01 A;  3BM6 A;  2M7V A;  1S67 L;  2JKG A;  5F6A A;  3UTB D;  5B1M D;  2V20 A;  5KIZ A;  1EQZ D;  2Y2G A;  5JRG A;  3UTA B;  4GDN A;  1ZLA B;  3AV1 D;  5B0Y C;  3AV2 C;  1VET A;  1GA9 A;  1XFQ A;  4J8U D;  3NEC A;  3NDG A;  3AFA D;  3BLS A;  1PYY A;  1YMX A;  2L4R A;  2VGL S;  1GHM A;  1W1P A;  1YU3 A;  4L0L A;  4HMD A;  2DQN C;  3VP1 A;  2WAF A;  4WYY A;  4C6Y A;  3X1T B;  3WRT A;  1P34 C;  1F66 A;  4R1G A;  2HJE A;  2V1Z A;  1O07 A;  4LV0 A;  5GT3 B;  4MBF A;  3IWI A;  1NZU A;  4ZRR A;  3MVD A;  2OLU A;  4DN0 A;  3AZG A;  2FJ7 C;  3AZJ C;  1U35 B;  2DCF A;  4IBI A;  5KZH A;  4B9O A;  1TZY B;  5F99 D;  3HLE A;  4M3K A;  4ARZ A;  3ZQ5 A;  3T1S A;  2Y2M A;  3LIE A;  3W97 D;  3IBJ A;  3T1X A;  5CPK D;  4H9O A;  1BTL A;  4OH0 A;  4H9R B;  4PKY G;  3SH7 A;  3C1B B;  2YFV A;  1K57 A;  1P3O A;  1PZR A;  3HLW A;  5AVB D;  1ID3 D;  4ARZ B;  1P3L C;  4OP8 A;  3TU4 B;  2CWE A;  3AZJ B;  1U35 C;  1ERM A;  1ALQ A;  4KUK A;  3UO9 A;  3LUQ A;  2FH5 A;  1Y28 A;  1YQS A;  4GB7 A;  1W7F A;  1Z6F A;  2IO5 B;  2EXB A;  2R9X A;  2WYX A;  4MMN A;  3KWQ D;  5AVC A;  4HP9 A;  1F2K A;  4Z5T A;  3CAX A;  3UTB B;  3MQQ A;  2HDR A;  5AY8 B;  3CIT A;  5HAQ A;  3G2Y A;  2XDM A;  1G5U A;  3N4I A;  4KGC C;  3OOV A;  1M40 A;  1HQ3 B;  5FQK A;  5JYO A;  5EEC A;  3WS1 A;  2B02 A;  4KUD C;  3B0B A;  5EPH A;  5FQI A;  4WF0 A;  5B0Y D;  3AV2 D;  1XJ2 A;  4H9N A;  5FSR A;  2IA2 A;  1PI4 A;  3AZL D;  4K0X A;  5EM0 A;  3P09 A;  1HQ3 A;  1ONG A;  4FCF A;  3NY4 A;  4BD0 A;  3UE3 A;  3MQO A;  3KS8 A;  4S2K A;  5EVE A;  1W63 Q;  3V5M A;  5CGW A;  2HF6 A;  1PW8 A;  4G3W A;  3V67 A;  1IKI A;  4MB5 A;  1P3P B;  2ZC7 A;  3GR2 A;  1P3O C;  5AV8 D;  4YS3 C;  1N9N A;  3AV1 C;  2BTF P;  3A3F A;  4N9L A;  3V3R A;  3AFA C;  1LI9 A;  4ZUX C;  1DY6 A;  1ESU A;  3AZF C;  4Q0I A;  2JKT I;  3R45 A;  5E2F A;  4MN7 A;  3WS4 A;  1W63 M;  2PU4 A;  3AZN A;  1P3L D;  3W98 A;  3UT9 A;  1OPX A;  1UWP X;  1SDN A;  3PBS A;  4R3A A;  1KVL A;  5E5A C;  4OJ5 A;  3W4Q A;  5EVI D;  2V1A A;  4E3L A;  5DTS A;  2RVQ C;  1KX4 B;  5B32 A;  1IEM A;  4KGC A;  1KGE A;  3AZL B;  2ZY5 A;  3IHA A;  5CPJ D;  5CHJ A;  5TFQ A;  3KFU G;  3LJA C;  3G30 A;  3JYI A;  3UT9 B;  3VH5 T;  4WEL A;  5B2J A;  4Z1W A;  2ZQA A;  4KZA A;  1E6R A;  3KXB D;  1KX5 A;  5CPI D;  1CXW A;  1K4E A;  1BLC A;  1YU1 A;  4GS9 A;  4NY2 A;  1S32 A;  4J8V B;  1K6R A;  4U3T A;  4WNN A;  5FEF A;  1P3G B;  1YAX A;  1L0D A;  5EV0 A;  1O6I A;  2J3T C;  2XLN A;  2DRW A;  3VE4 A;  3NCK A;  4Z2M H;  4GS9 B;  4IBE A;  3LEL B;  3LZ0 B;  1MC0 A;  4WV4 B;  3HLG A;  3DTE A;  4NZ3 A;  1OTB A;  3QNB A;  4UPK A;  3O62 D;  2WGI A;  5EOO A;  5B24 D;  3REK B;  4IBC A;  3B6G C;  2WGV A;  3F1N B;  3AZG D;  1P3A D;  4XXR A;  5GLC A;  2ZC3 B;  3REL C;  1KX4 A;  1OTA A;  5EVI C;  1YLY A;  5HAR A;  1IYO A;  1OJG A;  1YLW A;  3LEL A;  3UB9 A;  3VSL A;  2V8F A;  4Z2G A;  2J8P A;  5HZH A;  1KX5 D;  1S32 C;  1YSP A;  4UUZ B;  1P3P C;  4H9S A;  5CPK A;  4BBV A;  3GV9 A;  1P3G D;  1L2S A;  2YKF A;  4LRZ E;  3REL D;  3AZK A;  1S4S A;  5L10 A;  4O0P A;  5FA7 A;  3WAA D;  4H8R A;  4UA6 A;  1TZY A;  1LL8 A;  2VV8 A;  4KZ3 A;  5B2J C;  4E44 A;  2XR0 A;  1HVB A;  5AV9 C;  1EW0 A;  1LI0 