2Y2MA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e08)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
489
structure length
471
Chain Sequence
b'ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 163
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2mA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2mA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2mA02
3UPPA 3EQVA 5EOEA 4KZ4A 3ZNTA 3C4OA 1IEMA 2OSUA 4WYYA 2Y2NA 1EROA 5EVIB 5CERA 2IWCA 1W5DA 1NYMA 4E3NA 3VFHA 5A92A 2J8YA 4JPMA 3N4IA 1XX2A 3BFGA 4ID4A 1NYYA 4S2IA 4H8RA 3HLWA 2Y2QA 2WK0A 4A5RA 1ALQA 4JF5A 5GHXA 4B4ZA 3O86A 4P87A 2FFFB 1JVJA 4MEZA 3M2KA 4DF6A 1S0WA 4EV4A 1L0EA 3FWLA 4X6TA 3V39A 2J7VA 3HLGA 2EXAA 2OLVA 4PPRA 2DNSA 4XUXA 5CEBA 1IYPA 3DWZA 1XPBA 4ZTKA 1VQQA 4FD8A 4Y0OA 1BLPA 3A3JA 4WZ5C 1BLHA 5HAIA 1WYBA 4OQHA 4BQMA 1K4FA 3MXRA 1XP4A 3OZHA 1KGFA 3SS4A 5CGXA 1GA9A 2Y2GA 3GR2A 1JTGA 3HBRA 3UDFA 3W8KA 4EUZA 3D4FA 1K55C 5DTKA 1K38A 3VP0A 4OQ0A 4ZJ2A 2EFXA 1ONGA 2WGWB 4GZBA 5HARA 2XLNA 4OOYA 3A3EA 1LHYA 3ITAA 4OPYA 3VFFA 4E3LA 4KQOA 5CXWA 4OOMA 4LV0A 2ZQAA 2EX8A 4U0TA 3FYZA 4PM9A 3OPHA 4FSFA 1PW8A 1NRFA 3P98A 5U47A 1K57A 4R4RA 3BFCA 1IKGA 2J9PA 2V2FF 2X02A 4OQIA 4R0QA 2UWXA 1KE0A 1CI8A 3ZG9B 5AQAA 2BG1A 3UDIA 4KZ7A 3CG5A 3JYIA 1FCMA 1TVFA 1TEMA 1ZC2A 3SS3A 4L0LA 3IXBA 1BLSA 3BM6A 3Q82A 3PBQA 3M2JA 3PBNA 3UY6A 2IWDA 1FQGA 1Z6FA 3ZG7B 3GQZA 3IF6C 4KQQA 5E43A 2HP5A 4GDNA 3V5MA 4D2OA 3AGFA 3N7WA 4GNUA 4OKPA 3OC2A 4KZ6A 3I7JA 5FSRA 3PBSA 5KSCA 1L0GA 1YLPA 3Q7ZA 4LV2A 5L2FA 2ZC3B 4QU3A 1KDSA 3OPPA 4OONA 5CTMA 5GHYA 3VP4A 5CEDA 1ES3A 3Q07A 4YFMA 1PI4A 4FCFA 5HFOA 1WE4A 2ZMAA 5CGSA 2ZC5B 3MKFA 3OCNA 2Y55A 3UPOA 2VGJA 1K4EA 4KZAA 2A49A 4KZ5A 4KG6A 4R3BA 3QNBA 4Q8IA 2ZM0A 5FQKA 3GV9A 4BL2A 4E3OA 1KE4A 1YLYA 1NZUA 2JE5A 4R3JA 3HLDA 5FAOA 2DRWA 3BRMA 1ERMA 3FKWA 3AGEA 4LENA 4M3KA 4QHCA 4BD1A 5HAPA 1MXOA 3ISGA 5F1FA 4FH2A 5FA7A 5E2FA 4IBXA 4U3TA 3IH9A 3OPRA 3IF6A 2X71A 4OP8A 1GA0A 3IF5A 4KZ9A 4N1HA 1K54A 4GD6A 1CEGA 1FSWA 4WELA 4ZJ3A 4CJNA 2Y2KA 1QMEA 3G30A 1SCWA 3S4XA 2V20A 4JXVA 3PAEA 5F1GA 4K91A 2OV5A 3G4PA 1M40A 1K6SA 1XXMA 4P0MA 4R23A 4X55A 2WGIA 3N8SA 1RGZA 4S2OA 5GLAA 2XD5A 1BLCA 5I94A 2HPBA 4HESA 2J9OA 1E25A 2WKEA 2EX6A 1TDLA 3FV7A 5FQMA 4EBNA 5DTTA 1ESIA 4OPQA 4UA6A 4S2NC 1IYOA 2GDNA 4MBHA 3IWQA 4DXBA 4E3JA 1KVMA 4S2JA 1MWRA 5A90A 4OPZA 3ZG8B 4B88A 4O7DA 5HW3A 1SDNA 5JYPA 5FI7A 2A3UA 3A3FA 3GSGA 3WWXA 4IEDA 2XQZA 1PIOA 3RXWA 5FAPA 4DXCA 2Y2IA 3DWKA 3ZG5A 2WZXA 3MZDA 3HUNA 3OCLA 1MBLA 1W7FA 4OH0A 1JTDA 3BLSA 3MZEA 5BOHA 1K25A 5GLCA 1ESUA 3UNWA 1AXBA 4LV1A 4NK3A 2HDUA 3OPLA 3IWOA 3B3XA 3RJUA 3ZDJA 4BD0A 2ZLYA 2Z2LB 1FSYA 3VSLA 4BENA 4JLFA 1PWGA 4S2LA 3IF6B 3V50A 1H8YA 1I2SA 2PU4A 3WS4A 3BYDA 2EXBA 3WS5A 3VOYA 1MKIA 3A3IA 4OPRA 3G2YA 1E4DA 2ZQ8A 2R9XA 4OOLA 5FDHA 5F83A 5GL9A 4JKTA 1IYQA 1XKZA 1GCEA 1H5XA 1PZOA 3MXSA 2B5RA 2QPNA 2ZQCA 5HL1A 4QD4A 4WEJA 1ZG6A 3G2ZA 3ZHHA 2XEPA 1O7EA 4JBFA 2HDQA 1DJCA 4EBLA 3GTCA 3HUMA 2JCHA 3UN7A 2ZC7A 4IVIA 1FOFA 2WADA 4JF6A 5E2HA 2IWBA 4DE0A 5CTNA 1FCNA 1W8YA 1LL9A 2EX9A 1JWZA 4KZ8A 4R4SA 4N9LA 3W4QA 5AQ9A 1XGJA 5FQ9A 3LO7A 1M6KA 1XA7A 3HLFA 5EECA 2Q9NA 5DF8A 3ZGAB 1FR1A 4WZ5A 4C3QA 1LLBA 3LY4A 3IWIA 3VOZA 3FZCA 4NETA 5EVIC 4WZ4A 2H0YA 4K0WA 4DKIA 1ES5A 3P09A 1G68A 1YLJA 1K55A 5J8XA 4YINA 2H10A 2R9WA 1N4OA 3NDGA 3PAGA 3NIAA 2XK1A 4OLDA 1NZOA 4FH4A 5DF7A 3ITBA 3MFDA 4HBUA 4OVDA 5TR7A 2OLUA 2WGVA 4XUZA 4PM5A 1NJ4A 1PI5A 3DTMA 3O88A 1HTZA 3GRJA 5DF9A 5KSHA 1YLWA 2WAEA 2EFUA 4BL3A 3E2LA 3HL9A 2WYXA 1GHPA 2ZJ9A 4EQIA 2HP6A 3HREA 2RCXA 4E6WA 4MBKA 1OMEA 2Y2MA 2C6WB 1W79A 3ZCZA 1L2SA 1PW1A 4LV3A 5CHMA 1KE3A 3IHBA 3PBRA 3DW0A 2Y59A 1YLTA 3TSGA 4F94A 5AQBA 4K0XA 4UHUA 5TFQA 1VM1A 4RX2A 4DE1A 3TOIA 4E6XA 4KZBA 4Y0TA 3IT9A 4PM8A 2XDMA 2XF3A 4KZ3A 4CPKA 1MWUA 1YMXA 4LCLA 3MBZA 3WS0A 3BFDA 4PMAA 4QJGA 4KG5A 4PM7A 1S6RA 3VP3A 4BLMA 2WAFA 3HLBA 4S2KA 3Q1FA 1EWZA 2JC7A 2ZQDA 3LEZA 4QY6A 5CHUA 3G31A 2Y2PA 4RA7A 2Y2HA 2QMIA 3C7VA 3N8RA 4WEKA 3SS5A 4JF4A 1FR6A 1KGGA 1DJBA 5DVAA 4C6YA 3PTEA 3G35A 2ZM8A 2I72A 4UA9A 3SH8A 2P74A 3CZDA 3Q7VA 4QY5A 1CK3A 5CHJA 5EUAA 2Y2JA 3VSKA 2P9VB 1ERQA 2E8IA 3E2KA 5EVLA 1YLZA 3NDEA 3NI9A 3UPNA 4E3KA 1ES2A 2XFTA 4DRTA 4EBPA 5FI6A 1LI9A 3NY4A 4N1XA 2G2WA 1K56A 1DJAA 1G6AA 2ZC6B 1CEFA 3N8LA 2XFSA 4IVKA 2XR0A 1JWVA 3GMWA 1KGEA 2ZD8A 4U0XA 1EI5A 5G18A 4UA7A 2HDRA 3S22A 2HP9A 4KENB 3UO9A 1CI9A 3WS2A 1Y54A 4KG2A 1BUEA 1K6RA 3HVFA 3IH8A 2BLSA 5KZHA 2G2UA 4DDSA 2XGNA 1I5QA 1MPLA 1ZKJA 1C3BA 5A93A 5FQQA 3BFEA 1WYCA 2QZ6A 4S2PA 5KMWA 4ZAMA 4KQRA 4DE2A 1O07A 4P6BA 1W8QA 1L0DA 1LI0A 1YQSA 2EX2A 1QMFA 1KDWA 1RGYA 4WM9A 1HVBA 4X53A 1IYSA 4IBRA 3VP2A 1K57C 3BEBA 4JXWA 3CMZA 4S2NA 3CJMA 4B4XA 3IXHA 4MNRA 4UAAA 4HBTA 3SH9A 1IELA 3PBTA 4N92A 3QNCA 5FQJA 3C5AA 5HAQA 1PZPA 1E3UD 1KVLA 3LCEA 3BLMA 3TG9A 3FKVA 1IKIA 5CECA 3WRTA 1L0FA 1ONHA 3Q7VB 1Q2PA 5EVID 3V3RA 2RL3A 4GD8A 4RX3A 2Z2MB 5FI2A 1BSGA 3N6IA 2H0TA 3IXDA 4OQGA 3O87A 2H5SA 1DY6A 3S1YA 4ZDXA 1U60A 5E2GA 4DDYA 1BTLA 4MLLA 4P85A 3BFFA 2ZQ9A 2DCFA 3C4PA 5F82A 5FQIA 1NXYA 2JBFA 5GHZA 4C75A 5FASA 2C5WB 3WRZA 4XXRA 2VGKA 1GHMA 2HDSA 4WMCA 1HZOA 3ZVWA 1LL5A 3QHYA 4BJPA 2CC1A 4GN2A 1NY0A 3O3VA 1J9MA 4Z9QA 2XD1A 4HEFA 3C7UA 1BT5A 1I2WA 2P9VA 1MWTA 4QB8A 3V3SA 3SOIA 5M19A 1K56D 2ZM2A 5AQ7A 3HUOA 3ZNYA 5M1AA 3BECA 2V1ZA 5D3OA 5DTSA 1GHIA 3UDXA 3RXXA 5JYOA 1YT4A 3HLEA 2Y91A 4LCMA 3VMAA 1TDGA 1K54C 3LY3A 4R1GA 1SHVA 5HX9A 1JWPA 1MWSA 1ZG4A 4X68A 2XH9A 5M18A 1MY8A 1YMSA 4GOGA 5GLDA 4EWFA 3IXGA 5TGFA 4ZBEA 1E3UA 3IHAA 4WBGA 2Q9MA 1BZAA 2WUQA 1SKFA 3ZVTA 3UE3A 4JXSA 5EVIA 3PBOA 2WKIA 3GVBA 4E3MA 4N9KA 2WKHA 3Q81A 5IHVA 1FCOA 1XA1A 4DE3A 5EOOA 3IQAA 5GLBA 3VP1A 4OLGA 5CGWA 2FFYA 1HD8A 3EQUA 1RP5A 3NBLA 3MKEA 5EPHA 4X56A 5EE8A 3UE0A 4RVAA 4Y7PA 4S2MA 5FAQA 1N9BA 2PU2A 4JXGA 2Y4AA 1BULA 3G32A 1PWCA 5FATA 4GDBA 1SDEA 4MBFA 3SH7A 4RYEA 3A3DA 3HLCA 1ES4A 4Y0UA 4ZJ1A 3ZFZA 3W4OA 3ZG0A 1XGIA 2Y2LA 1YM1A 4PM6A 3WS1A 1PYYA 1PWDA 1RCJA 1H8ZA 5CRFA 4OP5A 2WGWA 4WMCD 3M6BA 3W4PA 2ZC4B 1Q2QA 2Y2OA 3AGDA 3G34A 3MZFA 4GKUA 2PBYA 5E2EA 2WZZA 3NCKA 3UE1A 3M6HA 2ZQ7A 3NC8A 4GB7A 4E3IA 5A91A 2X01A 4X69A
chains in the Genus database with same CATH superfamily
2PD7A 3HCYA 1YSQA 4DMZA 4G3VA 4NZ5A 1KX4A 5G49A 5EVIB 1W5DA 4IBIA 3WTPE 2J8YA 5I5LA 5B2IB 3IBRA 1P3AA 2NZDA 4YOFA 2Y2QA 4A5RA 1EAKA 3LIBA 5B1LB 3WAAA 1BYWA 3AZJB 3F1OB 1E15A 4GJ4A 3MF0A 3L29A 3FWLA 2EXAA 2DNSA 1IYPA 3DWZA 1XPBA 3X1VC 4FD8A 1BLPA 2CV5B 2ZOIA 3H82A 3QP5A 5DNMA 3SS4A 5CGXA 1GA9A 4EUZA 4Y17A 1KX5C 1KX3D 1AOIA 4J8UB 4ZJ2A 2EFXA 2V5OA 2WGWB 4NYUA 2LB5A 3ITAA 4OPYA 3VFFA 2F2AC 4OOMA 4LV0A 3MSHA 4OJ5A 4PM9A 3AZHA 1PW8A 2V0UA 3P98A 5U47A 1P3KB 1K57A 4AFIA 1P0ZA 3DTKA 5JRGB 2V2FF 3DTEA 3KX0X 5FDSA 1KE0A 1M1AC 2V8CA 4LLOB 1S1ZA 3P01A 3UDIA 2NQBD 3JYIA 1FCMA 3TW8A 5FEFA 3WTPC 5B31G 2PYPA 5B31B 3SS3A 3PBNA 2IWDA 5BS7C 1FQGA 1Z6FA 4O8GA 3E4PA 4I3JA 4QLCD 2O9CA 2E8JA 4YM6D 1S4SA 3I7JA 2MJ6A 1EQZC 3F1PB 5KSCA 1F1EA 2RTSA 5EVEA 1YLPA 2ZC3B 2OWJA 4CSRA 1GPFA 5CTMA 1F5MA 3MGRD 5GT0C 3W97D 5FL3A 2RIQA 1KX3A 2ZMFA 3F1NB 3KUYD 4LD9D 1P34D 4E3OA 1NZUA 4R3JA 3REJC 3HLDA 1ID3A 2DRWA 3BRMA 4LENA 4M3KA 4QHCA 3QP1A 4EUVA 3ISGA 4FH2A 2B02A 3IF6A 3IF5A 4KZ9A 4ZJ3A 5CPID 1QMEA 3S4XA 3HONA 3AV2B 2Q0OA 2V20A 1WWSA 2OV5A 1S32B 2NQBA 2W3DA 2W3GA 3N8SA 3C1BC 2HPBA 4H9QA 2J9OA 4MN6A 1E25A 3A6NC 2V1AA 4EBNA 3O62D 2GZAA 3AZMD 4QLCA 2GDNA 3IWQA 4WU9D 1KVMA 4S2JA 3UTBD 5AV6A 4YM6A 2V0WA 4O7DA 3ZG8B 4B88A 5HW3A 4WU8D 5FI7A 1GSWA 1M19C 2O9AA 1ODVA 3MJQA 4ARZA 3L26A 4WV4B 4KUOA 4QPRA 1A7WA 2WZXA 2F8NG 3KFUG 3MGRA 3REHC 1MBLA 4OH0A 4J8VB 2P04A 1ESUA 1P3OD 5B0ZD 3BQAA 1AXBA 4CLCA 2AVXA 2YFVB 3WD0A 4ZUXC 4LD9A 2A24B 1P34A 1W63Q 1YPRA 3KSFA 3B3XA 4BD0A 2Z2LB 3WD1A 4KGCC 3FC7A 4BWIA 4H9NB 3LEQA 3W99C 3WS4A 1MC0A 3UTAC 5AVBC 4E44A 1MKIA 3VOYA 2YKFA 4DQYB 2ZQ8A 2QYBA 5AV5B 3MVDD 5CPIA 1KU5A 1NRJA 4EU0A 4RQ9A 1G5UA 1GCEA 2YFWB 1QO6A 3MXSA 1E88A 5B40B 4HMDA 4QD4A 4WEJA 5B2JC 1ZG6A 3T1RA 3MQQA 4JBFA 5CP6D 3O62A 5LBRA 4H9OB 1MKMA 1FOFA 4WU9A 1W8YA 3UTBA 4N9LA 2EA9A 4WU8A 3E0YA 3LO7A 1XA7A 3HLFA 5EECA 2Q9NA 3TU4B 1LLBA 3LY4A 3FZCA 4GH9A 1F66D 2PYOD 3R45A 3W96A 1V9YA 1K55A 3C2WA 3TRCA 5B0ZA 4Q0IA 1NZOA 5DF7A 1W1PA 2EWVA 3MFDA 4HBUA 2J8PA 4OVDA 2INWA 1P3GB 4XUZA 1ZLAD 2QKPA 4NFTA 3O88A 1HTZA 4H9PB 4BL3A 3ULFA 4PHTA 3N3FA 4JGOA 4Z2IA 4EQIA 2HP6A 2QJ7A 2RCXA 4E6WA 3AZLB 1W79A 4OUIA 1L2SA 1PW1A 3LJAC 3RH8B 1U35D 5GT3C 4G3KA 4KUDB 1L6JA 4UHUA 2PHYA 4Z5TD 3IT9A 2XDMA 2XF3A 2L4RA 3LI9A 4LCLA 4CAYB 4YS3D 5B32D 4KG5A 2B18A 4WNNB 1CF0A 2WAFA 4S2KA 4HMEA 3BY8A 5AV8B 2FJ7D 5CHUA 1TZYB 1GOIA 1KX4C 2QMIA 5J3WA 3EOIA 3REID 2I72A 4L9EA 2PYOA 2NZDC 3Q7VA 4QY5A 4HI4A 5EUAA 3RTYA 2P9VB 1ERQA 3E2KA 5EVLA 3UPNA 3WAAC 2XFTA 4DRTA 3CPTA 4EBPA 1LI9A 1T1BA 2G2WA 3X1VD 1K56A 1OJGA 3T1QB 1G6AA 2ZC6B 3N8LA 2HF6A 4IVKA 5DNMC 3MNND 3GMWA 3B0DC 1E6RA 4PAUA 2HDRA 3REKB 1AOIC 3NQJB 3IH8A 5KZHA 3EPJA 5A93A 1ZKJA 1U35A 3LIEA 3BFEA 5KMWA 4KQRA 1PFLA 5DKLA 4MB4A 4P6BA 4Z5TA 5B0YB 1L0DA 1QMFA 2EX2A 4X53A 3AZHC 1RGYA 1IYSA 4IBRA 1K57C 3KWQD 1KOUA 3CMZA 2VLGA 4YS3A 5B32A 3IXHA 4HBTA 1T18A 2HIOB 1IELA 3C5AA 2FJ7A 1PZPA 4HJ6A 1HTAA 2PBDP 3BLMA 3VE4A 1L0FA 3REIA 4I39A 3LZ1D 2DF4C 2RL3A 5EVID 3WKJA 2K2NA 4R3AA 3S1YA 2F8NK 2EWWA 4R38A 4MLLA 1Y28A 1SZVA 5KDMB 3CI6A 5B1LD 4P85A 3C4PA 3AZJD 3GECA 4Y5FA 2JBFA 2VGKA 4Z1WA 4GHLA 1GHMA 5HSQA 1LL5A 3BWLA 3QHYA 3MNNA 3EPHA 4XT2B 5GT0D 4JJNA 2CV5D 1NY0A 3O3VA 3UMDA 4H9SA 1TS7A 4HEFA 1KX3C 3CLOA 1OT9A 1I2WA 3V3SA 4CLCE 1VEUB 5F68A 5M19A 1H0IA 4J8UD 1ID3C 3ZNYA 3FPWA 4TX8A 3BECA 1GHIA 3UDXA 4D60A 3HLEA 1P3IA 5C3IB 4LCMA 2FH5A 3KWQA 4HHDA 2AROB 4IJGA 1B67A 1MWSA 3S7QA 4X68A 1H0GA 1MY8A 1YMSA 5AVFA 4ZBEA 2NQBC 2Q9MA 4UPKA 4BMWA 1JFIB 4NYYA 1P3LB 3A6ND 5EVIA 1VB6A 3AZID 5B31D 2WKIA 3GVBA 5B2IA 2WKHA 4G92C 3AYWB 4QLCC 4XUJD 4X23B 3AN2B 5AV6C 4YM6C 5B1LA 5CGWA 2FFYA 3AZJA 3C1CB 4IBCA 1X0OA 5FAQA 2PU2A 5AY8B 3G32A 3DTIA 3MGRC 1F2KA 2CV5A 2W1TB 1TS6A 3B33A 4O0PA 4RYEA 3W97C 4Z2HA 3HLCA 1ES4A 4ZJ1A 4J8WB 4Z2LA 3W4OA 3ZG0A 4CLCC 4WUJA 3T4QA 3KUYC 4LD9C 2JKFA 4J8UA 3WD4A 1PYYA 2JHEA 1RCJA 3X1SB 1P34C 1DP9A 5CRFA 2WGWA 4WMCD 3A0RA 5HDDA 3JPUA 3W99D 1Q2QA 2D49A 3AGDA 3NOTC 5AVBD 4HJ3A 2ZQ7A 4E3IA 3X1UB 4XZQB 5HZHA 3S7PA 5CPIC 1P3KA 4X69A 3UPPA 3EQVA 4YWZA 1J7MA 3ZNTA 4KZ4A 5CERA 4E3NA 1YU0A 1OTIA 1OTBA 3N4IA 4ID4A 1NYYA 3AZIA 5B31A 3HLWA 4Y13A 3O62C 3AZMC 2OWHA 1ALQA 4WL9A 4MEZA 4WU9C 1OTEA 1S0WA 3H0MC 2D01A 1DP6A 3UTBC 1W1YA 3DBAA 2ZY5A 1YU2A 4WU8C 4ZTKA 3FG8A 2UV0E 3F1PA 5HAIA 1WYBA 4QNLA 4OQHA 3KS8A 2G7UA 2Y2GA 3W96C 3UDFA 4HP9A 3UB7A 3W8KA 1K55C 2F8ND 5B0ZC 4J8VD 1ONGA 5HARA 2XLNA 1D06A 4OOYA 3A3EA 2JKGA 3F1NA 5B24B 2BASA 3AZNB 3IP4C 2EX8A 3LELD 1PRQA 2GX5A 3FYZA 1UR8A 1NRFA 3BFCA 1IKGA 1G6OA 2X02A 3MVDC 1P3MD 3LJAD 1CI8A 3ZG9B 3V67A 5AV5D 4KZ7A 2G5HC 3CG5A 3AV2A 1TVFA 5B33B 5FUGB 1M18B 4NZ3A 5B32G 3Q82A 4ETZA 4IJFA 3ZG7B 5CP6C 5E43A 2M1CA 3CUEA 2HP5A 4GDNA 2J3TC 3AGFA 3N7WA 4OKPA 1KS0A 5FSRA 1EW0A 1KX4D 2M7VA 1L0GA 3UB8A 2GNXA 4YNRA 1P3AD 1F66C 3TU4D 2PYOC 4FCFA 5G4YA 5HFOA 1ZHHB 1V9ZA 2QHKA 2ZC5B 2F8NA 1YKDA 4J8VA 2A49A 3U4LP 4BL2A 1KE4A 1YLYA 2JE5A 5FAOA 2YFVA 3FKWA 5JA4B 4BD1A 3LELA 1P3GD 5F1FA 4IBXA 4H9NA 4LRXC 1GA0A 4N1HA 2RVQC 1K54A 4GD6A 4CJNA 2Y2KA 3G30A 1NLZA 3QP8A 1P3MA 4JXVA 3NECA 3PAEA 5F1GA 1U35C 5AV5A 3AZLD 1CJFA 4P0MA 4X55A 3H9WA 2WGIA 3H0LC 5GLAA 5I94A 2YFWA 5HD3A 4KUDD 3R7WB 4Z5TC 3HJIA 3AZHD 1TDLA 3NOPC 3R4KA 5B40A 5FQMA 5CPKB 4MBHA 4DXBA 4YS3C 5B32C 4E3JA 3W98B 5A90A 4OPZA 4H9OA 4IJEA 2V1BA 3LIDA 1T1CA 5JYPA 2FJ7C 4EO5B 2JSSA 3MGPB 3A3FA 3WWXA 3RXWA 3TE8A 2Y2IA 3REIC 3HUNA 1ULYA 4KHAB 3TU4A 3D3OA 2VV8A 3BLSA 4EETB 1K25A 5GLCA 3UNWA 4LV1A 3IWOA 1FSYA 1PWGA 4KQDA 3LFVA 3NHQA 1P3GA 2PU4A 3MNNC 2QWSA 3OOVA 3BYDA 2EXBA 4JJNC 3WS5A 3A3IA 3LZ0B 4OPRA 4KUKA 4H9SC 4H9PA 1JNUA 2R9XA 5GL9A 4JKTA 4EEPA 5TJJA 4CQHA 3AZLA 1E8BA 1ID3D 3LUQA 3AZEB 2QPNA 2ZM5A 4KUDA 4OJPA 3ZHHA 2HDQA 3UT9B 4EBLA 2JCHA 1P3IC 3KWQC 2ZC7A 5B0YD 4GS9B 3VH6T 3REJB 4CAYA 1XGJA 3C30A 5AQ9A 5HDSA 4WNNA 1M6KA 2DQNC 4WLAA 5AV8A 4WZ5A 4C3QA 1TZYA 3VOZA 5AVEA 2OAP1 3E98A 3LZ1C 5EVIC 4WZ4A 2H0YA 4K0WA 3UB6A 5B2IC 3P09A 2O0YA 5J8XA 2R9WA 4LFUA 5AV6D 2V8FA 4BBVA 5B1LC 3ITBA 3AZJC 2HUEB 4ZBJB 3KS4A 3WD2A 1NJ4A 3DTMA 1OTAA 5DF9A 2PR5A 1J3WA 1O6IA 2CV5C 2JN7A 1GHPA 5HPIA 2FN2A 2VEAA 1STZA 4CLCD 3REKA 1PNEA 3ZCZA 4LV3A 3AZKB 3NQJA 4I5SA 3VOLA 3DW0A 4J8UC 1YLTA 2GJ3A 5MC7A 1TD5A 4DN0A 4L9FA 4K0XA 3REHB 3TOIA 3KXBB 1P3PB 4KZBA 1Z2CB 3AZGB 3JVUA 4KZ3A 1YMXA 4F3LA 3WS0A 5B0YA 3L28A 3VH5T 4QJGA 4PM7A 4OJOA 2IA2A 3VP3A 3B42A 3HLBA 5BNXA 2AROD 2ZQDA 4KGCB 4EXOA 2Y2PA 2HIOA 3N8RA 4WEKA 3SS5A 4JF4A 1FR6A 1KGGA 5DVAA 3UTAB 3KO6A 4UEYA 3OLOA 4LRZE 3AZIC 4UA9A 5B31C 2P74A 3CZDA 4Q0JA 2Y2JA 1YLZA 2V9AA 1Y4OA 4EW7A 4XUJC 3AYWD 5FI6A 2QJ5A 4X23D 5KDMA 3AN2D 3PXPA 1EI5A 3W96D 4UA7A 3K3DA 5AY8D 1Y54A 1BUEA 1K6RA 4XT2A 3HVFA 4LGWA 3BQ8A 2NUTC 2XGNA 1MPLA 4PKYA 4J8WD 1F9IA 2BTFP 1VEUA 3X1SD 3X1TB 5A8BA 3RFBA 3S7OA 1LI0A 4DKIA 1KDWA 4WM9A 4JXWA 4S2NA 3CJMA 4B4XA 4MNRA 3B0CT 3X1UD 3PBTA 2AROA 3QNCA 4Z2GA 1E3UD 1KVLA 3AV2C 1IKIA 3IBJA 5CECA 4B9OA 4RX3A 3UB9A 2Z2MB 5FI2A 1BSGA 2HGVA 1P3LA 2H0TA 3IXDA 4OQGA 2H5SA 1DY6A 2J3TD 2P08A 4ZDXA 5E2GA 4DDYA 3AV1B 1BTLA 4R8PB 3V9RB 3AYWA 2ZOHA 2DCFA 5FQIA 5GHZA 4C75A 4X23A 3AN2A 1LSWA 3D9YA 3A1KA 3C1CA 2HV1A 4E04A 2K7SA 2CC1A 3NQUB 4HY8A 2HJ9C 1J9MA 4Q0HA 5AY8A 5CPJB 5AV9B 2W1TA 3C7UA 1BT5A 4QB8A 4J8VC 3SOIA 1K56D 4J8WA 5AQ7A 2W1RA 5M1AA 3X1SA 3LELC 5D3OA 3WAAB 3AZND 1P9WA 2Y91A 3E4QA 2RVQD 1IFQA 2J3WA 3L2AA 1K54C 5HX9A 2NUPC 3AFAB 1SHVA 5TBMB 1P3MC 3X1UA 2XH9A 4XZQA 4GOGA 5AV5C 4X1LA 1E3UA 5TGFA 2ZY3A 2WUQA 1SKFA 3ZVTA 5F69A 3UE3A 1W1TA 5B33D 1M18D 3L9KA 3FPVA 2LB9A 3IQAA 3H7WB 5GLBA 3IX8A 5DJTA 2B95A 4NE5A 4X56A 2LY8A 5B1MB 3C38A 3ZYTA 1N9BA 1YAXA 3WKJD 4JXGA 1P3AC 5FATA 3TU4C 3AZFB 3A3DA 2Z6CA 4Y0UA 1ACFA 2FZ0A 4ME4A 1LT0A 1YM1A 5HD5A 1PWDA 3M6BA 3W4PA 2Y2OA 5B24A 1P3GC 4JJND 3MZFA 5E2EA 4G91B 4GLQA 3NC8A 3AZNA 4GB7A 3G6OA 2X01A 5E5AB 5K5BA 3CHWP 5KIZA 3C4OA 1S66L 3AZLC 2OSUA 1ED7A 4WYYA 1EROA 3PR6A 2IWCA 1NYMA 3MGQB 3LR4A 5A92A 4JPMA 4AWLC 5L07A 5B33A 4WF0A 4S2IA 4KUDC 5FUGA 2ZMVA 4H8RA 1P3ID 1M18A 2WK0A 4B4ZA 3O86A 5BO0B 4P87A 4DF6A 4E45A 2H28A 5CEBA 2J7VA 3HLGA 4PPRA 2OLVA 4IUKA 1HQ3D 3W98D 1VQQA 3EGDC 4WZ5C 1BLHA 5GSUB 1K4FA 1XP4A 1N9NA 5B2ID 2PAVP 5EV0A 1JTGA 4NEED 1OTDA 2NQBB 4GZBA 1P3FB 1IOUA 4E3LA 4Z2JA 3FKEA 3KYEA 4PKYG 5JA4A 4J8XB 4Z2MG 4OQIA 2BYKB 4P6ZS 4HH2A 3LZ0D 5HWWA 3VE3A 3QP2A 4ARZB 4NE6A 2BG1A 1ZC2A 4L0LA 3IXBA 3W97B 3BM6A 3UY6A 3PBQA 3M2JA 3IF6C 3L7HA 3PHYA 4KQQA 5EM1A 3R7WA 5B0YC 3KUYB 2BYMB 3UT9D 1P3KD 5JRGD 5CPKA 3OC2A 4KZ6A 3PBSA 1HQ3A 3W98A 2HIOC 3DAVA 4LV2A 5L2FA 1P3BB 4QU3A 3OPPA 3MGPA 4OONA 5DNNB 1FILA 5GHYA 3VP4A 5CEDA 3Q07A 1R4VA 4KHAA 5F99B 2ZBBA 3MR0A 2VGJA 1K4EA 4KZAA 4KZ5A 3F1OA 4KG6A 3QNBA 4R3BA 3L27A 2M7UA 1OPXA 3T4TA 1ERMA 3SW1A 3S7NA 1MXOA 3AZMB 5FA7A 4U3TA 4HNBA 3OPRA 2X71A 4JGRA 1CEGA 1SCWA 2KX6A 4R6LA 3LZ0A 2ACGA 4Z66B 3LR3A 3T12B 3MS6A 1M40A 1K6SA 1XXMA 4R23A 3AZKD 3IS2B 2A2LA 4S2OA 2XD5A 2W8SA 1BLCA 3AZEA 2WKEA 1VETB 4HIAA 5DTTA 4OPQA 1P3OB 4UA6A 3KXBD 4S2NC 4IBJA 3UT9A 4MB3A 3B6FB 1H3QA 1MWRA 5JRGA 2VQRA 4WN5A 1SDNA 2AROC 4GS9A 3AV2D 2A3UA 3GSGA 3EPLA 2K31A 4IEDA 1S32D 1N9OA 5FAPA 3DWKA 3KSHA 3MZDA 2XA7S 2OOLA 1W7FA 1XFQA 3B47A 3OBFA 3MVDB 2VGLS 3MZEA 5BOHA 3EPKA 3AYWC 4NK3A 3OPLA 4EERA 1P97A 3B6GB 4X23C 3AN2C 4S2LA 5CP6B 3V50A 1BH9B 1H8YA 1I2SA 4NXGA 2PR6A 5AVCB 3G2YA 5AY8C 1E4DA 3RELB 4OOLA 3H0RC 3L25A 3C8CA 3MGSB 4J8WC 1YU4A 1S4RA 3M7PA 3AZKA 2B5RA 1F66B 3WX7A 3X1SC 2O9BA 3G2ZA 3A1IA 2XEPA 3REHA 4Y2FA 1F98A 1SKOB 3KXBA 1P3PA 2WADA 5GXQB 2IWBA 3AZGA 5CTNA 4DE0A 1FCNA 1LL9A 2EX9A 4R4SA 4HGAB 3X1UC 1XJ6A 4XZQC 5FQ9A 1ZLAB 3ICYA 5DF8A 1S32A 3ZGAB 3GDIA 1FR1A 4KGCA 1YUEA 3VH5A 3QP4A 3D72A 2IO5C 5HPFA 5B40D 1DRMA 3LI8A 1G68A 1YLJA 3TJZC 4YINA 2H10A 1N4OA 3NDGA 3PAGA 2XK1A 4OLDA 4FH4A 1S1YA 2ZL1B 1NLYA 1YU1A 4HJ4A 2WGVA 4PM5A 1PI5A 3GRJA 3WA9B 1YLWA 2WAEA 2VX8A 4LRYC 1TAFB 2G5IC 1UGUA 2HJEA 3E4OA 2C6WB 5L10A 5CPJD 5AV9D 3PBRA 3TSGA 5AQBA 2A24A 5DFXA 5F5YA 5TFQA 4UQIS 5BPVA 3FDDA 3AZNC 1MWUA 3X1TA 3MBZA 2L1MA 1S6RA 2Y79A 4BLMA 3X1VB 3Q1FA 1EWZA 4FUWA 3AFAD 4QY6A 3C7VA 3MMHA 3MNNB 1DJBA 1KX5B 5B33C 4OJ6A 4K08A 3SH8A 1M18C 1CK3A 5CHJA 4DXCA 3WD3A 2E8IA 4E3KA 3NI9A 1A0KA 1ES2A 3IX4A 2F8NH 3K3CA 4N1XA 3AV1A 4R8PA 3V9RA 1L3LA 5AV8D 4H9RB 1CEFA 1TZYD 4I3AA 2XFSA 2PDRA 3CITA 3WKJC 1JWVA 5B1MD 3KWQB 1KGEA 4U0XA 5G18A 3S22A 2HP9A 3UO9A 1CI9A 1M1AB 4KG2A 2BLSA 3NQUA 3WTPB 5CPJA 1I5QA 1C3BA 1E6ZA 5AV9A 1HLUP 1WYCA 2QZ6A 3LZ1B 3KYQA 2WKPA 1O07A 2JKRM 1YQSA 1HVBA 3BEBA 4WJ3C 3REKD 1EQZB 4UAAA 5EFWA 4MCWA 2XSSA 2JKTM 3SH9A 5FQJA 3AFAA 5HAQA 5E5AD 5TBMA 3TG9A 3FKVA 5GT0B 1H0MA 1Q2PA 4G3WA 4GD8A 3MGQD 4Z2KA 3T1XA 2L5AA 4DRBA 3N6IA 4NZ1A 3O87A 2KDKA 1U60A 1GSVA 4EESA 4HOIA 1W1VA 3BFFA 5CPKC 2ZQ9A 1HQ3C 3W98C 2HIOD 3H7WA 5FASA 5IS1A 1B6WA 2C5WB 3WRZA 4XXRA 2VA0A 3ZVWA 4EO5C 3MGPC 4BJPA 5B1MA 4BBTA 3NULA 4Z9QA 2XD1A 5GSUD 3AZFA 2P9VA 1MWTA 1S67L 2ZM2A 3C1BB 4GHIB 1VHMA 3A6NB 3HUOA 3AZIB 1P3FD 1N1JB 3LR0A 4XUJB 4OJLA 1TDGA 4R1GA 2PT7A 1M19B 4IUHA 3T4SA 3LZ0C 4J8XD 5GLDA 5E5AA 4UUZB 3IXGA 5G4ZA 4ETXA 4JXSA 3MGQA 4H6JB 3AZEC 1E6NA 5IHVA 4ZUXB 3UT9C 1P3KC 4I3IA 5JRGC 2VKSA 1OGBA 5BO0A 3EQUA 1RP5A 3KSIA 3MKEA 5EPHA 3UE0A 3W99B 3LIAA 4RVAA 5AVBB 4Y7PA 4S2MA 3KSYA 5HWVA 1OT6A 1CK7A 1BULA 2Y4AA 1PWCA 4MBFA 1P3BD 1P3LD 2WKQA 4HMCA 5DNND 5GSUA 3ZFZA 1XGIA 4PM6A 1H3OB 4P6ZM 5F99D 1LSVA 3MQ0A 5B2JB 1BH8B 1UWNX 3C1CD 1P3FA 5BT1D 4GKUA 2HUEC 4ZBJC 3G34A 4DJ2A 2PBYA 1CQAA 2WZZA 3NCKA 5A91A 4NXBA 4J8XA 3EEHA 5EOEA 2BYKA 3IX3A 3PYPA 1IEMA 2Y2NA 4IBGA 3AZKC 3VH6W 4Z66D 4NG2A 3VFHA 3VV4A 1XX2A 3BFGA 2F8NB 1OJ5A 5J4EA 3W97A 4IBBA 4JF5A 3KXBC 1P3PC 5GHXA 2FFFB 3AZGC 1JVJA 3M2KA 4EV4A 2P7JA 1WA9A 1L0EA 4XZQD 2VK3A 2WKRA 4XUXA 2Y8HA 3V39A 3KUYA 2BYMA 3B6FD 4Y0OA 3LELB 3A3JA 3KYZA 1S32C 4BQMA 3MXRA 3OZHA 5BNVB 1KGFA 1P3BA 1JFIA 3GR2A 3HBRA 5DNNA 1P3MB 3LJAB 3CUEC 1K38A 3D4FA 4JGPA 5DTKA 5GT3B 3VP0A 4OQ0A 2W27A 5F99A 1LHYA 4Z2MH 3BY9A 4KQOA 5CXWA 3B6GD 2ZQAA 4Y3IA 4U0TA 3OPHA 4FSFA 4R4RA 3AZMA 2J9PA 1WWIA 2VZWA 2UWXA 4R0QA 1KX4B 5AVCD 5G49B 4NKPA 3CAXA 5HWTA 5AQAA 5L8MA 3T4JA 3RELD 3VH5W 3JVVA 1P3AB 2NZDB 4Z66A 4LG2A 3MGSD 1AWIA 1TEMA 5B24D 1BLSA 3IS2A 2PYRA 3GQZA 2XA7M 3X1TC 1UR9A 3V5MA 4D2OA 1VETA 2VGLM 3UB5P 1P3OA 4GNUA 5GXQD 3H82B 3B6FA 5DNMB 2KLIA 3Q7ZA 3B0DB 1KDSA 2VV7A 1AOIB 5B40C 1ES3A 4YFMA 1PI4A 4MN7A 2I9VA 1WE4A 2ZMAA 5CGSA 3MKFA 3OCNA 3MVDA 2Y55A 2J80A 1XFNA 4II7A 2W0NA 3UPOA 2VV6A 4Q8IA 2ZM0A 5FQKA 3EEAA 3AV1C 3GV9A 4AWLB 4R8PC 5DFYA 3AZHB 3B6GA 3AGEA 5HAPA 3UE6A 5E2FA 1GSXA 3IH9A 1W2EA 5CP6A 3WA9D 1BH9A 4OP8A 4FOFA 4WELA 1FSWA 4QWOA 4M4XA 1W63M 5AVCA 3LYXA 5CPJC 4K91A 4HH3A 5AV9C 3RELA 3MFXA 3G4PA 3B0CW 2VJWA 1RGZA 3MGSA 1UWPX 1K0KA 4HESA 2W3EA 4IHQA 2EX6A 1GXDA 1F66A 3FV7A 3BJNA 5EM0A 1ESIA 1IYOA 1SKOA 4IBFA 5GXQA 3AFAC 2IOUA 4CSRB 1PDCA 4NXFA 2XQZA 4MMNA 1ZLAA 1PIOA 1Q9CA 3ZG5A 3NJAA 1KX3B 3OCLA 4EQ1A 1JTDA 1KX5D 1NWZA 4ZRRA 4WZSB 5CPKD 1ID3B 1D1JA 2HDUA 4ESPA 3F6TA 3RJUA 3ZDJA 5AV8C 2ZLYA 2ZL1A 1TZYC 3MGPD 4JLFA 3VSLA 4BENA 3IF6B 5CHLB 5B1MC 4F3LB 3B0BA 3WA9A 4UQIM 5BNXB 1TAFA 4R70A 1M1AD 5F83A 5FDHA 3AZFC 1IYQA 1XKZA 3KSGA 3HJKA 1H5XA 4MN5A 4H9QB 1PZOA 3WTPD 1XJ3A 2ZQCA 5HL1A 2XRNA 4G92B 4QLCB 3K2NA 3O5YA 1O7EA 1DJCA 3GTCA 3HUMA 1T3UA 3UN7A 5AV6B 4YM6B 2PRFA 3BW6A 4IVIA 4JF6A 5E2HA 3REKC 4G91C 2HZ5A 1JWZA 4KZ8A 3W4QA 4HP4A 1E6PA 4GW9A 5DKKA 1EQZD 5E5AC 5IT5A 3X1VA 3MGRB 5IU1A 3IWIA 4NETA 3AZED 3MGQC 4NE3A 1ES5A 4CLCB 1KX5A 1G28A 4LD9B 4NXEA 3ZQ5A 1P34B 3NIAA 4NZ4A 5TR7A 3REJD 2OLUA 2ZY2A 5DJUA 1T1AA 5KSHA 4H9RA 4DJ3A 2EFUA 5L09A 3MQLA 1N9LA 5CPIB 3E2LA 3HL9A 2WYXA 3LGOA 1OGGA 2ZJ9A 5GSUC 3HREA 5J7EA 4MBKA 1OMEA 3P5JB 1M1AA 2Y2MA 5CHMA 1P9RA 3T4KA 1KE3A 3IHBA 3NOUC 1YSPA 2Y59A 3WTPA 4GHAA 4F94A 3AL0C 3C1BD 3O62B 4GCZA 1P3FC 1VM1A 4RX2A 4DE1A 4E6XA 3LZ1A 4Y0TA 4X1MA 5BS7A 3SZTA 4WU9B 2OAQ1 4PM8A 4B93A 4CPKA 3UTBB 2XROA 3BFDA 4PMAA 4WU8B 1CXWA 1D7EA 1T19A 4J8XC 3W2ZA 1EQZA 2JC7A 3LEZA 1M19D 3T1SA 3G31A 4RA7A 2Y2HA 3R45B 4Y15A 3W96B 4C6YA 1XJ4A 3PTEA 3G35A 2ZM8A 3REHD 4I38A 5GT0A 5B0ZB 4L9GA 1P3PD 3VSKA 5M18A 3AZGD 3NDEA 1H8MA 5C3IC 2YKHA 1AIWA 4ZUXD 3NY4A 4NY2A 1MZUA 4DRAA 3REJA 1DJAA 4KGCD 2KOIA 3U2AA 4IBEA 1FIKA 3VH6A 2XR0A 3T4LA 2ZD8A 3T50A 5CX7A 3UTAD 1P3BC 4KENB 1ZTUA 1P3LC 3WS2A 5DNNC 5FEGA 2JKRI 2G2UA 4DDSA 1YU3A 5FQQA 3EGXC 3P7NA 5F99C 4S2PA 2IO5B 4ZAMA 2JKTI 4HQAA 3C1BA 3C1CC 4GHIA 4DE2A 4M6BA 5B2JD 2CMNA 5BT1C 3A6NA 1W8QA 2L0WA 4X6TA 3VP2A 4IBDA 1N1JA 1Z09A 5F6AA 4XUJA 3EWKA 4N92A 1M19A 3LCEA 2PYOB 1H8PA 4Z66C 1LL8A 1ONHA 4X25A 3Q7VB 4UUZA 1XJ2A 3WRTA 3V3RA 3EG5B 3X1TD 3CPTB 4H6JA 3CWFA 1P3OC 4BBUA 4ZUXA 5F82A 2PD8A 1LSXA 1NXYA 1TS8A 3B6FC 3LIFA 2HDSA 3A0VA 4WMCA 1HZOA 1TS0A 3QP6A 2DMWA 3W99A 4GN2A 5C5KA 3UTAA 5AVBA 2Z6DA 1U35B 3LR5A 4MB5A 4MDZA 3A0SA 4IBKA 2D02A 5GT3D 3AV1D 4R8PD 4Z5TB 1H3OA 2R78A 2W3HA 3B6GC 5B2JA 2V1ZA 5DTSA 1BH8A 4YS3B 5B32B 3RXXA 5JYOA 1YT4A 3VMAA 3LY3A 2FJ7B 1JWPA 3UMEA 5AVCC 1ZG4A 4EWFA 3RELC 3REIB 3IHAA 4WBGA 1BZAA 3WKJB 3MGSC 5B24C 4LPZA 3PBOA 2NZDD 4N9KA 3Q81A 5AJGA 2CWEA 1FCOA 1XA1A 4DE3A 3WAAD 3LICA 2O99A 5EOOA 4EEUA 3VP1A 1DP8A 4OLGA 5GXQC 1PZRA 1HD8A 3NBLA 3T4OA 4HGAC 5EE8A 2ZY4A 4JJNB 1ZLAC 4O01A 5DNMD 2W3FA 4GDBA 1SDEA 3SH7A 1AOID 5BNVA 2Y2LA 3LJAA 5HDCA 5GT3A 3WS1A 1H8ZA 5HL6A 4OP5A 3HSHA 4FTXA 1TF1A 1BFMA 1P3IB 2ZC4B 4E3MA 4JGQA 3UE1A 3M6HA 3MQOA 3WA9C 3MXQA 3AZFD 1HQ3B