A;  2KX6 A;  2QJ5 A;  2QZ6 A;  4WJ3 C;  2Z2M B;  3G35 A;  3C1C B;  5F1G A;  2XQZ A;  2PBY A;  5CPJ B;  3LZ0 A;  1P34 D;  1UGU A;  4R8P B;  3FPV A;  5GT0 A;  3X1V B;  4J8W B;  3AZJ A;  4KZ8 A;  3LID A;  4RVA A;  5B2I C;  5AV5 C;  3CHW P;  4J8V C;  1L3L A;  4WU8 A;  5CP6 A;  4EWF A;  5B1M B;  5B33 C;  1AWI A;  4L9E A;  1E3U D;  2XFT A;  3VFH A;  3IX4 A;  4J8W A;  5FI2 A;  4Z66 C;  5A92 A;  3CJM A;  2F8N H;  1MPL A;  3UE6 A;  1W5D A;  5JRG D;  4FH2 A;  4IJG A;  4XUJ B;  3MNN D;  4G92 B;  2OWJ A;  5DTT A;  3W96 A;  5B2I B;  5AV5 B;  3WD2 A;  4JGQ A;  2GNX A;  5AV6 C;  4DRB A;  4MBK A;  3MF0 A;  2V5O A;  4Y7P A;  3LIC A;  3C5A A;  3T4Q A;  2K2N A;  2ZL1 A;  5F99 C;  4WZ5 C;  4IJE A;  3QP1 A;  5CGX A;  2X02 A;  3IXG A;  5GSU A;  3NOU C;  4GCZ A;  2WAE A;  1KX3 B;  5EVL A;  2LB5 A;  5GSU D;  3LY3 A;  3WX7 A;  3B6F C;  4WU8 D;  3UDX A;  3OPL A;  3D72 A;  5AV8 C;  3AZE D;  5B1M A;  1TD5 A;  4UA9 A;  5EOE A;  3SS3 A;  1T18 A;  1P3M D;  3R4K A;  1JWV A;  2VZW A;  3MMH A;  2VX8 A;  4JF5 A;  4AWL C;  3I7J A;  3H0L C;  1GSX A;  1ZLA C;  5AY8 D;  2PYO C;  5I5L A;  3PYP A;  1H8M A;  4Z66 A;  3LYX A;  1F66 C;  3WA9 B;  1YMS A;  2EX9 A;  4UEY A;  4OPQ A;  3MGS B;  1SKO A;  4OOL A;  3A6N A;  5E2H A;  3UMD A;  1FIL A;  2PAV P;  3AGF A;  2V8C A;  5GXQ D;  2ZD8 A;  4Z2J A;  3MXS A;  1ZLA D;  1H0I A;  3C7U A;  2NQB C;  5B33 D;  3PTE A;  2VKS A;  4KG2 A;  4KUD B;  1SKO B;  2PYO B;  1YT4 A;  1P3K B;  1DP8 A;  3BYD A;  2QHK A;  4Y0U A;  4JGO A;  1P9R A;  4KUO A;  5G4Z A;  4H9P B;  2WKP A;  3RXX A;  3NQU B;  1I5Q A;  2PU2 A;  2DNS A;  4JXW A;  2P04 A;  4PKY A;  3N7W A;  4PMA A;  2W8S A;  1W1T A;  1P3G C;  4Z2M G;  1MWU A;  4LLO B;  4H9P A;  1AOI B;  2W3D A;  5FQQ A;  5AY8 C;  1E6P A;  4OQG A;  3ZYT A;  4HJ4 A;  1LSW A;  4HJ3 A;  4FTX A;  3T12 B;  4X56 A;  2CC1 A;  4P6Z S;  5AV6 B;  3G6O A;  2EWW A;  3X1U B;  3AZM A;  1P3I B;  3AGE A;  4YOF A;  1NRF A;  2G2U A;  5CEB A;  1AOI A;  3WKJ C;  4S2L A;  5HDD A;  5CER A;  4XZQ D;  3IWO A;  4G91 B;  5BS7 C;  3E4Q A;  4KZ7 A;  5BNX B;  3SH8 A;  4R4S A;  5GHX A;  4KUD D;  5AVB C;  3MKF A;  4Z5T C;  4G3V A;  3B0D C;  3L27 A;  2V0U A;  2ZQ8 A;  4KZ6 A;  3MGQ C;  4OPR A;  1K6S A;  5DF9 A;  2O0Y A;  1BH9 B;  3DBA A;  1GCE A;  2A24 B;  4KQQ A;  3OBF A;  4X68 A;  1H8Y A;  3LIF A;  3WTP B;  1KVM A;  2PD8 A;  3H0R C;  3ZG0 A;  4MBH A;  2ZQC A;  2VGL M;  4Z5T D;  2WKQ A;  4EEU A;  4R8P C;  4C75 A;  4HBT A;  1B67 A;  3C1C D;  3REL A;  3AZK D;  3CG5 A;  2PBD P;  3TJZ C;  2FFF B;  1ODV A;  1TVF A;  3Q81 A;  2QMI A;  5HPI A;  1LHY A;  5HW3 A;  5AV9 B;  4OPY A;  3UDF A;  2JCH A;  4YM6 D;  4DXB A;  3EG5 B;  3REL B;  4NET A;  1M18 C;  5BNX A;  5DFY A;  3AZN D;  4P0M A;  1BLS A;  4OQ0 A;  4Z9Q A;  1VHM A;  3EQV A;  1UR8 A;  1XKZ A;  4EBP A;  3B6G B;  5CP6 C;  2QJ7 A;  1PI5 A;  1M18 D;  2F8N K;  2ZQ7 A;  1BLP A;  2W1R A;  4I38 A;  3VH6 W;  3L25 A;  3REI B;  4JXG A;  3AN2 C;  4EUZ A;  1LT0 A;  1KU5 A;  3EOI A;  4RA7 A;  3AZI C;  2Y2H A;  4JLF A;  2ACG A;  4NE5 A;  5FAS A;  2P9V B;  4Y2F A;  4ZUX A;  3JVU A;  1K54 C;  3X1U C;  1P3I C;  1YU0 A;  1M1A B;  4WM9 A;  4KZ9 A;  3ZVW A;  4P6Z M;  1O7E A;  4L9F A;  5IU1 A;  1K55 A;  3ZVT A;  3T4J A;  4LRX C;  2BYM A;  4WU9 C;  4P85 A;  2Y2L A;  4BBT A;  1M1A A;  2G7U A;  2OAP 1;  3RH8 B;  2ARO B;  3N8R A;  4WBG A;  1HTA A;  1LSV A;  3VH5 A;  3MVD D;  1M18 A;  4QY6 A;  5DFX A;  3IXH A;  1CJF A;  1F5M A;  2X01 A;  1TF1 A;  3IH8 A;  4S2P A;  2D49 A;  5B1M C;  5TR7 A;  1PZP A;  4Y17 A;  2ARO A;  4J8U C;  1ZC2 A;  1P3A B;  4EER A;  1M18 B;  3PXP A;  3RFB A;  3IF5 A;  5FAP A;  4Z2I A;  4MEZ A;  2Y59 A;  4RX2 A;  3REH C;  1CEG A;  1S32 D;  1P3O D;  1K57 C;  4NFT A;  4HJ6 A;  3WKJ D;  2J3T D;  4JF6 A;  4J8X A;  4OJL A;  3MBZ A;  1E6N A;  4U0T A;  1P3O B;  4LV1 A;  3CZD A;  4CSR B;  5GLB A;  4DQY B;  3M6H A;  1KE0 A;  3BY9 A;  5CRF A;  4GHI A;  2NQB B;  5IHV A;  1NYM A;  1P3A C;  3A3D A;  3AZG B;  2WKH A;  3NBL A;  1YPR A;  5CPI C;  3WS2 A;  2WZZ A;  3DWZ A;  4KZB A;  5J8X A;  1XGJ A;  4CSR A;  1NRJ A;  1WE4 A;  2F8N G;  5HWW A;  1EWZ A;  3B47 A;  2BG1 A;  2XF3 A;  2RTS A;  2JKT M;  3UNW A;  3B6F B;  4DF6 A;  4EO5 C;  3WWX A;  1CF0 A;  2V9A A;  3DAV A;  2H28 A;  2ARO D;  3C1B A;  4HBU A;  1H3O B;  5EVI B;  2Y2I A;  4J8V D;  1FR1 A;  3C4O A;  3IT9 A;  3ICY A;  4G91 C;  4FSF A;  1FQG A;  3V50 A;  4K08 A;  4X25 A;  4DJ3 A;  1HD8 A;  3KYZ A;  1ESI A;  2ARO C;  2W0N A;  5JRG C;  3TSG A;  1DP6 A;  3NI9 A;  2DMW A;  3LI9 A;  4FOF A;  3AZM D;  2CV5 C;  3ITB A;  2J7V A;  3H82 B;  4BQM A;  1CK7 A;  3CI6 A;  5B1L C;  1JWZ A;  2IO5 C;  1T19 A;  5DNN B;  3AZN C;  4XZQ B;  1S6R A;  1NYY A;  1GXD A;  3REI C;  5TBM B;  1S0W A;  4UA7 A;  4MB4 A;  3E4P A;  2GX5 A;  4X53 A;  3BRM A;  1VEU B;  4H9N B;  4J8U A;  1KDS A;  1OTD A;  3ISG A;  1AOI C;  3WKJ A;  5B1L D;  3GVB A;  5DNN A;  3B6G D;  5AVF A;  3SOI A;  5AVB A;  1H3O A;  5CHM A;  3K3C A;  4MN6 A;  3O5Y A;  3QNC A;  3V3S A;  3L26 A;  3P98 A;  3AZF B;  5B32 C;  2W1T B;  1NLY A;  2ZBB A;  3O62 A;  5DNM A;  5J7E A;  1JVJ A;  1ZHH B;  2NUT C;  2HDS A;  2CMN A;  4F94 A;  1P3B B;  5DTK A;  3MGP C;  3S22 A;  3RXW A;  3X1U D;  1P3I D;  2C5W B;  5DJU A;  3KYQ A;  3KWQ A;  1DJA A;  3OPH A;  3IF6 B;  3N8S A;  4MN5 A;  2W1T A;  2Z2L B;  3QHY A;  4OJP A;  4WZ5 A;  2M7U A;  2VGK A;  3G34 A;  3BFD A;  4YS3 B;  2XA7 M;  2EX8 A;  5B2J B;  4KQD A;  3A3E A;  3KWQ B;  3BQA A;  3IX3 A;  1TS8 A;  4Z2H A;  4WEJ A;  2HUE C;  4YWZ A;  4EQ1 A;  3REI A;  4J8U B;  1OTE A;  4ZBJ B;  4NZ1 A;  1H0M A;  4GN2 A;  4WNN B;  3UTA D;  3NOT C;  4YNR A;  3NHQ A;  4NXB A;  4EEP A;  3LY4 A;  4E3N A;  1P3M A;  5AVB B;  1GHP A;  5JYP A;  3REH B;  4IHQ A;  4HEF A;  2RL3 A;  4JXV A;  2PYO D;  3BFG A;  3LR3 A;  4UQI M;  5DVA A;  4BLM A;  4PM8 A;  4NKP A;  1MWR A;  1R4V A;  1ULY A;  2RVQ D;  3WTP C;  1TS7 A;  4D2O A;  3REK C;  3AZI A;  1P3B A;  3ZFZ A;  4LG2 A;  2H0Y A;  3ZG7 B;  3AZH D;  1KGG A;  1P3M B;  2PR5 A;  1HQ3 C;  5FDH A;  4MDZ A;  3IF6 A;  1JNU A;  3AZE C;  4Z2L A;  1MY8 A;  3AZJ D;  2G2W A;  4OQH A;  4JXS A;  3PR6 A;  3NC8 A;  3REJ A;  5DJT A;  2JHE A;  1E4D A;  2WUQ A;  1V9Z A;  1CK3 A;  3FWL A;  3MGP A;  2XH9 A;  3LR5 A;  3TU4 C;  3PAE A;  2ZY2 A;  3GSG A;  1P3G A;  2OOL A;  4P6B A;  3AV1 A;  4HGA B;  4HY8 A;  1M19 D;  4OJ6 A;  5A90 A;  5B0Z D;  3AZE B;  2NZD A;  1PNE A;  3VOZ A;  2VLG A;  3AZK C;  3LI8 A;  4JKT A;  4WMC A;  1OTI A;  3REK A;  2Y2J A;  2FJ7 D;  5L8M A;  1ZG6 A;  1IFQ A;  2QPN A;  3X1V C;  2W3H A;  4HH2 A;  4QWO A;  5JRG B;  3OLO A; 