chains in the Genus database with same CATH topology
4NZ5A 1KX4A 5G49A 5EVIB 1W5DA 4IBIA 3WTPE 2J8YA 5B2IB 1P3AA 2NZDA 2Y2QA 4A5RA 5B1LB 3WAAA 3AZJB 3L29A 3FWLA 2EXAA 2DNSA 1IYPA 3DWZA 1XPBA 3X1VC 4FD8A 1BLPA 2CV5B 5DNMA 3SS4A 5CGXA 1GA9A 4EUZA 1KX5C 1KX3D 1AOIA 4J8UB 4ZJ2A 2EFXA 2WGWB 4NYUA 3ITAA 4OPYA 3VFFA 2F2AC 4OOMA 4LV0A 4OJ5A 4PM9A 3AZHA 1PW8A 3P98A 5U47A 1P3KB 1K57A 5JRGB 2V2FF 1KE0A 1M1AC 3UDIA 2NQBD 3JYIA 1FCMA 3WTPC 5B31G 5B31B 3SS3A 3PBNA 2IWDA 5BS7C 1FQGA 1Z6FA 4QLCD 4YM6D 3I7JA 1EQZC 5KSCA 1F1EA 1YLPA 2ZC3B 4CSRA 5CTMA 3MGRD 5GT0C 3W97D 2RIQA 1KX3A 3KUYD 4LD9D 1P34D 4E3OA 1NZUA 4R3JA 3REJC 3HLDA 1ID3A 2DRWA 3BRMA 4LENA 4M3KA 4QHCA 3ISGA 4FH2A 3IF6A 3IF5A 4KZ9A 4ZJ3A 5CPID 1QMEA 3S4XA 3HONA 3AV2B 2V20A 1WWSA 2OV5A 1S32B 2NQBA 3N8SA 3C1BC 2HPBA 4H9QA 2J9OA 1E25A 3A6NC 4EBNA 3O62D 3AZMD 4QLCA 2GDNA 3IWQA 4WU9D 1KVMA 4S2JA 3UTBD 5AV6A 4YM6A 3ZG8B 4O7DA 4B88A 5HW3A 4WU8D 5FI7A 1M19C 3L26A 4WV4B 1A7WA 2WZXA 2F8NG 3KFUG 3MGRA 3REHC 1MBLA 4OH0A 4J8VB 1ESUA 1P3OD 5B0ZD 1AXBA 2YFVB 4ZUXC 4LD9A 1P34A 3B3XA 4BD0A 2Z2LB 4KGCC 4H9NB 3W99C 3WS4A 3UTAC 5AVBC 4E44A 1MKIA 3VOYA 4DQYB 2ZQ8A 5AV5B 3MVDD 5CPIA 1KU5A 1GCEA 2YFWB 3MXSA 5B40B 4QD4A 4WEJA 5B2JC 1ZG6A 4JBFA 5CP6D 3O62A 4H9OB 1FOFA 4WU9A 1W8YA 3UTBA 4N9LA 4WU8A 3LO7A 1XA7A 3HLFA 5EECA 2Q9NA 3TU4B 1LLBA 3LY4A 3FZCA 4GH9A 1F66D 2PYOD 3R45A 3W96A 1K55A 5B0ZA 1NZOA 5DF7A 3MFDA 4HBUA 2J8PA 4OVDA 1P3GB 4XUZA 1ZLAD 4NFTA 3O88A 1HTZA 4H9PB 4BL3A 3N3FA 4EQIA 2HP6A 2RCXA 4E6WA 3AZLB 1W79A 4OUIA 1L2SA 1PW1A 3LJAC 1U35D 5GT3C 4KUDB 4UHUA 4Z5TD 3IT9A 2XDMA 2XF3A 4LCLA 4CAYB 4YS3D 5B32D 4KG5A 4WNNB 2WAFA 4S2KA 5AV8B 2FJ7D 5CHUA 1TZYB 1KX4C 2QMIA 3REID 2I72A 2PYOA 2NZDC 3Q7VA 4QY5A 5EUAA 2P9VB 1ERQA 3E2KA 5EVLA 3UPNA 3WAAC 2XFTA 4DRTA 4EBPA 1LI9A 2G2WA 3X1VD 1K56A 1G6AA 2ZC6B 3N8LA 4IVKA 5DNMC 3MNND 3GMWA 3B0DC 2HDRA 3REKB 1AOIC 3NQJB 3IH8A 5KZHA 3EPJA 5A93A 1ZKJA 1U35A 3BFEA 5KMWA 4KQRA 4P6BA 4Z5TA 5B0YB 1L0DA 1QMFA 2EX2A 4X53A 3AZHC 1RGYA 1IYSA 4IBRA 1K57C 3KWQD 3CMZA 4YS3A 5B32A 3IXHA 4HBTA 2HIOB 1IELA 3C5AA 2FJ7A 1PZPA 1HTAA 3BLMA 1L0FA 3REIA 3LZ1D 2DF4C 2RL3A 5EVID 3WKJA 3S1YA 2F8NK 4MLLA 5KDMB 4P85A 5B1LD 3C4PA 3AZJD 2JBFA 2VGKA 4GHLA 1GHMA 1LL5A 3QHYA 3MNNA 3EPHA 5GT0D 4JJNA 2CV5D 1NY0A 3O3VA 4H9SA 4HEFA 1KX3C 1I2WA 3V3SA 5M19A 4J8UD 1ID3C 3ZNYA 3BECA 1GHIA 3UDXA 3HLEA 1P3IA 5C3IB 4LCMA 3KWQA 2AROB 1B67A 1MWSA 4X68A 1MY8A 1YMSA 4ZBEA 2NQBC 2Q9MA 4UPKA 1JFIB 4NYYA 1P3LB 3A6ND 5EVIA 3AZID 5B31D 2WKIA 3GVBA 5B2IA 2WKHA 4G92C 3AYWB 4QLCC 4XUJD 4X23B 3AN2B 5AV6C 4YM6C 5B1LA 5CGWA 2FFYA 3AZJA 3C1CB 4IBCA 5FAQA 2PU2A 5AY8B 3G32A 3MGRC 2CV5A 4RYEA 3W97C 3HLCA 1ES4A 4ZJ1A 4J8WB 3W4OA 3ZG0A 3KUYC 4LD9C 4J8UA 1PYYA 1RCJA 3X1SB 1P34C 5CRFA 2WGWA 4WMCD 3W99D 3AGDA 1Q2QA 5AVBD 2ZQ7A 4E3IA 3X1UB 4XZQB 5CPIC 1P3KA 4X69A 3UPPA 3EQVA 3ZNTA 4KZ4A 5CERA 4E3NA 1YU0A 3N4IA 4ID4A 1NYYA 3AZIA 5B31A 3HLWA 3O62C 3AZMC 1ALQA 4MEZA 4WU9C 1S0WA 3H0MC 3UTBC 2ZY5A 1YU2A 4WU8C 4ZTKA 5HAIA 1WYBA 4QNLA 4OQHA 3KS8A 2Y2GA 3W96C 3UDFA 3W8KA 1K55C 2F8ND 5B0ZC 4J8VD 1ONGA 5HARA 2XLNA 4OOYA 3A3EA 5B24B 3AZNB 3IP4C 2EX8A 3LELD 3FYZA 1NRFA 3BFCA 1IKGA 2X02A 3MVDC 1P3MD 3LJAD 1CI8A 3ZG9B 5AV5D 4KZ7A 2G5HC 3CG5A 3AV2A 1TVFA 5B33B 5FUGB 1M18B 4NZ3A 5B32G 3Q82A 4IJFA 3ZG7B 5CP6C 5E43A 2HP5A 4GDNA 3AGFA 3N7WA 4OKPA 5FSRA 1KX4D 1L0GA 1P3AD 1F66C 3TU4D 2PYOC 4FCFA 5HFOA 2ZC5B 2F8NA 4J8VA 2A49A 4BL2A 1KE4A 1YLYA 2JE5A 5FAOA 2YFVA 3FKWA 5JA4B 4BD1A 3LELA 1P3GD 5F1FA 4IBXA 4H9NA 1GA0A 4N1HA 2RVQC 1K54A 4GD6A 4CJNA 2Y2KA 3G30A 1P3MA 4JXVA 3PAEA 5F1GA 1U35C 5AV5A 3AZLD 4P0MA 4X55A 2WGIA 3H0LC 5GLAA 5I94A 2YFWA 4KUDD 4Z5TC 3AZHD 1TDLA 5FQMA 5B40A 5CPKB 4MBHA 4DXBA 4YS3C 5B32C 4E3JA 3W98B 5A90A 4OPZA 4H9OA 4IJEA 5JYPA 2FJ7C 4EO5B 2JSSA 3MGPB 3A3FA 3WWXA 3RXWA 2Y2IA 3REIC 3HUNA 1ULYA 4KHAB 3TU4A 3BLSA 1K25A 5GLCA 3UNWA 4LV1A 3IWOA 1FSYA 1PWGA 1P3GA 2PU4A 3MNNC 3BYDA 2EXBA 4JJNC 3WS5A 3A3IA 3LZ0B 4OPRA 4H9SC 4H9PA 2R9XA 5GL9A 4JKTA 3AZLA 1ID3D 3AZEB 2QPNA 2ZM5A 4KUDA 4OJPA 3ZHHA 2HDQA 3UT9B 4EBLA 2JCHA 1P3IC 3KWQC 2ZC7A 5B0YD 3VH6T 3REJB 4CAYA 1XGJA 5AQ9A 4WNNA 1M6KA 2DQNC 5AV8A 4WZ5A 4C3QA 1TZYA 3VOZA 3LZ1C 5EVIC 4WZ4A 2H0YA 4K0WA 5B2IC 3P09A 5J8XA 2R9WA 5AV6D 5B1LC 3ITBA 3AZJC 2HUEB 4ZBJB 3KS4A 1NJ4A 3DTMA 5DF9A 2CV5C 1GHPA 3REKA 3ZCZA 4LV3A 3AZKB 3NQJA 3DW0A 4J8UC 1YLTA 4K0XA 3REHB 3TOIA 3KXBB 1P3PB 4KZBA 1Z2CB 3AZGB 4KZ3A 1YMXA 3WS0A 5B0YA 3L28A 3VH5T 4QJGA 4PM7A 4OJOA 3VP3A 3HLBA 5BNXA 2AROD 2ZQDA 4KGCB 2Y2PA 2HIOA 3N8RA 4WEKA 3SS5A 4JF4A 1FR6A 1KGGA 5DVAA 3UTAB 3AZIC 4UA9A 5B31C 2P74A 3CZDA 2Y2JA 1YLZA 4XUJC 3AYWD 5FI6A 4X23D 5KDMA 3AN2D 1EI5A 3W96D 4UA7A 5AY8D 1Y54A 1BUEA 1K6RA 3HVFA 2XGNA 1MPLA 4J8WD 3X1SD 3X1TB 1LI0A 4DKIA 1KDWA 4WM9A 4JXWA 4S2NA 3CJMA 4B4XA 4MNRA 3B0CT 3X1UD 3PBTA 2AROA 3QNCA 1E3UD 1KVLA 3AV2C 1IKIA 5CECA 4RX3A 2Z2MB 5FI2A 1BSGA 1P3LA 2H0TA 3IXDA 4OQGA 2H5SA 1DY6A 4ZDXA 5E2GA 4DDYA 3AV1B 1BTLA 4R8PB 3V9RB 3AYWA 2DCFA 5FQIA 5GHZA 4C75A 4X23A 3AN2A 3A1KA 3C1CA 2CC1A 3NQUB 1J9MA 5AY8A 5CPJB 5AV9B 3C7UA 1BT5A 4QB8A 4J8VC 3SOIA 1K56D 4J8WA 5AQ7A 5M1AA 3X1SA 3LELC 5D3OA 3WAAB 3AZND 2Y91A 2RVQD 3L2AA 1K54C 5HX9A 3AFAB 1SHVA 1P3MC 3X1UA 2XH9A 4XZQA 4GOGA 5AV5C 5TGFA 1E3UA 2ZY3A 2WUQA 1SKFA 3ZVTA 3UE3A 5B33D 1M18D 3IQAA 5GLBA 4NE5A 4X56A 2LY8A 5B1MB 1N9BA 4JXGA 3WKJD 1P3AC 5FATA 3TU4C 3AZFB 3A3DA 4Y0UA 1YM1A 1PWDA 3M6BA 3W4PA 2Y2OA 5B24A 1P3GC 4JJND 3MZFA 5E2EA 4G91B 3NC8A 3AZNA 4GB7A 2X01A 5E5AB 3C4OA 2OSUA 3AZLC 4WYYA 1EROA 2IWCA 1NYMA 3MGQB 5A92A 4JPMA 4AWLC 5B33A 4S2IA 4KUDC 5FUGA 4H8RA 1P3ID 1M18A 2WK0A 4B4ZA 3O86A 5BO0B 4P87A 4DF6A 4E45A 5CEBA 2J7VA 3HLGA 4PPRA 2OLVA 1HQ3D 3W98D 1VQQA 4WZ5C 1BLHA 5GSUB 1K4FA 1XP4A 5B2ID 1JTGA 2NQBB 4GZBA 1P3FB 4E3LA 3FKEA 5JA4A 4J8XB 4Z2MG 4OQIA 2BYKB 3LZ0D 4NE6A 2BG1A 1ZC2A 4L0LA 3IXBA 3W97B 3BM6A 3UY6A 3PBQA 3M2JA 3IF6C 4KQQA 5B0YC 3KUYB 2BYMB 3UT9D 1P3KD 5JRGD 5CPKA 3OC2A 4KZ6A 3PBSA 1HQ3A 3W98A 2HIOC 4LV2A 5L2FA 1P3BB 4QU3A 3OPPA 3MGPA 4OONA 5DNNB 5GHYA 3VP4A 5CEDA 3Q07A 1R4VA 4KHAA 5F99B 2VGJA 1K4EA 4KZAA 4KZ5A 4KG6A 4R3BA 3QNBA 3L27A 1ERMA 1MXOA 3AZMB 5FA7A 4U3TA 3OPRA 2X71A 1CEGA 1SCWA 3LZ0A 4Z66B 1M40A 1K6SA 1XXMA 4R23A 3AZKD 4S2OA 2XD5A 2W8SA 1BLCA 3AZEA 2WKEA 5DTTA 4OPQA 1P3OB 4UA6A 3KXBD 4S2NC 4IBJA 3UT9A 3B6FB 1MWRA 5JRGA 2VQRA 1SDNA 2AROC 3AV2D 2A3UA 3GSGA 3EPLA 4IEDA 1S32D 5FAPA 3DWKA 3MZDA 1W7FA 3MVDB 3MZEA 5BOHA 3EPKA 3AYWC 4NK3A 3OPLA 3B6GB 4X23C 3AN2C 4S2LA 5CP6B 3V50A 1BH9B 1H8YA 1I2SA 5AVCB 3G2YA 5AY8C 1E4DA 3RELB 4OOLA 3H0RC 3L25A 3MGSB 4J8WC 1YU4A 3AZKA 2B5RA 1F66B 3WX7A 3X1SC 3G2ZA 3A1IA 2XEPA 3REHA 3KXBA 1P3PA 2WADA 5GXQB 2IWBA 3AZGA 5CTNA 4DE0A 1FCNA 1LL9A 2EX9A 4R4SA 4HGAB 3X1UC 4XZQC 5FQ9A 1ZLAB 5DF8A 1S32A 3ZGAB 1FR1A 4KGCA 1YUEA 3VH5A 2IO5C 5B40D 1G68A 1YLJA 4YINA 2H10A 1N4OA 3NDGA 3PAGA 2XK1A 4OLDA 4FH4A 1YU1A 2WGVA 4PM5A 1PI5A 3GRJA 3WA9B 1YLWA 2WAEA 1TAFB 2G5IC 2C6WB 5CPJD 5AV9D 3PBRA 3TSGA 5AQBA 5TFQA 5BPVA 3FDDA 3AZNC 1MWUA 3X1TA 3MBZA 1S6RA 4BLMA 3X1VB 3Q1FA 1EWZA 3AFAD 4QY6A 3C7VA 3MNNB 1DJBA 1KX5B 5B33C 4OJ6A 3SH8A 1M18C 1CK3A 5CHJA 4DXCA 2E8IA 4E3KA 3NI9A 1ES2A 2F8NH 4N1XA 3AV1A 4R8PA 3V9RA 5AV8D 4H9RB 1CEFA 1TZYD 2XFSA 3WKJC 1JWVA 5B1MD 3KWQB 1KGEA 4U0XA 5G18A 3S22A 2HP9A 3UO9A 1CI9A 1M1AB 4KG2A 2BLSA 3NQUA 3WTPB 5CPJA 1I5QA 1C3BA 5AV9A 1WYCA 2QZ6A 3LZ1B 1O07A 1YQSA 1HVBA 3BEBA 4WJ3C 3REKD 1EQZB 4UAAA 3SH9A 5FQJA 3AFAA 5HAQA 5E5AD 3TG9A 3FKVA 5GT0B 1Q2PA 4GD8A 3MGQD 2L5AA 4DRBA 3N6IA 4NZ1A 3O87A 1U60A 3BFFA 5CPKC 2ZQ9A 1HQ3C 3W98C 2HIOD 5FASA 1B6WA 2C5WB 3WRZA 4XXRA 3ZVWA 4EO5C 3MGPC 4BJPA 5B1MA 4Z9QA 2XD1A 5GSUD 3AZFA 2P9VA 1MWTA 2ZM2A 3C1BB 3A6NB 3HUOA 3AZIB 1P3FD 1N1JB 4XUJB 4OJLA 1TDGA 4R1GA 1M19B 3LZ0C 4J8XD 5GLDA 5E5AA 4UUZB 3IXGA 4JXSA 3MGQA 3AZEC 5IHVA 4ZUXB 3UT9C 1P3KC 5JRGC 5BO0A 3EQUA 1RP5A 3MKEA 5EPHA 3UE0A 3W99B 4RVAA 5AVBB 4Y7PA 4S2MA 3KSYA 2Y4AA 1BULA 1PWCA 4MBFA 1P3BD 1P3LD 5DNND 5GSUA 3ZFZA 1XGIA 4PM6A 1H3OB 5F99D 5B2JB 1BH8B 3C1CD 1P3FA 5BT1D 4GKUA 2HUEC 4ZBJC 3G34A 2PBYA 2WZZA 3NCKA 5A91A 4J8XA 5EOEA 2BYKA 1IEMA 2Y2NA 4IBGA 3AZKC 3VH6W 4Z66D 3VFHA 1XX2A 3BFGA 2F8NB 3W97A 4IBBA 4JF5A 3KXBC 1P3PC 5GHXA 2FFFB 3AZGC 1JVJA 3M2KA 4EV4A 1L0EA 4XZQD 3V39A 4XUXA 3KUYA 2BYMA 3B6FD 4Y0OA 3LELB 3A3JA 1S32C 4BQMA 3MXRA 3OZHA 5BNVB 1KGFA 1P3BA 1JFIA 3GR2A 3HBRA 5DNNA 1P3MB 3LJAB 3D4FA 1K38A 5DTKA 5GT3B 3VP0A 4OQ0A 5F99A 1LHYA 4Z2MH 4KQOA 5CXWA 3B6GD 2ZQAA 4U0TA 3OPHA 4FSFA 4R4RA 3AZMA 2J9PA 1WWIA 4R0QA 2UWXA 1KX4B 5AVCD 5G49B 5AQAA 3RELD 