#chains in the Genus database with same CATH homology
 4OKP A;  5AQ9 A;  1P3K D;  3X1S D;  3W99 C;  3PBN A;  3HUN A;  1IYS A;  4GH9 A;  5B33 B;  4H9O B;  2HDU A;  5B2I D;  5AV5 D;  2YFV B;  3M2K A;  5DNN D;  3EPK A;  3HL9 A;  3EQU A;  1CEF A;  1EQZ B;  5GSU C;  4OON A;  2HUE B;  4EBL A;  5KDM A;  1PW1 A;  3H0M C;  1VM1 A;  1W8Q A;  5E43 A;  2NZD D;  4ZBJ C;  3A6N D;  2F8N B;  4BL2 A;  3CMZ A;  1KX5 C;  4ZJ1 A;  1TAF B;  4KHA A;  3HLD A;  4DE0 A;  1WYC A;  1E3U A;  4WU8 B;  4IVK A;  4X23 C;  3MZF A;  2GDN A;  5GSU B;  4ZJ3 A;  2WAD A;  2CV5 D;  3MGP D;  3IWQ A;  4UAA A;  4E6W A;  1TDL A;  5G18 A;  3W96 D;  1KE3 A;  2ZC4 B;  3W98 D;  2Y2Q A;  5B24 B;  3LEL C;  3REK D;  2FJ7 A;  2WZX A;  4XUZ A;  4GNU A;  2XFS A;  3DTM A;  3MGR D;  1ID3 A;  1N1J B;  5GL9 A;  4PPR A;  4ZJ2 A;  5CED A;  3LZ1 C;  4WU9 B;  5HL1 A;  3NQJ A;  2ZLY A;  5KMW A;  1TAF A;  3AZL C;  4OJO A;  1DJB A;  3W99 D;  3REJ D;  4IBB A;  5CGS A;  4QLC A;  3G31 A;  1KE4 A;  2XK1 A;  2IOU A;  4Y0T A;  1NJ4 A;  5BT1 D;  4WU9 A;  1LL9 A;  1P34 B;  3ZNY A;  4JPM A;  2R9W A;  4DE1 A;  3AN2 B;  1VQQ A;  5BT1 C;  5FI6 A;  5CPI B;  1L0G A;  4J8W C;  2UWX A;  1MXO A;  1PWC A;  5FQM A;  4WU8 C;  1G6A A;  1MBL A;  2ZM5 A;  5A91 A;  1M1A D;  2ZM2 A;  3FKE A;  3DW0 A;  2RIQ A;  3B0C T;  1IYP A;  4QLC B;  4QNL A;  1QMF A;  4KQO A;  4JJN D;  3AFA A;  3ZHH A;  2ZQ9 A;  3AZM C;  4JJN B;  3AZL A;  4NK3 A;  5GHY A;  2ZMA A;  1JTD A;  3LZ0 D;  5TGF A;  5FAQ A;  1W79 A;  4BJP A;  1LLB A;  1XXM A;  5CHL B;  4LEN A;  5JA4 B;  2PYO A;  1BH9 A;  3OZH A;  1P3P D;  3IF6 C;  3GTC A;  5FQJ A;  2V2F F;  3VP0 A;  2H5S A;  2Q9N A;  5KSC A;  3UPO A;  3X1S C;  4WU9 D;  3A3J A;  3OPR A;  1FR6 A;  3B6F D;  5U47 A;  5F1F A;  4X69 A;  5FUG A;  1C3B A;  4FD8 A;  1W8Y A;  4IBR A;  4YM6 C;  4H9Q B;  1HQ3 D;  3VH5 W;  1HTZ A;  5E5A D;  2ZJ9 A;  4J8X D;  3X1S B;  2XD5 A;  3C1C C;  3W99 A;  4HES A;  3ZG5 A;  3E2K A;  4OOM A;  3X1S A;  5B40 A;  5DNM C;  1MWT A;  3UN7 A;  5B32 G;  4MNR A;  3WTP E;  5AV5 A;  5B2I A;  3W96 B;  3MGR A;  1H8Z A;  4YFM A;  1L0F A;  2IWD A;  3W97 B;  1WWS A;  3MNN A;  1ERO A;  1FCN A;  5B31 A;  1YLJ A;  4LV2 A;  3Q7Z A;  3UTA C;  3WS5 A;  1QME A;  1NY0 A;  5B40 D;  3W99 B;  2Y55 A;  1ONH A;  1BT5 A;  1RGY A;  1L0E A;  3ZCZ A;  4AWL B;  4YM6 A;  3MGR B;  2BYM B;  3TU4 D;  3L28 A;  4GOG A;  3MXR A;  1XPB A;  3HSH A;  4QD4 A;  3UTA A;  4B4X A;  1P34 A;  1YM1 A;  3N8L A;  3D4F A;  5B31 C;  2ZC6 B;  3VMA A;  1AOI D;  3LO7 A;  5CPI A;  2J9O A;  2A49 A;  4E3K A;  1P3K A;  1P3B D;  4CJN A;  3M2J A;  1B6W A;  3HUO A;  2HDQ A;  5B40 C;  5AV9 D;  3B6F A;  3AGD A;  5B24 C;  3A6N B;  5GT3 D;  3VSK A;  4J8X B;  5BNV B;  1FSW A;  4DDS A;  1BUE A;  5M1A A;  5AV8 A;  5DF7 A;  4KUD A;  4O7D A;  4H9S C;  5CPK C;  3UE0 A;  3AZH B;  5GLA A;  1F66 B;  3WA9 C;  3MGS D;  5BNV A;  3NIA A;  2Y2K A;  5B2J D;  1K56 D;  1PWD A;  4DRT A;  3REH D;  2C6W B;  1KGF A;  4X23 B;  1DJC A;  3MGS C;  2BYK B;  4MLL A;  1BLH A;  4EV4 A;  4J8W D;  1K25 A;  2DF4 C;  3AZH C;  1ERQ A;  5B0Z B;  4H9R A;  3X1U A;  1P3I A;  1JWP A;  4YS3 D;  5EUA A;  1M19 B;  1Q9C A;  1IYQ A;  3IP4 C;  5BS7 A;  5DNM D;  4WEK A;  3AZF A;  5FUG B;  5FQ9 A;  1NXY A;  2JE5 A;  2OLV A;  4LD9 D;  3MGQ B;  2LY8 A;  4GHL A;  4IED A;  3WAA B;  1G68 A;  2WGW B;  4Q8I A;  1PZO A;  3C7V A;  1P3B C;  4IBX A;  3PBR A;  1Z2C B;  3WKJ B;  3LZ1 D;  2H0T A;  3TG9 A;  3MGQ A;  4NE6 A;  1CI9 A;  4R23 A;  3UT9 C;  3O88 A;  4XUJ C;  3UE1 A;  3KUY D;  3UPP A;  3O62 B;  5B40 B;  1MWS A;  3MGR C;  2HPB A;  3PBO A;  1E25 A;  4Z66 D;  2VQR A;  3PAG A;  4IBK A;  3WA9 D;  1AXB A;  1P3M C;  3AZI B;  5B31 B;  1I2W A;  2G5I C;  3LZ1 A;  3WAA A;  5AVC D;  4B4Z A;  5B0Y A;  3AV2 A;  2FFY A;  2HP5 A;  1YUE A;  3X1T C;  3REJ B;  3G32 A;  5EE8 A;  5C3I C;  2ZY3 A;  5BO0 B;  3VH6 A;  4OP5 A;  3FDD A;  5HX9 A;  3AZG C;  5CXW A;  3AZF D;  3R45 B;  1KX5 B;  4Y0O A;  1A7W A;  3VP4 A;  4LCL A;  3HLF A;  4E3I A;  4JJN C;  4OLD A;  1S32 B;  3MFD A;  4E3J A;  4P87 A;  3HON A;  3BEB A;  3ZNT A;  5B32 B;  5C3I B;  3W4O A;  4QLC D;  4IBD A;  3MGP B;  5CP6 D;  3AYW A;  3UTB C;  1FCO A;  1OME A;  3MVD B;  4KQR A;  2Y2N A;  5F83 A;  3KUY C;  1EQZ C;  1WWI A;  3EPL A;  3VOY A;  2F8N D;  5AQA A;  4UUZ A;  1P3F C;  3X1T A;  3AZK B;  1XX2 A;  2Y4A A;  5B31 D;  4R3B A;  1RP5 A;  4R8P D;  1H5X A;  3OPP A;  3SS5 A;  1TZY C;  1K38 A;  1ES3 A;  3REI D;  4XUX A;  2J8Y A;  2L5A A;  3FYZ A;  4RX3 A;  3UTB A;  3WRZ A;  3LCE A;  5CP6 B;  1W2E A;  5GT3 A;  5B24 A;  2BYK A;  2FJ7 B;  3TU4 A;  4B88 A;  5GXQ C;  1ID3 B;  5B33 A;  5B31 G;  3MZD A;  4QLC C;  4R8P A;  1M19 C;  3M6B A;  5AVC B;  2BLS A;  2EX2 A;  1XP4 A;  3MVD C;  1EQZ A;  3UY6 A;  1SHV A;  1TZY D;  5KDM B;  3FKV A;  2WGW A;  2NZD C;  4GHA A;  2F8N A;  2XEP A;  4QB8 A;  3IQA A;  4X55 A;  4ZUX D;  4KHA B;  3G2Z A;  1P3F D;  5AVC C;  4DKI A;  1GA0 A;  5GT0 D;  3UT9 D;  3L29 A;  3IHB A;  3X1T D;  5KSH A;  4Z5T B;  5M19 A;  5BPV A;  4WZ4 A;  3IXB A;  4NYU A;  2CV5 A;  1YLP A;  3O3V A;  2JC7 A;  5CTM A;  3A6N C;  5HAP A;  4KGC B;  5CEC A;  3Q1F A;  3O62 C;  4R3J A;  4EBN A;  4G92 C;  4OQI A;  3N3F A;  2B5R A;  3AN2 A;  2CV5 B;  1SCW A;  4KEN B;  1JFI B;  5G49 B;  4IVI A;  3VFF A;  3ZGA B;  4M6B A;  5DNN C;  3AZN B;  4NZ5 A;  2I72 A;  2HP9 A;  1P3P A;  2EX6 A;  5GXQ A;  5F82 A;  3NQU A;  4JBF A;  1JFI A;  5CPJ C;  1T3U A;  1P3K C;  1BUL A;  3UDI A;  4OUI A;  4OVD A;  3W4P A;  1K4F A;  5JA4 A;  1ZG4 A;  3OC2 A;  3AYW D;  4QU3 A;  3KXB C;  4GDB A;  3W8K A;  4JF4 A;  4KG6 A;  4S2M A;  3AFA B;  3VH6 T;  2ZC5 B;  3NDE A;  5B0Z C;  3EPJ A;  4JJN A;  4OPZ A;  4N1H A;  4J8V A;  5AV6 A;  4N92 A;  3AZE A;  3AZM B;  3BFF A;  4DE3 A;  1Y54 A;  5G49 A;  4S2O A;  3FZC A;  5GT0 C;  2EXA A;  4PM7 A;  3HVF A;  3TOI A;  3GQZ A;  5E5A A;  5GXQ B;  3BEC A;  3DWK A;  1BFM A;  1ZKJ A;  3VP3 A;  2F2A C;  1YU2 A;  3C1C A;  5D3O A;  5CPJ A;  5FAT A;  5BOH A;  5F99 A;  4DRA A;  1XA7 A;  1KX3 C;  5AV6 D;  5GT0 B;  3X1V A;  3C1B D;  1XGI A;  3BLM A;  1SKF A;  4LCM A;  1WYB A;  3BFE A;  3WTP A;  4ZAM A;  5CPK B;  3REJ C;  3W98 C;  1ES5 A;  2X71 A;  3W96 C;  3Q07 A;  4GZB A;  2ZY4 A;  5F99 B;  1YU4 A;  4C3Q A;  5B1L A;  3B3X A;  1FSY A;  2EFX A;  4H9Q A;  1LL5 A;  4UHU A;  3E2L A;  4QJG A;  4XUJ D;  3MNN B;  1Q2P A;  5E2E A;  3V9R A;  3IH9 A;  5B1L B;  5E5A B;  4KGC D;  4E6X A;  2WKI A;  4A5R A;  4NZ4 A;  4GD8 A;  3OCL A;  3LEL D;  2Y2P A;  3A1K A;  1M1A C;  1GHI A;  3VP2 A;  4E3M A;  1KX3 A;  4DDY A;  1K55 C;  3S4X A;  5AV9 A;  2EFU A;  1N1J A;  4XUJ A;  1P3F B;  4ZTK A;  4ZUX B;  3ZG9 B;  3SS4 A;  5GT3 C;  4KZ5 A;  3X1V D;  2YFW A;  3V9R B;  3HBR A;  4CAY A;  1KX4 D;  2HIO C;  3KS4 A;  5M18 A;  3WA9 A;  4ZDX A;  5FAO A;  1KX3 D;  3MKE A;  5I94 A;  1BZA A;  4E3O A;  3V39 A;  3PBQ A;  2YFW B;  4LV3 A;  2A3U A;  1N4O A;  3GRJ A;  3NQJ B;  4QHC A;  4LD9 C;  4R0Q A;  4YIN A;  3EPH A;  3HUM A;  2WK0 A;  4DXC A;  3KUY A;  2JBF A;  2HIO B;  1P3F A;  3B0D B;  2IWB A;  1PWG A;  1IKG A;  1ID3 C;  5B32 D;  1EI5 A;  1MKI A;  5AV8 B;  3OCN A;  3B0C W;  3C4P A;  1ES2 A;  3MZE A;  3A3I A;  3ZG8 B;  4PM5 A;  3IXD A;  3AZH A;  2G5H C;  1RGZ A;  1SDE A;  5CTN A;  4OOY A;  5FI7 A;  2JSS A;  4BEN A;  3FV7 A;  1CI8 A;  1M6K A;  4E45 A;  2P74 A;  3FKW A;  3AYW C;  2ZQD A;  4IBG A;  4BL3 A;  3Q7V A;  4N1X A;  4XZQ C;  3O87 A;  4Z66 B;  1IEL A;  3MGS A;  3C1B C;  2H10 A;  5B0Z A;  1I2S A;  3KUY B;  4N9K A;  4FH4 A;  2HIO A;  2NQB D;  3MNN C;  1XA1 A;  3AZI D;  3Q7V B;  4EO5 B;  2HIO D;  2NQB A;  4PM9 A;  4LD9 A;  3KXB A;  1KX4 C;  4BD1 A;  1YLT A;  2E8I A;  3Q82 A;  2OV5 A;  4IJF A;  3WAA C;  4LD9 B;  1FOF A;  4OLG A;  1U60 A;  1P3L A;  5CHU A;  4XZQ A;  3SH9 A;  1FCM A;  1NZO A;  4S2N C;  1JTG A;  1M19 A;  4IBF A;  3AN2 D;  5EVI A;  3A1I A;  3KWQ C;  1N9B A;  3WS0 A;  1ES4 A;  4U0X A;  5AY8 A;  2WKE A;  3ITA A;  4DE2 A;  1J9M A;  4GD6 A;  2J9P A;  4ZBE A;  3HLC A;  4X6T A;  4X23 A;  3BFC A;  3F6T A;  3G4P A;  1YLZ A;  4R4R A;  3KSY A;  3O86 A;  4S2J A;  3KXB B;  4GKU A;  5DNM B;  1K54 A;  5AQB A;  2Y2O A;  5HFO A;  4J8X C;  3W97 A;  3GMW A;  3AL0 C;  4KG5 A;  4QY5 A;  3WTP D;  4S2I A;  5L2F A;  1P3L B;  1RCJ A;  4YS3 A;  1KDW A;  5HAI A;  3LZ0 C;  1BH8 A;  4WMC D;  3HRE A;  3S1Y A;  4NYY A;  4IBJ A;  1F1E A;  3P5J B;  2IWC A;  5DF8 A;  4HGA C;  4NE3 A;  3LZ1 B;  1F66 D;  3LEZ A;  3HLB A;  2VGJ A;  4S2N A;  5E2G A;  3REH A;  1BH8 B;  5GLD A;  4CPK A;  2XD1 A;  3N6I A;  3L2A A;  3LJA B;  2Y91 A;  4YM6 B;  3MGQ D;  1Q2Q A;  1TDG A;  3RJU A;  3W98 B;  3AYW B;  4CAY B;  1BSG A;  2HP6 A;  1PIO A;  1TEM A;  5GHZ A;  1HZO A;  2XGN A;  3LJA A;  5A93 A;  3B6G A;  2ZM0 A;  1P3A A;  3LJA D;  3ZDJ A;  4K0W A;  2OSU A;  2ZM8 A;  1U35 D;  4K91 A;  5B0Y B;  3AV2 B;  4ID4 A;  3UPN A;  1K56 A;  3AV1 B;  1U35 A;  4RYE A;  4WZS B;  4X23 D;  4KZ4 A;  4EQI A;  2RCX A;  1ZLA A;  3PBT A;  5AQ7 A;  4PM6 A;  2NZD B;  5BO0 A;  2P9V A;  2Q9M A;  3W97 C;  3BM6 A;  3UTB D;  5B1M D;  2V20 A;  1EQZ D;  2Y2G A;  5JRG A;  3UTA B;  4GDN A;  1ZLA B;  3AV1 D;  5B0Y C;  3AV2 C;  1GA9 A;  4J8U D;  3NDG A;  3AFA D;  3BLS A;  1PYY A;  1YMX A;  1GHM A;  1YU3 A;  4L0L A;  2DQN C;  3VP1 A;  2WAF A;  4WYY A;  4C6Y A;  3X1T B;  3WRT A;  1P34 C;  1F66 A;  4R1G A;  2V1Z A;  1O07 A;  4LV0 A;  5GT3 B;  4MBF A;  3IWI A;  1NZU A;  3MVD A;  2OLU A;  3AZG A;  2FJ7 C;  3AZJ C;  1U35 B;  2DCF A;  4IBI A;  5KZH A;  1TZY B;  5F99 D;  3HLE A;  4M3K A;  2Y2M A;  3W97 D;  5CPK D;  4H9O A;  1BTL A;  4OH0 A;  4H9R B;  