3VH5W 1P3AB 2NZDB 4Z66A 4LG2A 3MGSD 1TEMA 5B24D 1BLSA 3GQZA 3X1TC 3V5MA 4D2OA 1P3OA 4GNUA 5GXQD 3B6FA 5DNMB 3Q7ZA 3B0DB 1KDSA 1AOIB 5B40C 1ES3A 4YFMA 1PI4A 1WE4A 2ZMAA 5CGSA 3MKFA 3OCNA 3MVDA 2Y55A 3UPOA 4Q8IA 2ZM0A 5FQKA 3GV9A 3AV1C 4AWLB 4R8PC 3AZHB 3B6GA 3AGEA 5HAPA 5E2FA 3IH9A 1W2EA 5CP6A 3WA9D 1BH9A 4OP8A 4WELA 1FSWA 5AVCA 5CPJC 4K91A 5AV9C 3RELA 3G4PA 3B0CW 1RGZA 3MGSA 4HESA 2EX6A 3FV7A 1F66A 1ESIA 1IYOA 4IBFA 5GXQA 3AFAC 2IOUA 4CSRB 2XQZA 1ZLAA 1PIOA 1Q9CA 3ZG5A 1KX3B 3OCLA 1JTDA 1KX5D 4WZSB 5CPKD 1ID3B 2HDUA 3F6TA 3RJUA 3ZDJA 5AV8C 2ZLYA 3VSLA 1TZYC 3MGPD 4JLFA 4BENA 3IF6B 5CHLB 5B1MC 3B0BA 3WA9A 5BNXB 1TAFA 5FDHA 1M1AD 5F83A 3AZFC 1IYQA 1XKZA 1H5XA 4H9QB 1PZOA 3WTPD 2ZQCA 5HL1A 4G92B 4QLCB 1O7EA 1DJCA 3GTCA 3HUMA 1T3UA 3UN7A 5AV6B 4YM6B 4IVIA 4JF6A 5E2HA 3REKC 4G91C 1JWZA 4KZ8A 3W4QA 1EQZD 5E5AC 3X1VA 3MGRB 3IWIA 4NETA 3AZED 3MGQC 4NE3A 1ES5A 1KX5A 4LD9B 1P34B 3NIAA 4NZ4A 5TR7A 3REJD 2OLUA 2ZY2A 5KSHA 4H9RA 2EFUA 5CPIB 3E2LA 3HL9A 2WYXA 2ZJ9A 5GSUC 3HREA 4MBKA 1OMEA 3P5JB 1M1AA 2Y2MA 5CHMA 1KE3A 3IHBA 2Y59A 3WTPA 4GHAA 4F94A 3AL0C 3C1BD 3O62B 1P3FC 1VM1A 4RX2A 4DE1A 4E6XA 3LZ1A 4Y0TA 5BS7A 4WU9B 4PM8A 4CPKA 3UTBB 3BFDA 4PMAA 4WU8B 4J8XC 1EQZA 2JC7A 3LEZA 1M19D 3G31A 4RA7A 2Y2HA 3R45B 3W96B 4C6YA 3PTEA 3G35A 2ZM8A 3REHD 5GT0A 5B0ZB 1P3PD 3VSKA 5M18A 3AZGD 3NDEA 5C3IC 4ZUXD 3NY4A 4NY2A 4DRAA 3REJA 1DJAA 4KGCD 4IBEA 2XR0A 3VH6A 2ZD8A 3UTAD 1P3BC 4KENB 1P3LC 3WS2A 5DNNC 2G2UA 4DDSA 1YU3A 5FQQA 5F99C 4S2PA 2IO5B 4ZAMA 3C1BA 3C1CC 4DE2A 4M6BA 5B2JD 5BT1C 3A6NA 1W8QA 4X6TA 3VP2A 4IBDA 1N1JA 4XUJA 4N92A 1M19A 3LCEA 2PYOB 4Z66C 3WRTA 1ONHA 3Q7VB 4UUZA 3V3RA 3EG5B 3X1TD 1P3OC 4ZUXA 5F82A 1NXYA 3B6FC 2HDSA 4WMCA 1HZOA 3W99A 4GN2A 3UTAA 5AVBA 1U35B 4IBKA 5GT3D 3AV1D 4R8PD 4Z5TB 1H3OA 3B6GC 5B2JA 2V1ZA 5DTSA 1BH8A 4YS3B 5B32B 3RXXA 5JYOA 1YT4A 3VMAA 3LY3A 2FJ7B 1JWPA 5AVCC 1ZG4A 4EWFA 3RELC 3REIB 3IHAA 4WBGA 1BZAA 3WKJB 3MGSC 5B24C 3PBOA 2NZDD 4N9KA 3Q81A 2CWEA 1FCOA 1XA1A 4DE3A 3WAAD 5EOOA 3VP1A 4OLGA 5GXQC 1PZRA 1HD8A 3NBLA 4HGAC 5EE8A 2ZY4A 4JJNB 1ZLAC 5DNMD 4GDBA 1SDEA 3SH7A 1AOID 5BNVA 2Y2LA 3LJAA 5GT3A 3WS1A 1H8ZA 4OP5A 3HSHA 1BFMA 1P3IB 2ZC4B 4E3MA 3UE1A 3M6HA 3WA9C 3AZFD 1HQ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UPP A;  3EQV A;  5EOE A;  4KZ4 A;  3ZNT A;  3C4O A;  1IEM A;  2OSU A;  4WYY A;  2Y2N A;  1ERO A;  5EVI B;  5CER A;  2IWC A;  1W5D A;  1NYM A;  4E3N A;  3VFH A;  5A92 A;  2J8Y A;  4JPM A;  3N4I A;  1XX2 A;  3BFG A;  4ID4 A;  1NYY A;  4S2I A;  4H8R A;  3HLW A;  2Y2Q A;  2WK0 A;  4A5R A;  1ALQ A;  4JF5 A;  5GHX A;  4B4Z A;  3O86 A;  4P87 A;  2FFF B;  1JVJ A;  4MEZ A;  3M2K A;  4DF6 A;  1S0W A;  4EV4 A;  1L0E A;  3FWL A;  4X6T A;  3V39 A;  2J7V A;  3HLG A;  2EXA A;  2OLV A;  4PPR A;  2DNS A;  4XUX A;  5CEB A;  1IYP A;  3DWZ A;  1XPB A;  4ZTK A;  1VQQ A;  4FD8 A;  4Y0O A;  1BLP A;  3A3J A;  4WZ5 C;  1BLH A;  5HAI A;  1WYB A;  4OQH A;  4BQM A;  1K4F A;  3MXR A;  1XP4 A;  3OZH A;  1KGF A;  3SS4 A;  5CGX A;  1GA9 A;  2Y2G A;  3GR2 A;  1JTG A;  3HBR A;  3UDF A;  3W8K A;  4EUZ A;  3D4F A;  1K55 C;  5DTK A;  1K38 A;  3VP0 A;  4OQ0 A;  4ZJ2 A;  2EFX A;  1ONG A;  2WGW B;  4GZB A;  5HAR A;  2XLN A;  4OOY A;  3A3E A;  1LHY A;  3ITA A;  4OPY A;  3VFF A;  4E3L A;  4KQO A;  5CXW A;  4OOM A;  4LV0 A;  2ZQA A;  2EX8 A;  4U0T A;  3FYZ A;  4PM9 A;  3OPH A;  4FSF A;  1PW8 A;  1NRF A;  3P98 A;  5U47 A;  1K57 A;  4R4R A;  3BFC A;  1IKG A;  2J9P A;  2V2F F;  2X02 A;  4OQI A;  4R0Q A;  2UWX A;  1KE0 A;  1CI8 A;  3ZG9 B;  5AQA A;  2BG1 A;  3UDI A;  4KZ7 A;  3CG5 A;  3JYI A;  1FCM A;  1TVF A;  1TEM A;  1ZC2 A;  3SS3 A;  4L0L A;  3IXB A;  1BLS A;  3BM6 A;  3Q82 A;  3PBQ A;  3M2J A;  3PBN A;  3UY6 A;  2IWD A;  1FQG A;  1Z6F A;  3ZG7 B;  3GQZ A;  3IF6 C;  4KQQ A;  5E43 A;  2HP5 A;  4GDN A;  3V5M A;  4D2O A;  3AGF A;  3N7W A;  4GNU A;  4OKP A;  3OC2 A;  4KZ6 A;  3I7J A;  5FSR A;  3PBS A;  5KSC A;  1L0G A;  1YLP A;  3Q7Z A;  4LV2 A;  5L2F A;  2ZC3 B;  4QU3 A;  1KDS A;  3OPP A;  4OON A;  5CTM A;  5GHY A;  3VP4 A;  5CED A;  1ES3 A;  3Q07 A;  4YFM A;  1PI4 A;  4FCF A;  5HFO A;  1WE4 A;  2ZMA A;  5CGS A;  2ZC5 B;  3MKF A;  3OCN A;  2Y55 A;  3UPO A;  2VGJ A;  1K4E A;  4KZA A;  2A49 A;  4KZ5 A;  4KG6 A;  4R3B A;  3QNB A;  4Q8I A;  2ZM0 A;  5FQK A;  3GV9 A;  4BL2 A;  4E3O A;  1KE4 A;  1YLY A;  1NZU A;  2JE5 A;  4R3J A;  3HLD A;  5FAO A;  2DRW A;  3BRM A;  1ERM A;  3FKW A;  3AGE A;  4LEN A;  4M3K A;  4QHC A;  4BD1 A;  5HAP A;  1MXO A;  3ISG A;  5F1F A;  4FH2 A;  5FA7 A;  5E2F A;  4IBX A;  4U3T A;  3IH9 A;  3OPR A;  3IF6 A;  2X71 A;  4OP8 A;  1GA0 A;  3IF5 A;  4KZ9 A;  4N1H A;  1K54 A;  4GD6 A;  1CEG A;  1FSW A;  4WEL A;  4ZJ3 A;  4CJN A;  2Y2K A;  1QME A;  3G30 A;  1SCW A;  3S4X A;  2V20 A;  4JXV A;  3PAE A;  5F1G A;  4K91 A;  2OV5 A;  3G4P A;  1M40 A;  1K6S A;  1XXM A;  4P0M A;  4R23 A;  4X55 A;  2WGI A;  3N8S A;  1RGZ A;  4S2O A;  5GLA A;  2XD5 A;  1BLC A;  5I94 A;  2HPB A;  4HES A;  2J9O A;  1E25 A;  2WKE A;  2EX6 A;  1TDL A;  3FV7 A;  5FQM A;  4EBN A;  5DTT A;  1ESI A;  4OPQ A;  4UA6 A;  4S2N C;  1IYO A;  2GDN A;  4MBH A;  3IWQ A;  4DXB A;  4E3J A;  1KVM A;  4S2J A;  1MWR A;  5A90 A;  4OPZ A;  3ZG8 B;  4B88 A;  4O7D A;  5HW3 A;  1SDN A;  5JYP A;  5FI7 A;  2A3U A;  3A3F A;  3GSG A;  3WWX A;  4IED A;  2XQZ A;  1PIO A;  3RXW A;  5FAP A;  4DXC A;  2Y2I A;  3DWK A;  3ZG5 A;  2WZX A;  3MZD A;  3HUN A;  3OCL A;  1MBL A;  1W7F A;  4OH0 A;  1JTD A;  3BLS A;  3MZE A;  5BOH A;  1K25 A;  5GLC A;  1ESU A;  3UNW A;  1AXB A;  4LV1 A;  4NK3 A;  2HDU A;  3OPL A;  3IWO A;  3B3X A;  3RJU A;  3ZDJ A;  4BD0 A;  2ZLY A;  2Z2L B;  1FSY A;  3VSL A;  4BEN A;  4JLF A;  1PWG A;  4S2L A;  3IF6 B;  3V50 A;  1H8Y A;  1I2S A;  2PU4 A;  3WS4 A;  3BYD A;  2EXB A;  3WS5 A;  3VOY A;  1MKI A;  3A3I A;  4OPR A;  3G2Y A;  1E4D A;  2ZQ8 A;  2R9X A;  4OOL A;  5FDH A;  5F83 A;  5GL9 A;  4JKT A;  1IYQ A;  1XKZ A;  1GCE A;  1H5X A;  1PZO A;  3MXS A;  2B5R A;  2QPN A;  2ZQC A;  5HL1 A;  4QD4 A;  4WEJ A;  1ZG6 A;  3G2Z A;  3ZHH A;  2XEP A;  1O7E A;  4JBF A;  2HDQ A;  1DJC A;  4EBL A;  3GTC A;  3HUM A;  2JCH A;  3UN7 A;  2ZC7 A;  4IVI A;  1FOF A;  2WAD A;  4JF6 A;  5E2H A;  2IWB A;  4DE0 A;  5CTN A;  1FCN A;  1W8Y A;  1LL9 A;  2EX9 A;  1JWZ A;  4KZ8 A;  4R4S A;  4N9L A;  3W4Q A;  5AQ9 A;  1XGJ A;  5FQ9 A;  3LO7 A;  1M6K A;  1XA7 A;  3HLF A;  5EEC A;  2Q9N A;  5DF8 A;  3ZGA B;  1FR1 A;  4WZ5 A;  4C3Q A;  1LLB A;  3LY4 A;  3IWI A;  3VOZ A;  3FZC A;  4NET A;  5EVI C;  4WZ4 A;  2H0Y A;  4K0W A;  4DKI A;  1ES5 A;  3P09 A;  1G68 A;  1YLJ A;  1K55 A;  5J8X A;  4YIN A;  2H10 A;  2R9W A;  1N4O A;  3NDG A;  3PAG A;  3NIA A;  2XK1 A;  4OLD A;  1NZO A;  4FH4 A;  5DF7 A;  3ITB A;  3MFD A;  4HBU A;  4OVD A;  5TR7 A;  2OLU A;  2WGV A;  4XUZ A;  4PM5 A;  1NJ4 A;  1PI5 A;  3DTM A;  3O88 A;  1HTZ A;  3GRJ A;  5DF9 A;  5KSH A;  1YLW A;  2WAE A;  2EFU A;  4BL3 A;  3E2L A;  3HL9 A;  2WYX A;  1GHP A;  2ZJ9 A;  4EQI A;  2HP6 A;  3HRE A;  2RCX A;  4E6W A;  4MBK A;  1OME A;  2Y2M A;  2C6W B;  1W79 A;  3ZCZ A;  1L2S A;  1PW1 A;  4LV3 A;  5CHM A;  1KE3 A;  3IHB A;  3PBR A;  3DW0 A;  2Y59 A;  1YLT A;  3TSG A;  4F94 A;  5AQB A;  4K0X A;  4UHU A;  5TFQ A;  1VM1 A;  4RX2 A;  4DE1 A;  3TOI A;  4E6X A;  4KZB A;  4Y0T A;  3IT9 A;  4PM8 A;  2XDM A;  2XF3 A;  4KZ3 A;  4CPK A;  1MWU A;  1YMX A;  4LCL A;  3MBZ A;  3WS0 A;  3BFD A;  4PMA A;  4QJG A;  4KG5 A;  4PM7 A;  1S6R A;  3VP3 A;  4BLM A;  2WAF A;  3HLB A;  4S2K A;  3Q1F A;  1EWZ A;  2JC7 A;  2ZQD A;  3LEZ A;  4QY6 A;  5CHU A;  3G31 A;  2Y2P A;  4RA7 A;  2Y2H A;  2QMI A;  3C7V A;  3N8R A;  4WEK A;  3SS5 A;  4JF4 A;  1FR6 A;  1KGG A;  1DJB A;  5DVA A;  4C6Y A;  3PTE A;  3G35 A;  2ZM8 A;  2I72 A;  4UA9 A;  3SH8 A;  2P74 A;  3CZD A;  3Q7V A;  4QY5 A;  1CK3 A;  5CHJ A;  5EUA A;  2Y2J A;  3VSK A;  2P9V B;  1ERQ A;  2E8I A;  3E2K A;  5EVL A;  1YLZ A;  3NDE A;  3NI9 A;  3UPN A;  4E3K A;  1ES2 A;  2XFT A;  4DRT A;  4EBP A;  5FI6 A;  1LI9 A;  3NY4 A;  4N1X A;  2G2W A;  1K56 A;  1DJA A;  1G6A A;  2ZC6 B;  1CEF A;  3N8L A;  2XFS A;  4IVK A;  2XR0 A;  1JWV A;  3GMW A;  1KGE A;  2ZD8 A;  4U0X A;  1EI5 A;  5G18 A;  4UA7 A;  2HDR A;  3S22 A;  2HP9 A;  4KEN B;  3UO9 A;  1CI9 A;  3WS2 A;  1Y54 A;  4KG2 A;  1BUE A;  1K6R A;  3HVF A;  3IH8 A;  2BLS A;  5KZH A;  2G2U A;  4DDS A;  2XGN A;  1I5Q A;  1MPL A;  1ZKJ A;  1C3B A;  5A93 A;  5FQQ A;  3BFE A;  1WYC A;  2QZ6 A;  4S2P A;  5KMW A;  4ZAM A;  4KQR A;  4DE2 A;  1O07 A;  4P6B A;  1W8Q A;  1L0D A;  1LI0 A;  1YQS A;  2EX2 A;  1QMF A;  1KDW A;  1RGY A;  4WM9 A;  1HVB A;  4X53 A;  1IYS A;  4IBR A;  3VP2 A;  1K57 C;  3BEB A;  4JXW A;  3CMZ A;  4S2N A;  3CJM A;  4B4X A;  3IXH A;  4MNR A;  4UAA A;  4HBT A;  3SH9 A;  1IEL A;  3PBT A;  4N92 A;  3QNC A;  5FQJ A;  3C5A A;  5HAQ A;  1PZP A;  1E3U D;  1KVL A;  3LCE A;  3BLM A;  3TG9 A;  3FKV A;  1IKI A;  5CEC A;  3WRT A;  1L0F A;  1ONH A;  3Q7V B;  1Q2P A;  5EVI D;  3V3R A;  2RL3 A;  4GD8 A;  4RX3 A;  2Z2M B;  5FI2 A;  1BSG A;  3N6I A;  2H0T A;  3IXD A;  4OQG A;  3O87 A;  2H5S A;  1DY6 A;  3S1Y A;  4ZDX A;  1U60 A;  5E2G A;  4DDY A;  1BTL A;  4MLL A;  4P85 A;  3BFF A;  2ZQ9 A;  2DCF A;  3C4P A;  5F82 A;  5FQI A;  1NXY A;  2JBF A;  5GHZ A;  4C75 A;  5FAS A;  2C5W B;  3WRZ A;  4XXR A;  2VGK A;  1GHM A;  2HDS A;  4WMC A;  1HZO A;  3ZVW A;  1LL5 A;  3QHY A;  4BJP A;  2CC1 A;  4GN2 A;  1NY0 A;  3O3V A;  1J9M A;  4Z9Q A;  2XD1 A;  4HEF A;  3C7U A;  1BT5 A;  1I2W A;  2P9V A;  1MWT A;  4QB8 A;  3V3S A;  3SOI A;  5M19 A;  1K56 D;  2ZM2 A;  5AQ7 A;  3HUO A;  3ZNY A;  5M1A A;  3BEC A;  2V1Z A;  5D3O A;  5DTS A;  1GHI A;  3UDX A;  3RXX A;  5JYO A;  1YT4 A;  3HLE A;  2Y91 A;  4LCM A;  3VMA A;  1TDG A;  1K54 C;  3LY3 A;  4R1G A;  1SHV A;  5HX9 A;  1JWP A;  1MWS A;  1ZG4 A;  4X68 A;  2XH9 A;  5M18 A;  1MY8 A;  1YMS A;  4GOG A;  5GLD A;  4EWF A;  3IXG A;  5TGF A;  4ZBE A;  1E3U A;  3IHA A;  4WBG A;  2Q9M A;  1BZA A;  2WUQ A;  1SKF A;  3ZVT A;  3UE3 A;  4JXS A;  5EVI A;  3PBO A;  2WKI A;  3GVB A;  4E3M A;  4N9K A;  2WKH A;  3Q81 A;  5IHV A;  1FCO A;  1XA1 A;  4DE3 A;  5EOO A;  3IQA A;  5GLB A;  3VP1 A;  4OLG A;  5CGW A;  2FFY A;  1HD8 A;  3EQU A;  1RP5 A;  3NBL A;  3MKE A;  5EPH A;  4X56 A;  5EE8 A;  3UE0 A;  4RVA A;  4Y7P A;  4S2M A;  5FAQ A;  1N9B A;  2PU2 A;  4JXG A;  2Y4A A;  1BUL A;  3G32 A;  1PWC A;  5FAT A;  4GDB A;  1SDE A;  4MBF A;  3SH7 A;  4RYE A;  3A3D A;  3HLC A;  1ES4 A;  4Y0U A;  4ZJ1 A;  3ZFZ A;  3W4O A;  3ZG0 A;  1XGI A;  2Y2L A;  1YM1 A;  4PM6 A;  3WS1 A;  1PYY A;  1PWD A;  1RCJ A;  1H8Z A;  5CRF A;  4OP5 A;  2WGW A;  4WMC D;  3M6B A;  3W4P A;  2ZC4 B;  1Q2Q A;  2Y2O A;  3AGD A;  3G34 A;  3MZF A;  4GKU A;  2PBY A;  5E2E A;  2WZZ A;  3NCK A;  3UE1 A;  3M6H A;  2ZQ7 A;  3NC8 A;  4GB7 A;  4E3I A;  5A91 A;  2X01 A;  4X69 A; 