3SH7 A;  3C1B B;  2YFV A;  1K57 A;  1P3O A;  1PZR A;  3HLW A;  5AVB D;  1ID3 D;  1P3L C;  4OP8 A;  3TU4 B;  2CWE A;  3AZJ B;  1U35 C;  1ERM A;  1ALQ A;  3UO9 A;  1YQS A;  4GB7 A;  1W7F A;  1Z6F A;  2IO5 B;  2EXB A;  2R9X A;  2WYX A;  3KWQ D;  5AVC A;  4Z5T A;  3UTB B;  2HDR A;  5AY8 B;  5HAQ A;  3G2Y A;  2XDM A;  3N4I A;  4KGC C;  1M40 A;  1HQ3 B;  5FQK A;  5JYO A;  5EEC A;  3WS1 A;  4KUD C;  3B0B A;  5EPH A;  5FQI A;  5B0Y D;  3AV2 D;  4H9N A;  5FSR A;  1PI4 A;  3AZL D;  4K0X A;  3P09 A;  1HQ3 A;  1ONG A;  4FCF A;  3NY4 A;  4BD0 A;  3UE3 A;  3KS8 A;  4S2K A;  3V5M A;  5CGW A;  1PW8 A;  1IKI A;  1P3P B;  2ZC7 A;  3GR2 A;  1P3O C;  5AV8 D;  4YS3 C;  3AV1 C;  3A3F A;  4N9L A;  3V3R A;  3AFA C;  1LI9 A;  4ZUX C;  1DY6 A;  1ESU A;  3AZF C;  3R45 A;  5E2F A;  3WS4 A;  2PU4 A;  3AZN A;  1P3L D;  3W98 A;  3UT9 A;  1SDN A;  3PBS A;  1KVL A;  5E5A C;  4OJ5 A;  3W4Q A;  5EVI D;  4E3L A;  5DTS A;  2RVQ C;  1KX4 B;  5B32 A;  1IEM A;  4KGC A;  1KGE A;  3AZL B;  2ZY5 A;  3IHA A;  5CPJ D;  5CHJ A;  5TFQ A;  3KFU G;  3LJA C;  3G30 A;  3JYI A;  3UT9 B;  3VH5 T;  4WEL A;  5B2J A;  2ZQA A;  4KZA A;  3KXB D;  1KX5 A;  5CPI D;  1K4E A;  1BLC A;  1YU1 A;  4NY2 A;  1S32 A;  4J8V B;  1K6R A;  4U3T A;  4WNN A;  1P3G B;  1L0D A;  2XLN A;  2DRW A;  3NCK A;  4Z2M H;  4IBE A;  3LEL B;  3LZ0 B;  3HLG A;  4WV4 B;  4NZ3 A;  3QNB A;  4UPK A;  3O62 D;  2WGI A;  5EOO A;  2WGV A;  5B24 D;  3REK B;  3B6G C;  4IBC A;  4XXR A;  3AZG D;  1P3A D;  5GLC A;  2ZC3 B;  3REL C;  1KX4 A;  5EVI C;  1YLY A;  5HAR A;  1IYO A;  1YLW A;  3LEL A;  3VSL A;  2J8P A;  1KX5 D;  1S32 C;  4UUZ B;  1P3P C;  4H9S A;  5CPK A;  3GV9 A;  1P3G D;  1L2S A;  3REL D;  3AZK A;  5FA7 A;  3WAA D;  4H8R A;  4UA6 A;  1TZY A;  4KZ3 A;  5B2J C;  4E44 A;  2XR0 A;  1HVB A;  5AV9 C;  1LI0 A;  2QZ6 A;  4WJ3 C;  2Z2M B;  3G35 A;  3C1C B;  5F1G A;  2XQZ A;  2PBY A;  5CPJ B;  3LZ0 A;  1P34 D;  4R8P B;  5GT0 A;  3X1V B;  4J8W B;  3AZJ A;  4KZ8 A;  4RVA A;  5B2I C;  5AV5 C;  4J8V C;  4WU8 A;  5CP6 A;  4EWF A;  5B1M B;  5B33 C;  2XFT A;  1E3U D;  3VFH A;  4J8W A;  5FI2 A;  4Z66 C;  5A92 A;  3CJM A;  2F8N H;  1MPL A;  1W5D A;  5JRG D;  4FH2 A;  4XUJ B;  3MNN D;  4G92 B;  5DTT A;  3W96 A;  5B2I B;  5AV5 B;  5AV6 C;  4DRB A;  4MBK A;  4Y7P A;  3C5A A;  5F99 C;  4WZ5 C;  4IJE A;  5CGX A;  2X02 A;  3IXG A;  5GSU A;  2WAE A;  1KX3 B;  5EVL A;  5GSU D;  3LY3 A;  3WX7 A;  3B6F C;  4WU8 D;  3UDX A;  3OPL A;  5AV8 C;  3AZE D;  5B1M A;  4UA9 A;  5EOE A;  3SS3 A;  1P3M D;  1JWV A;  4JF5 A;  4AWL C;  3I7J A;  3H0L C;  1ZLA C;  5AY8 D;  2PYO C;  4Z66 A;  1F66 C;  3WA9 B;  1YMS A;  2EX9 A;  4OPQ A;  3MGS B;  4OOL A;  3A6N A;  5E2H A;  3AGF A;  5GXQ D;  2ZD8 A;  3MXS A;  1ZLA D;  3C7U A;  2NQB C;  5B33 D;  3PTE A;  4KG2 A;  4KUD B;  2PYO B;  1YT4 A;  1P3K B;  3BYD A;  4Y0U A;  4H9P B;  3RXX A;  3NQU B;  1I5Q A;  2PU2 A;  2DNS A;  4JXW A;  3N7W A;  4PMA A;  2W8S A;  1P3G C;  4Z2M G;  1MWU A;  4H9P A;  1AOI B;  5FQQ A;  5AY8 C;  4OQG A;  4X56 A;  2CC1 A;  5AV6 B;  3X1U B;  3AZM A;  1P3I B;  3AGE A;  1NRF A;  2G2U A;  5CEB A;  1AOI A;  3WKJ C;  4S2L A;  5CER A;  4XZQ D;  3IWO A;  4G91 B;  5BS7 C;  4KZ7 A;  5BNX B;  3SH8 A;  4R4S A;  5GHX A;  4KUD D;  5AVB C;  3MKF A;  4Z5T C;  3B0D C;  3L27 A;  4KZ6 A;  2ZQ8 A;  3MGQ C;  4OPR A;  1K6S A;  5DF9 A;  1BH9 B;  1GCE A;  4KQQ A;  4X68 A;  1H8Y A;  3WTP B;  1KVM A;  3H0R C;  3ZG0 A;  4MBH A;  2ZQC A;  4Z5T D;  4R8P C;  4C75 A;  4HBT A;  1B67 A;  3C1C D;  3REL A;  3AZK D;  3CG5 A;  2FFF B;  1TVF A;  3Q81 A;  2QMI A;  1LHY A;  5HW3 A;  5AV9 B;  4OPY A;  3UDF A;  2JCH A;  4YM6 D;  4DXB A;  3EG5 B;  3REL B;  4NET A;  1M18 C;  5BNX A;  3AZN D;  4P0M A;  1BLS A;  4OQ0 A;  4Z9Q A;  3EQV A;  1XKZ A;  4EBP A;  3B6G B;  5CP6 C;  1PI5 A;  1M18 D;  2F8N K;  2ZQ7 A;  1BLP A;  3VH6 W;  3L25 A;  3REI B;  4JXG A;  3AN2 C;  4EUZ A;  1KU5 A;  4RA7 A;  3AZI C;  2Y2H A;  4JLF A;  4NE5 A;  5FAS A;  2P9V B;  4ZUX A;  1K54 C;  3X1U C;  1P3I C;  1YU0 A;  1M1A B;  4WM9 A;  4KZ9 A;  3ZVW A;  1O7E A;  1K55 A;  3ZVT A;  2BYM A;  4WU9 C;  4P85 A;  2Y2L A;  1M1A A;  2ARO B;  3N8R A;  4WBG A;  1HTA A;  3VH5 A;  3MVD D;  1M18 A;  4QY6 A;  3IXH A;  2X01 A;  3IH8 A;  4S2P A;  5B1M C;  5TR7 A;  1PZP A;  2ARO A;  4J8U C;  1ZC2 A;  1P3A B;  1M18 B;  3IF5 A;  5FAP A;  4MEZ A;  2Y59 A;  4RX2 A;  3REH C;  1CEG A;  1S32 D;  1P3O D;  1K57 C;  4NFT A;  3WKJ D;  4JF6 A;  4J8X A;  4OJL A;  3MBZ A;  4U0T A;  1P3O B;  4LV1 A;  3CZD A;  4CSR B;  5GLB A;  4DQY B;  3M6H A;  1KE0 A;  5CRF A;  5IHV A;  2NQB B;  1NYM A;  1P3A C;  3A3D A;  3AZG B;  2WKH A;  3NBL A;  3WS2 A;  5CPI C;  2WZZ A;  3DWZ A;  4KZB A;  5J8X A;  1XGJ A;  4CSR A;  1WE4 A;  2F8N G;  1EWZ A;  2BG1 A;  2XF3 A;  3UNW A;  3B6F B;  4DF6 A;  4EO5 C;  3WWX A;  2ARO D;  3C1B A;  4HBU A;  1H3O B;  5EVI B;  2Y2I A;  4J8V D;  1FR1 A;  3C4O A;  3IT9 A;  4G91 C;  4FSF A;  1FQG A;  3V50 A;  1HD8 A;  1ESI A;  2ARO C;  3TSG A;  5JRG C;  3NI9 A;  3AZM D;  3ITB A;  2CV5 C;  2J7V A;  4BQM A;  5B1L C;  1JWZ A;  2IO5 C;  5DNN B;  3AZN C;  4XZQ B;  1S6R A;  1NYY A;  3REI C;  1S0W A;  4UA7 A;  4X53 A;  3BRM A;  4H9N B;  4J8U A;  1KDS A;  3ISG A;  1AOI C;  3WKJ A;  5B1L D;  3GVB A;  5DNN A;  3B6G D;  3SOI A;  5AVB A;  1H3O A;  5CHM A;  3QNC A;  3V3S A;  3L26 A;  3P98 A;  3AZF B;  5B32 C;  3O62 A;  5DNM A;  1JVJ A;  4F94 A;  2HDS A;  1P3B B;  5DTK A;  3MGP C;  3S22 A;  3RXW A;  3X1U D;  1P3I D;  2C5W B;  3KWQ A;  1DJA A;  3OPH A;  3IF6 B;  3N8S A;  2Z2L B;  3QHY A;  4OJP A;  4WZ5 A;  2VGK A;  3G34 A;  3BFD A;  4YS3 B;  2EX8 A;  5B2J B;  3A3E A;  3KWQ B;  4WEJ A;  2HUE C;  3REI A;  4J8U B;  4ZBJ B;  4NZ1 A;  4GN2 A;  4WNN B;  3UTA D;  3LY4 A;  4E3N A;  1P3M A;  5AVB B;  1GHP A;  5JYP A;  3REH B;  4HEF A;  2RL3 A;  4JXV A;  3BFG A;  2PYO D;  5DVA A;  4BLM A;  4PM8 A;  1MWR A;  1R4V A;  1ULY A;  2RVQ D;  3WTP C;  4D2O A;  3REK C;  3AZI A;  1P3B A;  3ZFZ A;  4LG2 A;  2H0Y A;  3ZG7 B;  3AZH D;  1KGG A;  1P3M B;  1HQ3 C;  5FDH A;  3IF6 A;  3AZE C;  1MY8 A;  3AZJ D;  2G2W A;  4OQH A;  4JXS A;  3NC8 A;  3REJ A;  2WUQ A;  1E4D A;  1CK3 A;  3FWL A;  3MGP A;  2XH9 A;  3PAE A;  3TU4 C;  2ZY2 A;  3GSG A;  1P3G A;  4P6B A;  3AV1 A;  4HGA B;  1M19 D;  4OJ6 A;  5A90 A;  5B0Z D;  3AZE B;  2NZD A;  3VOZ A;  3AZK C;  4JKT A;  4WMC A;  3REK A;  2Y2J A;  2FJ7 D;  1ZG6 A;  2QPN A;  3X1V C;  5JRG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...