#chains in the Genus database with same CATH topology
 2PD7 A;  3HCY A;  1YSQ A;  4DMZ A;  4G3V A;  4NZ5 A;  1KX4 A;  5G49 A;  5EVI B;  1W5D A;  4IBI A;  3WTP E;  2J8Y A;  5I5L A;  5B2I B;  3IBR A;  1P3A A;  2NZD A;  4YOF A;  2Y2Q A;  4A5R A;  1EAK A;  3LIB A;  5B1L B;  3WAA A;  1BYW A;  3AZJ B;  3F1O B;  1E15 A;  4GJ4 A;  3MF0 A;  3L29 A;  3FWL A;  2EXA A;  2DNS A;  1IYP A;  3DWZ A;  1XPB A;  3X1V C;  4FD8 A;  1BLP A;  2CV5 B;  2ZOI A;  3H82 A;  3QP5 A;  5DNM A;  3SS4 A;  5CGX A;  1GA9 A;  4EUZ A;  4Y17 A;  1KX5 C;  1KX3 D;  1AOI A;  4J8U B;  4ZJ2 A;  2EFX A;  2V5O A;  2WGW B;  4NYU A;  2LB5 A;  3ITA A;  4OPY A;  3VFF A;  2F2A C;  4OOM A;  4LV0 A;  3MSH A;  4OJ5 A;  4PM9 A;  3AZH A;  1PW8 A;  2V0U A;  3P98 A;  5U47 A;  1P3K B;  1K57 A;  4AFI A;  1P0Z A;  3DTK A;  5JRG B;  2V2F F;  3DTE A;  3KX0 X;  5FDS A;  1KE0 A;  1M1A C;  2V8C A;  4LLO B;  1S1Z A;  3P01 A;  3UDI A;  2NQB D;  3JYI A;  1FCM A;  3TW8 A;  5FEF A;  3WTP C;  5B31 G;  2PYP A;  5B31 B;  3SS3 A;  3PBN A;  2IWD A;  5BS7 C;  1FQG A;  1Z6F A;  4O8G A;  3E4P A;  4I3J A;  4QLC D;  2O9C A;  2E8J A;  4YM6 D;  1S4S A;  3I7J A;  2MJ6 A;  1EQZ C;  3F1P B;  5KSC A;  1F1E A;  2RTS A;  5EVE A;  1YLP A;  2ZC3 B;  2OWJ A;  4CSR A;  1GPF A;  5CTM A;  1F5M A;  3MGR D;  5GT0 C;  3W97 D;  5FL3 A;  2RIQ A;  1KX3 A;  2ZMF A;  3F1N B;  3KUY D;  4LD9 D;  1P34 D;  4E3O A;  1NZU A;  4R3J A;  3REJ C;  3HLD A;  1ID3 A;  2DRW A;  3BRM A;  4LEN A;  4M3K A;  4QHC A;  3QP1 A;  4EUV A;  3ISG A;  4FH2 A;  2B02 A;  3IF6 A;  3IF5 A;  4KZ9 A;  4ZJ3 A;  5CPI D;  1QME A;  3S4X A;  3HON A;  3AV2 B;  2Q0O A;  2V20 A;  1WWS A;  2OV5 A;  1S32 B;  2NQB A;  2W3D A;  2W3G A;  3N8S A;  3C1B C;  2HPB A;  4H9Q A;  2J9O A;  4MN6 A;  1E25 A;  3A6N C;  2V1A A;  4EBN A;  3O62 D;  2GZA A;  3AZM D;  4QLC A;  2GDN A;  3IWQ A;  4WU9 D;  1KVM A;  4S2J A;  3UTB D;  5AV6 A;  4YM6 A;  2V0W A;  4O7D A;  3ZG8 B;  4B88 A;  5HW3 A;  4WU8 D;  5FI7 A;  1GSW A;  1M19 C;  2O9A A;  1ODV A;  3MJQ A;  4ARZ A;  3L26 A;  4WV4 B;  4KUO A;  4QPR A;  1A7W A;  2WZX A;  2F8N G;  3KFU G;  3MGR A;  3REH C;  1MBL A;  4OH0 A;  4J8V B;  2P04 A;  1ESU A;  1P3O D;  5B0Z D;  3BQA A;  1AXB A;  4CLC A;  2AVX A;  2YFV B;  3WD0 A;  4ZUX C;  4LD9 A;  2A24 B;  1P34 A;  1W63 Q;  1YPR A;  3KSF A;  3B3X A;  4BD0 A;  2Z2L B;  3WD1 A;  4KGC C;  3FC7 A;  4BWI A;  4H9N B;  3LEQ A;  3W99 C;  3WS4 A;  1MC0 A;  3UTA C;  5AVB C;  4E44 A;  1MKI A;  3VOY A;  2YKF A;  4DQY B;  2ZQ8 A;  2QYB A;  5AV5 B;  3MVD D;  5CPI A;  1KU5 A;  1NRJ A;  4EU0 A;  4RQ9 A;  1G5U A;  1GCE A;  2YFW B;  1QO6 A;  3MXS A;  1E88 A;  5B40 B;  4HMD A;  4QD4 A;  4WEJ A;  5B2J C;  1ZG6 A;  3T1R A;  3MQQ A;  4JBF A;  5CP6 D;  3O62 A;  5LBR A;  4H9O B;  1MKM A;  1FOF A;  4WU9 A;  1W8Y A;  3UTB A;  4N9L A;  2EA9 A;  4WU8 A;  3E0Y A;  3LO7 A;  1XA7 A;  3HLF A;  5EEC A;  2Q9N A;  3TU4 B;  1LLB A;  3LY4 A;  3FZC A;  4GH9 A;  1F66 D;  2PYO D;  3R45 A;  3W96 A;  1V9Y A;  1K55 A;  3C2W A;  3TRC A;  5B0Z A;  4Q0I A;  1NZO A;  5DF7 A;  1W1P A;  2EWV A;  3MFD A;  4HBU A;  2J8P A;  4OVD A;  2INW A;  1P3G B;  4XUZ A;  1ZLA D;  2QKP A;  4NFT A;  3O88 A;  1HTZ A;  4H9P B;  4BL3 A;  3ULF A;  4PHT A;  3N3F A;  4JGO A;  4Z2I A;  4EQI A;  2HP6 A;  2QJ7 A;  2RCX A;  4E6W A;  3AZL B;  1W79 A;  4OUI A;  1L2S A;  1PW1 A;  3LJA C;  3RH8 B;  1U35 D;  5GT3 C;  4G3K A;  4KUD B;  1L6J A;  4UHU A;  2PHY A;  4Z5T D;  3IT9 A;  2XDM A;  2XF3 A;  2L4R A;  3LI9 A;  4LCL A;  4CAY B;  4YS3 D;  5B32 D;  4KG5 A;  2B18 A;  4WNN B;  1CF0 A;  2WAF A;  4S2K A;  4HME A;  3BY8 A;  5AV8 B;  2FJ7 D;  5CHU A;  1TZY B;  1GOI A;  1KX4 C;  2QMI A;  5J3W A;  3EOI A;  3REI D;  2I72 A;  4L9E A;  2PYO A;  2NZD C;  3Q7V A;  4QY5 A;  4HI4 A;  5EUA A;  3RTY A;  2P9V B;  1ERQ A;  3E2K A;  5EVL A;  3UPN A;  3WAA C;  2XFT A;  4DRT A;  3CPT A;  4EBP A;  1LI9 A;  1T1B A;  2G2W A;  3X1V D;  1K56 A;  1OJG A;  3T1Q B;  1G6A A;  2ZC6 B;  3N8L A;  2HF6 A;  4IVK A;  5DNM C;  3MNN D;  3GMW A;  3B0D C;  1E6R A;  4PAU A;  2HDR A;  3REK B;  1AOI C;  3NQJ B;  3IH8 A;  5KZH A;  3EPJ A;  5A93 A;  1ZKJ A;  1U35 A;  3LIE A;  3BFE A;  5KMW A;  4KQR A;  1PFL A;  5DKL A;  4MB4 A;  4P6B A;  4Z5T A;  5B0Y B;  1L0D A;  1QMF A;  2EX2 A;  4X53 A;  3AZH C;  1RGY A;  1IYS A;  4IBR A;  1K57 C;  3KWQ D;  1KOU A;  3CMZ A;  2VLG A;  4YS3 A;  5B32 A;  3IXH A;  4HBT A;  1T18 A;  2HIO B;  1IEL A;  3C5A A;  2FJ7 A;  1PZP A;  4HJ6 A;  1HTA A;  2PBD P;  3BLM A;  3VE4 A;  1L0F A;  3REI A;  4I39 A;  3LZ1 D;  2DF4 C;  2RL3 A;  5EVI D;  3WKJ A;  2K2N A;  4R3A A;  3S1Y A;  2F8N K;  2EWW A;  4R38 A;  4MLL A;  1Y28 A;  1SZV A;  5KDM B;  3CI6 A;  5B1L D;  4P85 A;  3C4P A;  3AZJ D;  3GEC A;  4Y5F A;  2JBF A;  2VGK A;  4Z1W A;  4GHL A;  1GHM A;  5HSQ A;  1LL5 A;  3BWL A;  3QHY A;  3MNN A;  3EPH A;  4XT2 B;  5GT0 D;  4JJN A;  2CV5 D;  1NY0 A;  3O3V A;  3UMD A;  4H9S A;  1TS7 A;  4HEF A;  1KX3 C;  3CLO A;  1OT9 A;  1I2W A;  3V3S A;  4CLC E;  1VEU B;  5F68 A;  5M19 A;  1H0I A;  4J8U D;  1ID3 C;  3ZNY A;  3FPW A;  4TX8 A;  3BEC A;  1GHI A;  3UDX A;  4D60 A;  3HLE A;  1P3I A;  5C3I B;  4LCM A;  2FH5 A;  3KWQ A;  4HHD A;  2ARO B;  4IJG A;  1B67 A;  1MWS A;  3S7Q A;  4X68 A;  1H0G A;  1MY8 A;  1YMS A;  5AVF A;  4ZBE A;  2NQB C;  2Q9M A;  4UPK A;  4BMW A;  1JFI B;  4NYY A;  1P3L B;  3A6N D;  5EVI A;  1VB6 A;  3AZI D;  5B31 D;  2WKI A;  3GVB A;  5B2I A;  2WKH A;  4G92 C;  3AYW B;  4QLC C;  4XUJ D;  4X23 B;  3AN2 B;  5AV6 C;  4YM6 C;  5B1L A;  5CGW A;  2FFY A;  3AZJ A;  3C1C B;  4IBC A;  1X0O A;  5FAQ A;  2PU2 A;  5AY8 B;  3G32 A;  3DTI A;  3MGR C;  1F2K A;  2CV5 A;  2W1T B;  1TS6 A;  3B33 A;  4O0P A;  4RYE A;  3W97 C;  4Z2H A;  3HLC A;  1ES4 A;  4ZJ1 A;  4J8W B;  4Z2L A;  3W4O A;  3ZG0 A;  4CLC C;  4WUJ A;  3T4Q A;  3KUY C;  4LD9 C;  2JKF A;  4J8U A;  3WD4 A;  1PYY A;  2JHE A;  1RCJ A;  3X1S B;  1P34 C;  1DP9 A;  5CRF A;  2WGW A;  4WMC D;  3A0R A;  5HDD A;  3JPU A;  3W99 D;  1Q2Q A;  2D49 A;  3AGD A;  3NOT C;  5AVB D;  4HJ3 A;  2ZQ7 A;  4E3I A;  3X1U B;  4XZQ B;  5HZH A;  3S7P A;  5CPI C;  1P3K A;  4X69 A;  3UPP A;  3EQV A;  4YWZ A;  1J7M A;  3ZNT A;  4KZ4 A;  5CER A;  4E3N A;  1YU0 A;  1OTI A;  1OTB A;  3N4I A;  4ID4 A;  1NYY A;  3AZI A;  5B31 A;  3HLW A;  4Y13 A;  3O62 C;  3AZM C;  2OWH A;  1ALQ A;  4WL9 A;  4MEZ A;  4WU9 C;  1OTE A;  1S0W A;  3H0M C;  2D01 A;  1DP6 A;  3UTB C;  1W1Y A;  3DBA A;  2ZY5 A;  1YU2 A;  4WU8 C;  4ZTK A;  3FG8 A;  2UV0 E;  3F1P A;  5HAI A;  1WYB A;  4QNL A;  4OQH A;  3KS8 A;  2G7U A;  2Y2G A;  3W96 C;  3UDF A;  4HP9 A;  3UB7 A;  3W8K A;  1K55 C;  2F8N D;  5B0Z C;  4J8V D;  1ONG A;  5HAR A;  2XLN A;  1D06 A;  4OOY A;  3A3E A;  2JKG A;  3F1N A;  5B24 B;  2BAS A;  3AZN B;  3IP4 C;  2EX8 A;  3LEL D;  1PRQ A;  2GX5 A;  3FYZ A;  1UR8 A;  1NRF A;  3BFC A;  1IKG A;  1G6O A;  2X02 A;  3MVD C;  1P3M D;  3LJA D;  1CI8 A;  3ZG9 B;  3V67 A;  5AV5 D;  4KZ7 A;  2G5H C;  3CG5 A;  3AV2 A;  1TVF A;  5B33 B;  5FUG B;  1M18 B;  4NZ3 A;  5B32 G;  3Q82 A;  4ETZ A;  4IJF A;  3ZG7 B;  5CP6 C;  5E43 A;  2M1C A;  3CUE A;  2HP5 A;  4GDN A;  2J3T C;  3AGF A;  3N7W A;  4OKP A;  1KS0 A;  5FSR A;  1EW0 A;  1KX4 D;  2M7V A;  1L0G A;  3UB8 A;  2GNX A;  4YNR A;  1P3A D;  1F66 C;  3TU4 D;  2PYO C;  4FCF A;  5G4Y A;  5HFO A;  1ZHH B;  1V9Z A;  2QHK A;  2ZC5 B;  2F8N A;  1YKD A;  4J8V A;  2A49 A;  3U4L P;  4BL2 A;  1KE4 A;  1YLY A;  2JE5 A;  5FAO A;  2YFV A;  3FKW A;  5JA4 B;  4BD1 A;  3LEL A;  1P3G D;  5F1F A;  4IBX A;  4H9N A;  4LRX C;  1GA0 A;  4N1H A;  2RVQ C;  1K54 A;  4GD6 A;  4CJN A;  2Y2K A;  3G30 A;  1NLZ A;  3QP8 A;  1P3M A;  4JXV A;  3NEC A;  3PAE A;  5F1G A;  1U35 C;  5AV5 A;  3AZL D;  1CJF A;  4P0M A;  4X55 A;  3H9W A;  2WGI A;  3H0L C;  5GLA A;  5I94 A;  2YFW A;  5HD3 A;  4KUD D;  3R7W B;  4Z5T C;  3HJI A;  3AZH D;  1TDL A;  3NOP C;  3R4K A;  5B40 A;  5FQM A;  5CPK B;  4MBH A;  4DXB A;  4YS3 C;  5B32 C;  4E3J A;  3W98 B;  5A90 A;  4OPZ A;  4H9O A;  4IJE A;  2V1B A;  3LID A;  1T1C A;  5JYP A;  2FJ7 C;  4EO5 B;  2JSS A;  3MGP B;  3A3F A;  3WWX A;  3RXW A;  3TE8 A;  2Y2I A;  3REI C;  3HUN A;  1ULY A;  4KHA B;  3TU4 A;  3D3O A;  2VV8 A;  3BLS A;  4EET B;  1K25 A;  5GLC A;  3UNW A;  4LV1 A;  3IWO A;  1FSY A;  1PWG A;  4KQD A;  3LFV A;  3NHQ A;  1P3G A;  2PU4 A;  3MNN C;  2QWS A;  3OOV A;  3BYD A;  2EXB A;  4JJN C;  3WS5 A;  3A3I A;  3LZ0 B;  4OPR A;  4KUK A;  4H9S C;  4H9P A;  1JNU A;  2R9X A;  5GL9 A;  4JKT A;  4EEP A;  5TJJ A;  4CQH A;  3AZL A;  1E8B A;  1ID3 D;  3LUQ A;  3AZE B;  2QPN A;  2ZM5 A;  4KUD A;  4OJP A;  3ZHH A;  2HDQ A;  3UT9 B;  4EBL A;  2JCH A;  1P3I C;  3KWQ C;  2ZC7 A;  5B0Y D;  4GS9 B;  3VH6 T;  3REJ B;  4CAY A;  1XGJ A;  3C30 A;  5AQ9 A;  5HDS A;  4WNN A;  1M6K A;  2DQN C;  4WLA A;  5AV8 A;  4WZ5 A;  4C3Q A;  1TZY A;  3VOZ A;  5AVE A;  2OAP 1;  3E98 A;  3LZ1 C;  5EVI C;  4WZ4 A;  2H0Y A;  4K0W A;  3UB6 A;  5B2I C;  3P09 A;  2O0Y A;  5J8X A;  2R9W A;  4LFU A;  5AV6 D;  2V8F A;  4BBV A;  5B1L C;  3ITB A;  3AZJ C;  2HUE B;  4ZBJ B;  3KS4 A;  3WD2 A;  1NJ4 A;  3DTM A;  1OTA A;  5DF9 A;  2PR5 A;  1J3W A;  1O6I A;  2CV5 C;  2JN7 A;  1GHP A;  5HPI A;  2FN2 A;  2VEA A;  1STZ A;  4CLC D;  3REK A;  1PNE A;  3ZCZ A;  4LV3 A;  3AZK B;  3NQJ A;  4I5S A;  3VOL A;  3DW0 A;  4J8U C;  1YLT A;  2GJ3 A;  5MC7 A;  1TD5 A;  4DN0 A;  4L9F A;  4K0X A;  3REH B;  3TOI A;  3KXB B;  1P3P B;  4KZB A;  1Z2C B;  3AZG B;  3JVU A;  4KZ3 A;  1YMX A;  4F3L A;  3WS0 A;  5B0Y A;  3L28 A;  3VH5 T;  4QJG A;  4PM7 A;  4OJO A;  2IA2 A;  3VP3 A;  3B42 A;  3HLB A;  5BNX A;  2ARO D;  2ZQD A;  4KGC B;  4EXO A;  2Y2P A;  2HIO A;  3N8R A;  4WEK A;  3SS5 A;  4JF4 A;  1FR6 A;  1KGG A;  5DVA A;  3UTA B;  3KO6 A;  4UEY A;  3OLO A;  4LRZ E;  3AZI C;  4UA9 A;  5B31 C;  2P74 A;  3CZD A;  4Q0J A;  2Y2J A;  1YLZ A;  2V9A A;  1Y4O A;  4EW7 A;  4XUJ C;  3AYW D;  5FI6 A;  2QJ5 A;  4X23 D;  5KDM A;  3AN2 D;  3PXP A;  1EI5 A;  3W96 D;  4UA7 A;  3K3D A;  5AY8 D;  1Y54 A;  1BUE A;  1K6R A;  4XT2 A;  3HVF A;  4LGW A;  3BQ8 A;  2NUT C;  2XGN A;  1MPL A;  4PKY A;  4J8W D;  1F9I A;  2BTF P;  1VEU A;  3X1S D;  3X1T B;  5A8B A;  3RFB A;  3S7O A;  1LI0 A;  4DKI A;  1KDW A;  4WM9 A;  4JXW A;  4S2N A;  3CJM A;  4B4X A;  4MNR A;  3B0C T;  3X1U D;  3PBT A;  2ARO A;  3QNC A;  4Z2G A;  1E3U D;  1KVL A;  3AV2 C;  1IKI A;  3IBJ A;  5CEC A;  4B9O A;  4RX3 A;  3UB9 A;  2Z2M B;  5FI2 A;  1BSG A;  2HGV A;  1P3L A;  2H0T A;  3IXD A;  4OQG A;  2H5S A;  1DY6 A;  2J3T D;  2P08 A;  4ZDX A;  5E2G A;  4DDY A;  3AV1 B;  1BTL A;  4R8P B;  3V9R B;  3AYW A;  2ZOH A;  2DCF A;  5FQI A;  5GHZ A;  4C75 A;  4X23 A;  3AN2 A;  1LSW A;  3D9Y A;  3A1K A;  3C1C A;  2HV1 A;  4E04 A;  2K7S A;  2CC1 A;  3NQU B;  4HY8 A;  2HJ9 C;  1J9M A;  4Q0H A;  5AY8 A;  5CPJ B;  5AV9 B;  2W1T A;  3C7U A;  1BT5 A;  4QB8 A;  4J8V C;  3SOI A;  1K56 D;  4J8W A;  5AQ7 A;  2W1R A;  5M1A A;  3X1S A;  3LEL C;  5D3O A;  3WAA B;  3AZN D;  1P9W A;  2Y91 A;  3E4Q A;  2RVQ D;  1IFQ A;  2J3W A;  3L2A A;  1K54 C;  5HX9 A;  2NUP C;  3AFA B;  1SHV A;  5TBM B;  1P3M C;  3X1U A;  2XH9 A;  4XZQ A;  4GOG A;  5AV5 C;  4X1L A;  1E3U A;  5TGF A;  2ZY3 A;  2WUQ A;  1SKF A;  3ZVT A;  5F69 A;  3UE3 A;  1W1T A;  5B33 D;  1M18 D;  3L9K A;  3FPV A;  2LB9 A;  3IQA A;  3H7W B;  5GLB A;  3IX8 A;  5DJT A;  2B95 A;  4NE5 A;  4X56 A;  2LY8 A;  5B1M B;  3C38 A;  3ZYT A;  1N9B A;  1YAX A;  3WKJ D;  4JXG A;  1P3A C;  5FAT A;  3TU4 C;  3AZF B;  3A3D A;  2Z6C A;  4Y0U A;  1ACF A;  2FZ0 A;  4ME4 A;  1LT0 A;  1YM1 A;  5HD5 A;  1PWD A;  3M6B A;  3W4P A;  2Y2O A;  5B24 A;  1P3G C;  4JJN D;  3MZF A;  5E2E A;  4G91 B;  4GLQ A;  3NC8 A;  3AZN A;  4GB7 A;  3G6O A;  2X01 A;  5E5A B;  5K5B A;  3CHW P;  5KIZ A;  3C4O A;  1S66 L;  3AZL C;  2OSU A;  1ED7 A;  4WYY A;  1ERO A;  3PR6 A;  2IWC A;  1NYM A;  3MGQ B;  3LR4 A;  5A92 A;  4JPM A;  4AWL C;  5L07 A;  5B33 A;  4WF0 A;  4S2I A;  4KUD C;  5FUG A;  2ZMV A;  4H8R A;  1P3I D;  1M18 A;  2WK0 A;  4B4Z A;  3O86 A;  5BO0 B;  4P87 A;  4DF6 A;  4E45 A;  2H28 A;  5CEB A;  2J7V A;  3HLG A;  4PPR A;  2OLV A;  4IUK A;  1HQ3 D;  3W98 D;  1VQQ A;  3EGD C;  4WZ5 C;  1BLH A;  5GSU B;  1K4F A;  1XP4 A;  1N9N A;  5B2I D;  2PAV P;  5EV0 A;  1JTG A;  4NEE D;  1OTD A;  2NQB B;  4GZB A;  1P3F B;  1IOU A;  4E3L A;  4Z2J A;  3FKE A;  3KYE A;  4PKY G;  5JA4 A;  4J8X B;  4Z2M G;  4OQI A;  2BYK B;  4P6Z S;  4HH2 A;  3LZ0 D;  5HWW A;  3VE3 A;  3QP2 A;  4ARZ B;  4NE6 A;  2BG1 A;  1ZC2 A;  4L0L A;  3IXB A;  3W97 B;  3BM6 A;  3UY6 A;  3PBQ A;  3M2J A;  3IF6 C;  3L7H A;  3PHY A;  4KQQ A;  5EM1 A;  3R7W A;  5B0Y C;  3KUY B;  2BYM B;  3UT9 D;  1P3K D;  5JRG D;  5CPK A;  3OC2 A;  4KZ6 A;  3PBS A;  1HQ3 A;  3W98 A;  2HIO C;  3DAV A;  4LV2 A;  5L2F A;  1P3B B;  4QU3 A;  3OPP A;  3MGP A;  4OON A;  5DNN B;  1FIL A;  5GHY A;  3VP4 A;  5CED A;  3Q07 A;  1R4V A;  4KHA A;  5F99 B;  2ZBB A;  3MR0 A;  2VGJ A;  1K4E A;  4KZA A;  4KZ5 A;  3F1O A;  4KG6 A;  3QNB A;  4R3B A;  3L27 A;  2M7U A;  1OPX A;  3T4T A;  1ERM A;  3SW1 A;  3S7N A;  1MXO A;  3AZM B;  5FA7 A;  4U3T A;  4HNB A;  3OPR A;  2X71 A;  4JGR A;  1CEG A;  1SCW A;  2KX6 A;  4R6L A;  3LZ0 A;  2ACG A;  4Z66 B;  3LR3 A;  3T12 B;  3MS6 A;  1M40 A;  1K6S A;  1XXM A;  4R23 A;  3AZK D;  3IS2 B;  2A2L A;  4S2O A;  2XD5 A;  2W8S A;  1BLC A;  3AZE A;  2WKE A;  1VET B;  4HIA A;  5DTT A;  4OPQ A;  1P3O B;  4UA6 A;  3KXB D;  4S2N C;  4IBJ A;  3UT9 A;  4MB3 A;  3B6F B;  1H3Q A;  1MWR A;  5JRG A;  2VQR A;  4WN5 A;  1SDN A;  2ARO C;  4GS9 A;  3AV2 D;  2A3U A;  3GSG A;  3EPL A;  2K31 A;  4IED A;  1S32 D;  1N9O A;  5FAP A;  3DWK A;  3KSH A;  3MZD A;  2XA7 S;  2OOL A;  1W7F A;  1XFQ A;  3B47 A;  3OBF A;  3MVD B;  2VGL S;  3MZE A;  5BOH A;  3EPK A;  3AYW C;  4NK3 A;  3OPL A;  4EER A;  1P97 A;  3B6G B;  4X23 C;  3AN2 C;  4S2L A;  5CP6 B;  3V50 A;  1BH9 B;  1H8Y A;  1I2S A;  4NXG A;  2PR6 A;  5AVC B;  3G2Y A;  5AY8 C;  1E4D A;  3REL B;  4OOL A;  3H0R C;  3L25 A;  3C8C A;  3MGS B;  4J8W C;  1YU4 A;  1S4R A;  3M7P A;  3AZK A;  2B5R A;  1F66 B;  3WX7 A;  3X1S C;  2O9B A;  3G2Z A;  3A1I A;  2XEP A;  3REH A;  4Y2F A;  1F98 A;  1SKO B;  3KXB A;  1P3P A;  2WAD A;  5GXQ B;  2IWB A;  3AZG A;  5CTN A;  4DE0 A;  1FCN A;  1LL9 A;  2EX9 A;  4R4S A;  4HGA B;  3X1U C;  1XJ6 A;  4XZQ C;  5FQ9 A;  1ZLA B;  3ICY A;  5DF8 A;  1S32 A;  3ZGA B;  3GDI A;  1FR1 A;  4KGC A;  1YUE A;  3VH5 A;  3QP4 A;  3D72 A;  2IO5 C;  5HPF A;  5B40 D;  1DRM A;  3LI8 A;  1G68 A;  1YLJ A;  3TJZ C;  4YIN A;  2H10 A;  1N4O A;  3NDG A;  3PAG A;  2XK1 A;  4OLD A;  4FH4 A;  1S1Y A;  2ZL1 B;  1NLY A;  1YU1 A;  4HJ4 A;  2WGV A;  4PM5 A;  1PI5 A;  3GRJ A;  3WA9 B;  1YLW A;  2WAE A;  2VX8 A;  4LRY C;  1TAF B;  2G5I C;  1UGU A;  2HJE A;  3E4O A;  2C6W B;  5L10 A;  5CPJ D;  5AV9 D;  3PBR A;  3TSG A;  5AQB A;  2A24 A;  5DFX A;  5F5Y A;  5TFQ A;  4UQI S;  5BPV A;  3FDD A;  3AZN C;  1MWU A;  3X1T A;  3MBZ A;  2L1M A;  1S6R A;  2Y79 A;  4BLM A;  3X1V B;  3Q1F A;  1EWZ A;  4FUW A;  3AFA D;  4QY6 A;  3C7V A;  3MMH A;  3MNN B;  1DJB A;  1KX5 B;  5B33 C;  4OJ6 A;  4K08 A;  3SH8 A;  1M18 C;  1CK3 A;  5CHJ A;  4DXC A;  3WD3 A;  2E8I A;  4E3K A;  3NI9 A;  1A0K A;  1ES2 A;  3IX4 A;  2F8N H;  3K3C A;  4N1X A;  3AV1 A;  4R8P A;  3V9R A;  1L3L A;  5AV8 D;  4H9R B;  1CEF A;  1TZY D;  4I3A A;  2XFS A;  2PDR A;  3CIT A;  3WKJ C;  1JWV A;  5B1M D;  3KWQ B;  1KGE A;  4U0X A;  5G18 A;  3S22 A;  2HP9 A;  3UO9 A;  1CI9 A;  1M1A B;  4KG2 A;  2BLS A;  3NQU A;  3WTP B;  5CPJ A;  1I5Q A;  1C3B A;  1E6Z A;  5AV9 A;  1HLU P;  1WYC A;  2QZ6 A;  3LZ1 B;  3KYQ A;  2WKP A;  1O07 A;  2JKR M;  1YQS A;  1HVB A;  3BEB A;  4WJ3 C;  3REK D;  1EQZ B;  4UAA A;  5EFW A;  4MCW A;  2XSS A;  2JKT M;  3SH9 A;  5FQJ A;  3AFA A;  5HAQ A;  5E5A D;  5TBM A;  3TG9 A;  3FKV A;  5GT0 B;  1H0M A;  1Q2P A;  4G3W A;  4GD8 A;  3MGQ D;  4Z2K A;  3T1X A;  2L5A A;  4DRB A;  3N6I A;  4NZ1 A;  3O87 A;  2KDK A;  1U60 A;  1GSV A;  4EES A;  4HOI A;  1W1V A;  3BFF A;  5CPK C;  2ZQ9 A;  1HQ3 C;  3W98 C;  2HIO D;  3H7W A;  5FAS A;  5IS1 A;  1B6W A;  2C5W B;  3WRZ A;  4XXR A;  2VA0 A;  3ZVW A;  4EO5 C;  3MGP C;  4BJP A;  5B1M A;  4BBT A;  3NUL A;  4Z9Q A;  2XD1 A;  5GSU D;  3AZF A;  2P9V A;  1MWT A;  1S67 L;  2ZM2 A;  3C1B B;  4GHI B;  1VHM A;  3A6N B;  3HUO A;  3AZI B;  1P3F D;  1N1J B;  3LR0 A;  4XUJ B;  4OJL A;  1TDG A;  4R1G A;  2PT7 A;  1M19 B;  4IUH A;  3T4S A;  3LZ0 C;  4J8X D;  5GLD A;  5E5A A;  4UUZ B;  3IXG A;  5G4Z A;  4ETX A;  4JXS A;  3MGQ A;  4H6J B;  3AZE C;  1E6N A;  5IHV A;  4ZUX B;  3UT9 C;  1P3K C;  4I3I A;  5JRG C;  2VKS A;  1OGB A;  5BO0 A;  3EQU A;  1RP5 A;  3KSI A;  3MKE A;  5EPH A;  3UE0 A;  3W99 B;  3LIA A;  4RVA A;  5AVB B;  4Y7P A;  4S2M A;  3KSY A;  5HWV A;  1OT6 A;  1CK7 A;  1BUL A;  2Y4A A;  1PWC A;  4MBF A;  1P3B D;  1P3L D;  2WKQ A;  4HMC A;  5DNN D;  5GSU A;  3ZFZ A;  1XGI A;  4PM6 A;  1H3O B;  4P6Z M;  5F99 D;  1LSV A;  3MQ0 A;  5B2J B;  1BH8 B;  1UWN X;  3C1C D;  1P3F A;  5BT1 D;  4GKU A;  2HUE C;  4ZBJ C;  3G34 A;  4DJ2 A;  2PBY A;  1CQA A;  2WZZ A;  3NCK A;  5A91 A;  4NXB A;  4J8X A;  3EEH A;  5EOE A;  2BYK A;  3IX3 A;  3PYP A;  1IEM A;  2Y2N A;  4IBG A;  3AZK C;  3VH6 W;  4Z66 D;  4NG2 A;  3VFH A;  3VV4 A;  1XX2 A;  3BFG A;  2F8N B;  1OJ5 A;  5J4E A;  3W97 A;  4IBB A;  4JF5 A;  3KXB C;  1P3P C;  5GHX A;  2FFF B;  3AZG C;  1JVJ A;  3M2K A;  4EV4 A;  2P7J A;  1WA9 A;  1L0E A;  4XZQ D;  2VK3 A;  2WKR A;  4XUX A;  2Y8H A;  3V39 A;  3KUY A;  2BYM A;  3B6F D;  4Y0O A;  3LEL B;  3A3J A;  3KYZ A;  1S32 C;  4BQM A;  3MXR A;  3OZH A;  5BNV B;  1KGF A;  1P3B A;  1JFI A;  3GR2 A;  3HBR A;  5DNN A;  1P3M B;  3LJA B;  3CUE C;  1K38 A;  3D4F A;  4JGP A;  5DTK A;  5GT3 B;  3VP0 A;  4OQ0 A;  2W27 A;  5F99 A;  1LHY A;  4Z2M H;  3BY9 A;  4KQO A;  5CXW A;  3B6G D;  2ZQA A;  4Y3I A;  4U0T A;  3OPH A;  4FSF A;  4R4R A;  3AZM A;  2J9P A;  1WWI A;  2VZW A;  2UWX A;  4R0Q A;  1KX4 B;  5AVC D;  5G49 B;  4NKP A;  3CAX A;  5HWT A;  5AQA A;  5L8M A;  3T4J A;  3REL D;  3VH5 W;  3JVV A;  1P3A B;  2NZD B;  4Z66 A;  4LG2 A;  3MGS D;  1AWI A;  1TEM A;  5B24 D;  1BLS A;  3IS2 A;  2PYR A;  3GQZ A;  2XA7 M;  3X1T C;  1UR9 A;  3V5M A;  4D2O A;  1VET A;  2VGL M;  3UB5 P;  1P3O A;  4GNU A;  5GXQ D;  3H82 B;  3B6F A;  5DNM B;  2KLI A;  3Q7Z A;  3B0D B;  1KDS A;  2VV7 A;  1AOI B;  5B40 C;  1ES3 A;  4YFM A;  1PI4 A;  4MN7 A;  2I9V A;  1WE4 A;  2ZMA A;  5CGS A;  3MKF A;  3OCN A;  3MVD A;  2Y55 A;  2J80 A;  1XFN A;  4II7 A;  2W0N A;  3UPO A;  2VV6 A;  4Q8I A;  2ZM0 A;  5FQK A;  3EEA A;  3AV1 C;  3GV9 A;  4AWL B;  4R8P C;  5DFY A;  3AZH B;  3B6G A;  3AGE A;  5HAP A;  3UE6 A;  5E2F A;  1GSX A;  3IH9 A;  1W2E A;  5CP6 A;  3WA9 D;  1BH9 A;  4OP8 A;  4FOF A;  4WEL A;  1FSW A;  4QWO A;  4M4X A;  1W63 M;  5AVC A;  3LYX A;  5CPJ C;  4K91 A;  4HH3 A;  5AV9 C;  3REL A;  3MFX A;  3G4P A;  3B0C W;  2VJW A;  1RGZ A;  3MGS A;  1UWP X;  1K0K A;  4HES A;  2W3E A;  4IHQ A;  2EX6 A;  1GXD A;  1F66 A;  3FV7 A;  3BJN A;  5EM0 A;  1ESI A;  1IYO A;  1SKO A;  4IBF A;  5GXQ A;  3AFA C;  2IOU A;  4CSR B;  1PDC A;  4NXF A;  2XQZ A;  4MMN A;  1ZLA A;  1PIO A;  1Q9C A;  3ZG5 A;  3NJA A;  1KX3 B;  3OCL A;  4EQ1 A;  1JTD A;  1KX5 D;  1NWZ A;  4ZRR A;  4WZS B;  5CPK D;  1ID3 B;  1D1J A;  2HDU A;  4ESP A;  3F6T A;  3RJU A;  3ZDJ A;  5AV8 C;  2ZLY A;  2ZL1 A;  1TZY C;  3MGP D;  4JLF A;  3VSL A;  4BEN A;  3IF6 B;  5CHL B;  5B1M C;  4F3L B;  3B0B A;  3WA9 A;  4UQI M;  5BNX B;  1TAF A;  4R70 A;  1M1A D;  5F83 A;  5FDH A;  3AZF C;  1IYQ A;  1XKZ A;  3KSG A;  3HJK A;  1H5X A;  4MN5 A;  4H9Q B;  1PZO A;  3WTP D;  1XJ3 A;  2ZQC A;  5HL1 A;  2XRN A;  4G92 B;  4QLC B;  3K2N A;  3O5Y A;  1O7E A;  1DJC A;  3GTC A;  3HUM A;  1T3U A;  3UN7 A;  5AV6 B;  4YM6 B;  2PRF A;  3BW6 A;  4IVI A;  4JF6 A;  5E2H A;  3REK C;  4G91 C;  2HZ5 A;  1JWZ A;  4KZ8 A;  3W4Q A;  4HP4 A;  1E6P A;  4GW9 A;  5DKK A;  1EQZ D;  5E5A C;  5IT5 A;  3X1V A;  3MGR B;  5IU1 A;  3IWI A;  4NET A;  3AZE D;  3MGQ C;  4NE3 A;  1ES5 A;  4CLC B;  1KX5 A;  1G28 A;  4LD9 B;  4NXE A;  3ZQ5 A;  1P34 B;  3NIA A;  4NZ4 A;  5TR7 A;  3REJ D;  2OLU A;  2ZY2 A;  5DJU A;  1T1A A;  5KSH A;  4H9R A;  4DJ3 A;  2EFU A;  5L09 A;  3MQL A;  1N9L A;  5CPI B;  3E2L A;  3HL9 A;  2WYX A;  3LGO A;  1OGG A;  2ZJ9 A;  5GSU C;  3HRE A;  5J7E A;  4MBK A;  1OME A;  3P5J B;  1M1A A;  2Y2M A;  5CHM A;  1P9R A;  3T4K A;  1KE3 A;  3IHB A;  3NOU C;  1YSP A;  2Y59 A;  3WTP A;  4GHA A;  4F94 A;  3AL0 C;  3C1B D;  3O62 B;  4GCZ A;  1P3F C;  1VM1 A;  4RX2 A;  4DE1 A;  4E6X A;  3LZ1 A;  4Y0T A;  4X1M A;  5BS7 A;  3SZT A;  4WU9 B;  2OAQ 1;  4PM8 A;  4B93 A;  4CPK A;  3UTB B;  2XRO A;  3BFD A;  4PMA A;  4WU8 B;  1CXW A;  1D7E A;  1T19 A;  4J8X C;  3W2Z A;  1EQZ A;  2JC7 A;  3LEZ A;  1M19 D;  3T1S A;  3G31 A;  4RA7 A;  2Y2H A;  3R45 B;  4Y15 A;  3W96 B;  4C6Y A;  1XJ4 A;  3PTE A;  3G35 A;  2ZM8 A;  3REH D;  4I38 A;  5GT0 A;  5B0Z B;  4L9G A;  1P3P D;  3VSK A;  5M18 A;  3AZG D;  3NDE A;  1H8M A;  5C3I C;  2YKH A;  1AIW A;  4ZUX D;  3NY4 A;  4NY2 A;  1MZU A;  4DRA A;  3REJ A;  1DJA A;  4KGC D;  2KOI A;  3U2A A;  4IBE A;  1FIK A;  3VH6 A;  2XR0 A;  3T4L A;  2ZD8 A;  3T50 A;  5CX7 A;  3UTA D;  1P3B C;  4KEN B;  1ZTU A;  1P3L C;  3WS2 A;  5DNN C;  5FEG A;  2JKR I;  2G2U A;  4DDS A;  1YU3 A;  5FQQ A;  3EGX C;  3P7N A;  5F99 C;  4S2P A;  2IO5 B;  4ZAM A;  2JKT I;  4HQA A;  3C1B A;  3C1C C;  4GHI A;  4DE2 A;  4M6B A;  5B2J D;  2CMN A;  5BT1 C;  3A6N A;  1W8Q A;  2L0W A;  4X6T A;  3VP2 A;  4IBD A;  1N1J A;  1Z09 A;  5F6A A;  4XUJ A;  3EWK A;  4N92 A;  1M19 A;  3LCE A;  2PYO B;  1H8P A;  4Z66 C;  1LL8 A;  1ONH A;  4X25 A;  3Q7V B;  4UUZ A;  1XJ2 A;  3WRT A;  3V3R A;  3EG5 B;  3X1T D;  3CPT B;  4H6J A;  3CWF A;  1P3O C;  4BBU A;  4ZUX A;  5F82 A;  2PD8 A;  1LSX A;  1NXY A;  1TS8 A;  3B6F C;  3LIF A;  2HDS A;  3A0V A;  4WMC A;  1HZO A;  1TS0 A;  3QP6 A;  2DMW A;  3W99 A;  4GN2 A;  5C5K A;  3UTA A;  5AVB A;  2Z6D A;  1U35 B;  3LR5 A;  4MB5 A;  4MDZ A;  3A0S A;  4IBK A;  2D02 A;  5GT3 D;  3AV1 D;  4R8P D;  4Z5T B;  1H3O A;  2R78 A;  2W3H A;  3B6G C;  5B2J A;  2V1Z A;  5DTS A;  1BH8 A;  4YS3 B;  5B32 B;  3RXX A;  5JYO A;  1YT4 A;  3VMA A;  3LY3 A;  2FJ7 B;  1JWP A;  3UME A;  5AVC C;  1ZG4 A;  4EWF A;  3REL C;  3REI B;  3IHA A;  4WBG A;  1BZA A;  3WKJ B;  3MGS C;  5B24 C;  4LPZ A;  3PBO A;  2NZD D;  4N9K A;  3Q81 A;  5AJG A;  2CWE A;  1FCO A;  1XA1 A;  4DE3 A;  3WAA D;  3LIC A;  2O99 A;  5EOO A;  4EEU A;  3VP1 A;  1DP8 A;  4OLG A;  5GXQ C;  1PZR A;  1HD8 A;  3NBL A;  3T4O A;  4HGA C;  5EE8 A;  2ZY4 A;  4JJN B;  1ZLA C;  4O01 A;  5DNM D;  2W3F A;  4GDB A;  1SDE A;  3SH7 A;  1AOI D;  5BNV A;  2Y2L A;  3LJA A;  5HDC A;  5GT3 A;  3WS1 A;  1H8Z A;  5HL6 A;  4OP5 A;  3HSH A;  4FTX A;  1TF1 A;  1BFM A;  1P3I B;  2ZC4 B;  4E3M A;  4JGQ A;  3UE1 A;  3M6H A;  3MQO A;  3WA9 C;  3MXQ A;  3AZF D;  1HQ3 B; 
#chains in the Genus database with same CATH homology
 4NZ5 A;  1KX4 A;  5G49 A;  5EVI B;  1W5D A;  4IBI A;  3WTP E;  2J8Y A;  5B2I B;  1P3A A;  2NZD A;  2Y2Q A;  4A5R A;  5B1L B;  3WAA A;  3AZJ B;  3L29 A;  3FWL A;  2EXA A;  2DNS A;  1IYP A;  3DWZ A;  1XPB A;  3X1V C;  4FD8 A;  1BLP A;  2CV5 B;  5DNM A;  3SS4 A;  5CGX A;  1GA9 A;  4EUZ A;  1KX5 C;  1KX3 D;  1AOI A;  4J8U B;  4ZJ2 A;  2EFX A;  2WGW B;  4NYU A;  3ITA A;  4OPY A;  3VFF A;  2F2A C;  4OOM A;  4LV0 A;  4OJ5 A;  4PM9 A;  3AZH A;  1PW8 A;  3P98 A;  5U47 A;  1P3K B;  1K57 A;  5JRG B;  2V2F F;  1KE0 A;  1M1A C;  3UDI A;  2NQB D;  3JYI A;  1FCM A;  3WTP C;  5B31 G;  5B31 B;  3SS3 A;  3PBN A;  2IWD A;  5BS7 C;  1FQG A;  1Z6F A;  4QLC D;  4YM6 D;  3I7J A;  1EQZ C;  5KSC A;  1F1E A;  1YLP A;  2ZC3 B;  4CSR A;  5CTM A;  3MGR D;  5GT0 C;  3W97 D;  2RIQ A;  1KX3 A;  3KUY D;  4LD9 D;  1P34 D;  4E3O A;  1NZU A;  4R3J A;  3REJ C;  3HLD A;  1ID3 A;  2DRW A;  3BRM A;  4LEN A;  4M3K A;  4QHC A;  3ISG A;  4FH2 A;  3IF6 A;  3IF5 A;  4KZ9 A;  4ZJ3 A;  5CPI D;  1QME A;  3S4X A;  3HON A;  3AV2 B;  2V20 A;  1WWS A;  2OV5 A;  1S32 B;  2NQB A;  3N8S A;  3C1B C;  2HPB A;  4H9Q A;  2J9O A;  1E25 A;  3A6N C;  4EBN A;  3O62 D;  3AZM D;  4QLC A;  2GDN A;  3IWQ A;  4WU9 D;  1KVM A;  4S2J A;  3UTB D;  5AV6 A;  4YM6 A;  3ZG8 B;  4O7D A;  4B88 A;  5HW3 A;  4WU8 D;  5FI7 A;  1M19 C;  3L26 A;  4WV4 B;  1A7W A;  2WZX A;  2F8N G;  3KFU G;  3MGR A;  3REH C;  1MBL A;  4OH0 A;  4J8V B;  1ESU A;  1P3O D;  5B0Z D;  1AXB A;  2YFV B;  4ZUX C;  4LD9 A;  1P34 A;  3B3X A;  4BD0 A;  2Z2L B;  4KGC C;  4H9N B;  3W99 C;  3WS4 A;  3UTA C;  5AVB C;  4E44 A;  1MKI A;  3VOY A;  4DQY B;  2ZQ8 A;  5AV5 B;  3MVD D;  5CPI A;  1KU5 A;  1GCE A;  2YFW B;  3MXS A;  5B40 B;  4QD4 A;  4WEJ A;  5B2J C;  1ZG6 A;  4JBF A;  5CP6 D;  3O62 A;  4H9O B;  1FOF A;  4WU9 A;  1W8Y A;  3UTB A;  4N9L A;  4WU8 A;  3LO7 A;  1XA7 A;  3HLF A;  5EEC A;  2Q9N A;  3TU4 B;  1LLB A;  3LY4 A;  3FZC A;  4GH9 A;  1F66 D;  2PYO D;  3R45 A;  3W96 A;  1K55 A;  5B0Z A;  1NZO A;  5DF7 A;  3MFD A;  4HBU A;  2J8P A;  4OVD A;  1P3G B;  4XUZ A;  1ZLA D;  4NFT A;  3O88 A;  1HTZ A;  4H9P B;  4BL3 A;  3N3F A;  4EQI A;  2HP6 A;  2RCX A;  4E6W A;  3AZL B;  1W79 A;  4OUI A;  1L2S A;  1PW1 A;  3LJA C;  1U35 D;  5GT3 C;  4KUD B;  4UHU A;  4Z5T D;  3IT9 A;  2XDM A;  2XF3 A;  4LCL A;  4CAY B;  4YS3 D;  5B32 D;  4KG5 A;  4WNN B;  2WAF A;  4S2K A;  5AV8 B;  2FJ7 D;  5CHU A;  1TZY B;  1KX4 C;  2QMI A;  3REI D;  2I72 A;  2PYO A;  2NZD C;  3Q7V A;  4QY5 A;  5EUA A;  2P9V B;  1ERQ A;  3E2K A;  5EVL A;  3UPN A;  3WAA C;  2XFT A;  4DRT A;  4EBP A;  1LI9 A;  2G2W A;  3X1V D;  1K56 A;  1G6A A;  2ZC6 B;  3N8L A;  4IVK A;  5DNM C;  3MNN D;  3GMW A;  3B0D C;  2HDR A;  3REK B;  1AOI C;  3NQJ B;  3IH8 A;  5KZH A;  3EPJ A;  5A93 A;  1ZKJ A;  1U35 A;  3BFE A;  5KMW A;  4KQR A;  4P6B A;  4Z5T A;  5B0Y B;  1L0D A;  1QMF A;  2EX2 A;  4X53 A;  3AZH C;  1RGY A;  1IYS A;  4IBR A;  1K57 C;  3KWQ D;  3CMZ A;  4YS3 A;  5B32 A;  3IXH A;  4HBT A;  2HIO B;  1IEL A;  3C5A A;  2FJ7 A;  1PZP A;  1HTA A;  3BLM A;  1L0F A;  3REI A;  3LZ1 D;  2DF4 C;  2RL3 A;  5EVI D;  3WKJ A;  3S1Y A;  2F8N K;  4MLL A;  5KDM B;  4P85 A;  5B1L D;  3C4P A;  3AZJ D;  2JBF A;  2VGK A;  4GHL A;  1GHM A;  1LL5 A;  3QHY A;  3MNN A;  3EPH A;  5GT0 D;  4JJN A;  2CV5 D;  1NY0 A;  3O3V A;  4H9S A;  4HEF A;  1KX3 C;  1I2W A;  3V3S A;  5M19 A;  4J8U D;  1ID3 C;  3ZNY A;  3BEC A;  1GHI A;  3UDX A;  3HLE A;  1P3I A;  5C3I B;  4LCM A;  3KWQ A;  2ARO B;  1B67 A;  1MWS A;  4X68 A;  1MY8 A;  1YMS A;  4ZBE A;  2NQB C;  2Q9M A;  4UPK A;  1JFI B;  4NYY A;  1P3L B;  3A6N D;  5EVI A;  3AZI D;  5B31 D;  2WKI A;  3GVB A;  5B2I A;  2WKH A;  4G92 C;  3AYW B;  4QLC C;  4XUJ D;  4X23 B;  3AN2 B;  5AV6 C;  4YM6 C;  5B1L A;  5CGW A;  2FFY A;  3AZJ A;  3C1C B;  4IBC A;  5FAQ A;  2PU2 A;  5AY8 B;  3G32 A;  3MGR C;  2CV5 A;  4RYE A;  3W97 C;  3HLC A;  1ES4 A;  4ZJ1 A;  4J8W B;  3W4O A;  3ZG0 A;  3KUY C;  4LD9 C;  4J8U A;  1PYY A;  1RCJ A;  3X1S B;  1P34 C;  5CRF A;  2WGW A;  4WMC D;  3W99 D;  3AGD A;  1Q2Q A;  5AVB D;  2ZQ7 A;  4E3I A;  3X1U B;  4XZQ B;  5CPI C;  1P3K A;  4X69 A;  3UPP A;  3EQV A;  3ZNT A;  4KZ4 A;  5CER A;  4E3N A;  1YU0 A;  3N4I A;  4ID4 A;  1NYY A;  3AZI A;  5B31 A;  3HLW A;  3O62 C;  3AZM C;  1ALQ A;  4MEZ A;  4WU9 C;  1S0W A;  3H0M C;  3UTB C;  2ZY5 A;  1YU2 A;  4WU8 C;  4ZTK A;  5HAI A;  1WYB A;  4QNL A;  4OQH A;  3KS8 A;  2Y2G A;  3W96 C;  3UDF A;  3W8K A;  1K55 C;  2F8N D;  5B0Z C;  4J8V D;  1ONG A;  5HAR A;  2XLN A;  4OOY A;  3A3E A;  5B24 B;  3AZN B;  3IP4 C;  2EX8 A;  3LEL D;  3FYZ A;  1NRF A;  3BFC A;  1IKG A;  2X02 A;  3MVD C;  1P3M D;  3LJA D;  1CI8 A;  3ZG9 B;  5AV5 D;  4KZ7 A;  2G5H C;  3CG5 A;  3AV2 A;  1TVF A;  5B33 B;  5FUG B;  1M18 B;  4NZ3 A;  5B32 G;  3Q82 A;  4IJF A;  3ZG7 B;  5CP6 C;  5E43 A;  2HP5 A;  4GDN A;  3AGF A;  3N7W A;  4OKP A;  5FSR A;  1KX4 D;  1L0G A;  1P3A D;  1F66 C;  3TU4 D;  2PYO C;  4FCF A;  5HFO A;  2ZC5 B;  2F8N A;  4J8V A;  2A49 A;  4BL2 A;  1KE4 A;  1YLY A;  2JE5 A;  5FAO A;  2YFV A;  3FKW A;  5JA4 B;  4BD1 A;  3LEL A;  1P3G D;  5F1F A;  4IBX A;  4H9N A;  1GA0 A;  4N1H A;  2RVQ C;  1K54 A;  4GD6 A;  4CJN A;  2Y2K A;  3G30 A;  1P3M A;  4JXV A;  3PAE A;  5F1G A;  1U35 C;  5AV5 A;  3AZL D;  4P0M A;  4X55 A;  2WGI A;  3H0L C;  5GLA A;  5I94 A;  2YFW A;  4KUD D;  4Z5T C;  3AZH D;  1TDL A;  5FQM A;  5B40 A;  5CPK B;  4MBH A;  4DXB A;  4YS3 C;  5B32 C;  4E3J A;  3W98 B;  5A90 A;  4OPZ A;  4H9O A;  4IJE A;  5JYP A;  2FJ7 C;  4EO5 B;  2JSS A;  3MGP B;  3A3F A;  3WWX A;  3RXW A;  2Y2I A;  3REI C;  3HUN A;  1ULY A;  4KHA B;  3TU4 A;  3BLS A;  1K25 A;  5GLC A;  3UNW A;  4LV1 A;  3IWO A;  1FSY A;  1PWG A;  1P3G A;  2PU4 A;  3MNN C;  3BYD A;  2EXB A;  4JJN C;  3WS5 A;  3A3I A;  3LZ0 B;  4OPR A;  4H9S C;  4H9P A;  2R9X A;  5GL9 A;  4JKT A;  3AZL A;  1ID3 D;  3AZE B;  2QPN A;  2ZM5 A;  4KUD A;  4OJP A;  3ZHH A;  2HDQ A;  3UT9 B;  4EBL A;  2JCH A;  1P3I C;  3KWQ C;  2ZC7 A;  5B0Y D;  3VH6 T;  3REJ B;  4CAY A;  1XGJ A;  5AQ9 A;  4WNN A;  1M6K A;  2DQN C;  5AV8 A;  4WZ5 A;  4C3Q A;  1TZY A;  3VOZ A;  3LZ1 C;  5EVI C;  4WZ4 A;  2H0Y A;  4K0W A;  5B2I C;  3P09 A;  5J8X A;  2R9W A;  5AV6 D;  5B1L C;  3ITB A;  3AZJ C;  2HUE B;  4ZBJ B;  3KS4 A;  1NJ4 A;  3DTM A;  5DF9 A;  2CV5 C;  1GHP A;  3REK A;  3ZCZ A;  4LV3 A;  3AZK B;  3NQJ A;  3DW0 A;  4J8U C;  1YLT A;  4K0X A;  3REH B;  3TOI A;  3KXB B;  1P3P B;  4KZB A;  1Z2C B;  3AZG B;  4KZ3 A;  1YMX A;  3WS0 A;  5B0Y A;  3L28 A;  3VH5 T;  4QJG A;  4PM7 A;  4OJO A;  3VP3 A;  3HLB A;  5BNX A;  2ARO D;  2ZQD A;  4KGC B;  2Y2P A;  2HIO A;  3N8R A;  4WEK A;  3SS5 A;  4JF4 A;  1FR6 A;  1KGG A;  5DVA A;  3UTA B;  3AZI C;  4UA9 A;  5B31 C;  2P74 A;  3CZD A;  2Y2J A;  1YLZ A;  4XUJ C;  3AYW D;  5FI6 A;  4X23 D;  5KDM A;  3AN2 D;  1EI5 A;  3W96 D;  4UA7 A;  5AY8 D;  1Y54 A;  1BUE A;  1K6R A;  3HVF A;  2XGN A;  1MPL A;  4J8W D;  3X1S D;  3X1T B;  1LI0 A;  4DKI A;  1KDW A;  4WM9 A;  4JXW A;  4S2N A;  3CJM A;  4B4X A;  4MNR A;  3B0C T;  3X1U D;  3PBT A;  2ARO A;  3QNC A;  1E3U D;  1KVL A;  3AV2 C;  1IKI A;  5CEC A;  4RX3 A;  2Z2M B;  5FI2 A;  1BSG A;  1P3L A;  2H0T A;  3IXD A;  4OQG A;  2H5S A;  1DY6 A;  4ZDX A;  5E2G A;  4DDY A;  3AV1 B;  1BTL A;  4R8P B;  3V9R B;  3AYW A;  2DCF A;  5FQI A;  5GHZ A;  4C75 A;  4X23 A;  3AN2 A;  3A1K A;  3C1C A;  2CC1 A;  3NQU B;  1J9M A;  5AY8 A;  5CPJ B;  5AV9 B;  3C7U A;  1BT5 A;  4QB8 A;  4J8V C;  3SOI A;  1K56 D;  4J8W A;  5AQ7 A;  5M1A A;  3X1S A;  3LEL C;  5D3O A;  3WAA B;  3AZN D;  2Y91 A;  2RVQ D;  3L2A A;  1K54 C;  5HX9 A;  3AFA B;  1SHV A;  1P3M C;  3X1U A;  2XH9 A;  4XZQ A;  4GOG A;  5AV5 C;  5TGF A;  1E3U A;  2ZY3 A;  2WUQ A;  1SKF A;  3ZVT A;  3UE3 A;  5B33 D;  1M18 D;  3IQA A;  5GLB A;  4NE5 A;  4X56 A;  2LY8 A;  5B1M B;  1N9B A;  4JXG A;  3WKJ D;  1P3A C;  5FAT A;  3TU4 C;  3AZF B;  3A3D A;  4Y0U A;  1YM1 A;  1PWD A;  3M6B A;  3W4P A;  2Y2O A;  5B24 A;  1P3G C;  4JJN D;  3MZF A;  5E2E A;  4G91 B;  3NC8 A;  3AZN A;  4GB7 A;  2X01 A;  5E5A B;  3C4O A;  2OSU A;  3AZL C;  4WYY A;  1ERO A;  2IWC A;  1NYM A;  3MGQ B;  5A92 A;  4JPM A;  4AWL C;  5B33 A;  4S2I A;  4KUD C;  5FUG A;  4H8R A;  1P3I D;  1M18 A;  2WK0 A;  4B4Z A;  3O86 A;  5BO0 B;  4P87 A;  4DF6 A;  4E45 A;  5CEB A;  2J7V A;  3HLG A;  4PPR A;  2OLV A;  1HQ3 D;  3W98 D;  1VQQ A;  4WZ5 C;  1BLH A;  5GSU B;  1K4F A;  1XP4 A;  5B2I D;  1JTG A;  2NQB B;  4GZB A;  1P3F B;  4E3L A;  3FKE A;  5JA4 A;  4J8X B;  4Z2M G;  4OQI A;  2BYK B;  3LZ0 D;  4NE6 A;  2BG1 A;  1ZC2 A;  4L0L A;  3IXB A;  3W97 B;  3BM6 A;  3UY6 A;  3PBQ A;  3M2J A;  3IF6 C;  4KQQ A;  5B0Y C;  3KUY B;  2BYM B;  3UT9 D;  1P3K D;  5JRG D;  5CPK A;  3OC2 A;  4KZ6 A;  3PBS A;  1HQ3 A;  3W98 A;  2HIO C;  4LV2 A;  5L2F A;  1P3B B;  4QU3 A;  3OPP A;  3MGP A;  4OON A;  5DNN B;  5GHY A;  3VP4 A;  5CED A;  3Q07 A;  1R4V A;  4KHA A;  5F99 B;  2VGJ A;  1K4E A;  4KZA A;  4KZ5 A;  4KG6 A;  4R3B A;  3QNB A;  3L27 A;  1ERM A;  1MXO A;  3AZM B;  5FA7 A;  4U3T A;  3OPR A;  2X71 A;  1CEG A;  1SCW A;  3LZ0 A;  4Z66 B;  1M40 A;  1K6S A;  1XXM A;  4R23 A;  3AZK D;  4S2O A;  2XD5 A;  2W8S A;  1BLC A;  3AZE A;  2WKE A;  5DTT A;  4OPQ A;  1P3O B;  4UA6 A;  3KXB D;  4S2N C;  4IBJ A;  3UT9 A;  3B6F B;  1MWR A;  5JRG A;  2VQR A;  1SDN A;  2ARO C;  3AV2 D;  2A3U A;  3GSG A;  3EPL A;  4IED A;  1S32 D;  5FAP A;  3DWK A;  3MZD A;  1W7F A;  3MVD B;  3MZE A;  5BOH A;  3EPK A;  3AYW C;  4NK3 A;  3OPL A;  3B6G B;  4X23 C;  3AN2 C;  4S2L A;  5CP6 B;  3V50 A;  1BH9 B;  1H8Y A;  1I2S A;  5AVC B;  3G2Y A;  5AY8 C;  1E4D A;  3REL B;  4OOL A;  3H0R C;  3L25 A;  3MGS B;  4J8W C;  1YU4 A;  3AZK A;  2B5R A;  1F66 B;  3WX7 A;  3X1S C;  3G2Z A;  3A1I A;  2XEP A;  3REH A;  3KXB A;  1P3P A;  2WAD A;  5GXQ B;  2IWB A;  3AZG A;  5CTN A;  4DE0 A;  1FCN A;  1LL9 A;  2EX9 A;  4R4S A;  4HGA B;  3X1U C;  4XZQ C;  5FQ9 A;  1ZLA B;  5DF8 A;  1S32 A;  3ZGA B;  1FR1 A;  4KGC A;  1YUE A;  3VH5 A;  2IO5 C;  5B40 D;  1G68 A;  1YLJ A;  4YIN A;  2H10 A;  1N4O A;  3NDG A;  3PAG A;  2XK1 A;  4OLD A;  4FH4 A;  1YU1 A;  2WGV A;  4PM5 A;  1PI5 A;  3GRJ A;  3WA9 B;  1YLW A;  2WAE A;  1TAF B;  2G5I C;  2C6W B;  5CPJ D;  5AV9 D;  3PBR A;  3TSG A;  5AQB A;  5TFQ A;  5BPV A;  3FDD A;  3AZN C;  1MWU A;  3X1T A;  3MBZ A;  1S6R A;  4BLM A;  3X1V B;  3Q1F A;  1EWZ A;  3AFA D;  4QY6 A;  3C7V A;  3MNN B;  1DJB A;  1KX5 B;  5B33 C;  4OJ6 A;  3SH8 A;  1M18 C;  1CK3 A;  5CHJ A;  4DXC A;  2E8I A;  4E3K A;  3NI9 A;  1ES2 A;  2F8N H;  4N1X A;  3AV1 A;  4R8P A;  3V9R A;  5AV8 D;  4H9R B;  1CEF A;  1TZY D;  2XFS A;  3WKJ C;  1JWV A;  5B1M D;  3KWQ B;  1KGE A;  4U0X A;  5G18 A;  3S22 A;  2HP9 A;  3UO9 A;  1CI9 A;  1M1A B;  4KG2 A;  2BLS A;  3NQU A;  3WTP B;  5CPJ A;  1I5Q A;  1C3B A;  5AV9 A;  1WYC A;  2QZ6 A;  3LZ1 B;  1O07 A;  1YQS A;  1HVB A;  3BEB A;  4WJ3 C;  3REK D;  1EQZ B;  4UAA A;  3SH9 A;  5FQJ A;  3AFA A;  5HAQ A;  5E5A D;  3TG9 A;  3FKV A;  5GT0 B;  1Q2P A;  4GD8 A;  3MGQ D;  2L5A A;  4DRB A;  3N6I A;  4NZ1 A;  3O87 A;  1U60 A;  3BFF A;  5CPK C;  2ZQ9 A;  1HQ3 C;  3W98 C;  2HIO D;  5FAS A;  1B6W A;  2C5W B;  3WRZ A;  4XXR A;  3ZVW A;  4EO5 C;  3MGP C;  4BJP A;  5B1M A;  4Z9Q A;  2XD1 A;  5GSU D;  3AZF A;  2P9V A;  1MWT A;  2ZM2 A;  3C1B B;  3A6N B;  3HUO A;  3AZI B;  1P3F D;  1N1J B;  4XUJ B;  4OJL A;  1TDG A;  4R1G A;  1M19 B;  3LZ0 C;  4J8X D;  5GLD A;  5E5A A;  4UUZ B;  3IXG A;  4JXS A;  3MGQ A;  3AZE C;  5IHV A;  4ZUX B;  3UT9 C;  1P3K C;  5JRG C;  5BO0 A;  3EQU A;  1RP5 A;  3MKE A;  5EPH A;  3UE0 A;  3W99 B;  4RVA A;  5AVB B;  4Y7P A;  4S2M A;  3KSY A;  2Y4A A;  1BUL A;  1PWC A;  4MBF A;  1P3B D;  1P3L D;  5DNN D;  5GSU A;  3ZFZ A;  1XGI A;  4PM6 A;  1H3O B;  5F99 D;  5B2J B;  1BH8 B;  3C1C D;  1P3F A;  5BT1 D;  4GKU A;  2HUE C;  4ZBJ C;  3G34 A;  2PBY A;  2WZZ A;  3NCK A;  5A91 A;  4J8X A;  5EOE A;  2BYK A;  1IEM A;  2Y2N A;  4IBG A;  3AZK C;  3VH6 W;  4Z66 D;  3VFH A;  1XX2 A;  3BFG A;  2F8N B;  3W97 A;  4IBB A;  4JF5 A;  3KXB C;  1P3P C;  5GHX A;  2FFF B;  3AZG C;  1JVJ A;  3M2K A;  4EV4 A;  1L0E A;  4XZQ D;  3V39 A;  4XUX A;  3KUY A;  2BYM A;  3B6F D;  4Y0O A;  3LEL B;  3A3J A;  1S32 C;  4BQM A;  3MXR A;  3OZH A;  5BNV B;  1KGF A;  1P3B A;  1JFI A;  3GR2 A;  3HBR A;  5DNN A;  1P3M B;  3LJA B;  3D4F A;  1K38 A;  5DTK A;  5GT3 B;  3VP0 A;  4OQ0 A;  5F99 A;  1LHY A;  4Z2M H;  4KQO A;  5CXW A;  3B6G D;  2ZQA A;  4U0T A;  3OPH A;  4FSF A;  4R4R A;  3AZM A;  2J9P A;  1WWI A;  4R0Q A;  2UWX A;  1KX4 B;  5AVC D;  5G49 B;  5AQA A;  3REL D;  3VH5 W;  1P3A B;  2NZD B;  4Z66 A;  4LG2 A;  3MGS D;  1TEM A;  5B24 D;  1BLS A;  3GQZ A;  3X1T C;  3V5M A;  4D2O A;  1P3O A;  4GNU A;  5GXQ D;  3B6F A;  5DNM B;  3Q7Z A;  3B0D B;  1KDS A;  1AOI B;  5B40 C;  1ES3 A;  4YFM A;  1PI4 A;  1WE4 A;  2ZMA A;  5CGS A;  3MKF A;  3OCN A;  3MVD A;  2Y55 A;  3UPO A;  4Q8I A;  2ZM0 A;  5FQK A;  3GV9 A;  3AV1 C;  4AWL B;  4R8P C;  3AZH B;  3B6G A;  3AGE A;  5HAP A;  5E2F A;  3IH9 A;  1W2E A;  5CP6 A;  3WA9 D;  1BH9 A;  4OP8 A;  4WEL A;  1FSW A;  5AVC A;  5CPJ C;  4K91 A;  5AV9 C;  3REL A;  3G4P A;  3B0C W;  1RGZ A;  3MGS A;  4HES A;  2EX6 A;  3FV7 A;  1F66 A;  1ESI A;  1IYO A;  4IBF A;  5GXQ A;  3AFA C;  2IOU A;  4CSR B;  2XQZ A;  1ZLA A;  1PIO A;  1Q9C A;  3ZG5 A;  1KX3 B;  3OCL A;  1JTD A;  1KX5 D;  4WZS B;  5CPK D;  1ID3 B;  2HDU A;  3F6T A;  3RJU A;  3ZDJ A;  5AV8 C;  2ZLY A;  3VSL A;  1TZY C;  3MGP D;  4JLF A;  4BEN A;  3IF6 B;  5CHL B;  5B1M C;  3B0B A;  3WA9 A;  5BNX B;  1TAF A;  5FDH A;  1M1A D;  5F83 A;  3AZF C;  1IYQ A;  1XKZ A;  1H5X A;  4H9Q B;  1PZO A;  3WTP D;  2ZQC A;  5HL1 A;  4G92 B;  4QLC B;  1O7E A;  1DJC A;  3GTC A;  3HUM A;  1T3U A;  3UN7 A;  5AV6 B;  4YM6 B;  4IVI A;  4JF6 A;  5E2H A;  3REK C;  4G91 C;  1JWZ A;  4KZ8 A;  3W4Q A;  1EQZ D;  5E5A C;  3X1V A;  3MGR B;  3IWI A;  4NET A;  3AZE D;  3MGQ C;  4NE3 A;  1ES5 A;  1KX5 A;  4LD9 B;  1P34 B;  3NIA A;  4NZ4 A;  5TR7 A;  3REJ D;  2OLU A;  2ZY2 A;  5KSH A;  4H9R A;  2EFU A;  5CPI B;  3E2L A;  3HL9 A;  2WYX A;  2ZJ9 A;  5GSU C;  3HRE A;  4MBK A;  1OME A;  3P5J B;  1M1A A;  2Y2M A;  5CHM A;  1KE3 A;  3IHB A;  2Y59 A;  3WTP A;  4GHA A;  4F94 A;  3AL0 C;  3C1B D;  3O62 B;  1P3F C;  1VM1 A;  4RX2 A;  4DE1 A;  4E6X A;  3LZ1 A;  4Y0T A;  5BS7 A;  4WU9 B;  4PM8 A;  4CPK A;  3UTB B;  3BFD A;  4PMA A;  4WU8 B;  4J8X C;  1EQZ A;  2JC7 A;  3LEZ A;  1M19 D;  3G31 A;  4RA7 A;  2Y2H A;  3R45 B;  3W96 B;  4C6Y A;  3PTE A;  3G35 A;  2ZM8 A;  3REH D;  5GT0 A;  5B0Z B;  1P3P D;  3VSK A;  5M18 A;  3AZG D;  3NDE A;  5C3I C;  4ZUX D;  3NY4 A;  4NY2 A;  4DRA A;  3REJ A;  1DJA A;  4KGC D;  4IBE A;  2XR0 A;  3VH6 A;  2ZD8 A;  3UTA D;  1P3B C;  4KEN B;  1P3L C;  3WS2 A;  5DNN C;  2G2U A;  4DDS A;  1YU3 A;  5FQQ A;  5F99 C;  4S2P A;  2IO5 B;  4ZAM A;  3C1B A;  3C1C C;  4DE2 A;  4M6B A;  5B2J D;  5BT1 C;  3A6N A;  1W8Q A;  4X6T A;  3VP2 A;  4IBD A;  1N1J A;  4XUJ A;  4N92 A;  1M19 A;  3LCE A;  2PYO B;  4Z66 C;  3WRT A;  1ONH A;  3Q7V B;  4UUZ A;  3V3R A;  3EG5 B;  3X1T D;  1P3O C;  4ZUX A;  5F82 A;  1NXY A;  3B6F C;  2HDS A;  4WMC A;  1HZO A;  3W99 A;  4GN2 A;  3UTA A;  5AVB A;  1U35 B;  4IBK A;  5GT3 D;  3AV1 D;  4R8P D;  4Z5T B;  1H3O A;  3B6G C;  5B2J A;  2V1Z A;  5DTS A;  1BH8 A;  4YS3 B;  5B32 B;  3RXX A;  5JYO A;  1YT4 A;  3VMA A;  3LY3 A;  2FJ7 B;  1JWP A;  5AVC C;  1ZG4 A;  4EWF A;  3REL C;  3REI B;  3IHA A;  4WBG A;  1BZA A;  3WKJ B;  3MGS C;  5B24 C;  3PBO A;  2NZD D;  4N9K A;  3Q81 A;  2CWE A;  1FCO A;  1XA1 A;  4DE3 A;  3WAA D;  5EOO A;  3VP1 A;  4OLG A;  5GXQ C;  1PZR A;  1HD8 A;  3NBL A;  4HGA C;  5EE8 A;  2ZY4 A;  4JJN B;  1ZLA C;  5DNM D;  4GDB A;  1SDE A;  3SH7 A;  1AOI D;  5BNV A;  2Y2L A;  3LJA A;  5GT3 A;  3WS1 A;  1H8Z A;  4OP5 A;  3HSH A;  1BFM A;  1P3I B;  2ZC4 B;  4E3M A;  3UE1 A;  3M6H A;  3WA9 C;  3AZF D;  1HQ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...