2Y2MA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e08)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 163
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2mA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2mA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2mA02
2FFYA 1IYQA 1HD8A 1HZOA 4GB7A 3IH9A 2ZLYA 2CC1A 3BEBA 3ZCZA 2WKEA 4S2LA 5FQ9A 4FH4A 4YFMA 5FAPA 4QB8A 2Z2LB 2ZM8A 3ISGA 1K4FA 1BTLA 3UPPA 3G31A 3IXGA 1VM1A 4O7DA 3UDFA 4EBLA 4IVIA 1ERMA 4S2PA 5E2GA 1NRFA 3UE0A 1ESIA 3NI9A 4MBKA 1G6AA 2WADA 3A3EA 3HLBA 4WEKA 5GLCA 3UDIA 4EUZA 5HAPA 4WZ5C 2WYXA 1PWCA 2HDUA 3TG9A 5EVID 2JE5A 4FSFA 2Y2JA 4KENB 3OC2A 1BULA 4OPRA 1FCNA 1I5QA 1SDEA 2RCXA 1YMSA 3QNCA 3OPRA 3HUMA 3G4PA 4K91A 2VGJA 4S2NC 4LCLA 1BSGA 4HBUA 4OQGA 4UHUA 4E3JA 4N9LA 5GHZA 3OCNA 3ZHHA 3HREA 3NY4A 4E3LA 4JXWA 3HLDA 1JVJA 2EFUA 3WRTA 1O07A 1K57A 1KVMA 3ITBA 1YM1A 1DJBA 5E2HA 4OLGA 3RJUA 4KZ3A 1SCWA 2X02A 3BLMA 3N7WA 3VP4A 5KMWA 5CHJA 4KZ9A 3IF6B 3EQUA 1W7FA 3G35A 4MBFA 1XPBA 4WEJA 3DTMA 5E43A 3VOYA 1EROA 2J8YA 3P09A 1ES5A 2H0YA 4MEZA 1IKGA 1GHMA 1FOFA 4KZ5A 2XF3A 1W8QA 3MZEA 5HW3A 1M40A 1BT5A 4ZBEA 1VQQA 4C3QA 3ZG0A 3HLCA 4KG2A 3BECA 2ZQ8A 1C3BA 3B3XA 1DY6A 3BFCA 5CHUA 3G34A 5HAQA 3Q81A 1KGEA 3WS5A 1YMXA 1W79A 3ZVWA 5I94A 4RVAA 4R23A 2P9VA 3FKVA 1ALQA 4Q8IA 4R4RA 1ERQA 1SKFA 4GNUA 4S2KA 3VP0A 3BM6A 5GLDA 5GLBA 4P85A 2HDSA 4OH0A 5FA7A 4DE3A 4P87A 1FSWA 2OLUA 2Y91A 5TR7A 2X01A 2WKHA 3PAEA 1K25A 4R0QA 1FR1A 3FWLA 5KZHA 5CHMA 2ZM2A 4UAAA 1BLSA 3UN7A 4PM5A 1CEFA 1XXMA 2V20A 4KQOA 3OPHA 4QY6A 2Y2IA 3O87A 3GVBA 4S2OA 2WKIA 2ZC6B 1GHPA 2ZC3B 4E3KA 1JTDA 5U47A 1PZOA 3SS3A 3VP1A 1MBLA 1YLJA 3RXXA 5EVLA 3D4FA 5HL1A 1E4DA 3Q82A 5AQAA 3SH9A 3MKEA 4DE2A 4EWFA 4HESA 2P74A 1I2SA 2WZXA 3AGEA 1Z6FA 1FCOA 3C4PA 2HDRA 3NCKA 2XEPA 4JXGA 4R3JA 4LV2A 3MBZA 1BLCA 4P0MA 5TFQA 3HUOA 3ITAA 2Y2PA 1PW8A 2ZD8A 4BD0A 2Y2KA 4X68A 4U0XA 3MZDA 4WM9A 5A91A 3ZG8B 2HDQA 4DXCA 1OMEA 5JYPA 3IWIA 3GQZA 1FQGA 1TEMA 2OLVA 4IEDA 5CXWA 3DWZA 3ZDJA 3OZHA 3Q07A 1K56A 4XUZA 4GDBA 4MNRA 2B5RA 3IT9A 1ES3A 2J7VA 3UO9A 2XGNA 2Y4AA 1BUEA 1FCMA 1IELA 1K55A 3EQVA 2HP9A 4QHCA 4NK3A 1I2WA 4BQMA 2DRWA 3SS5A 5FASA 4OPZA 5E2EA 1MXOA 5DTSA 2IWCA 2XFSA 5GL9A 4S2MA 4ZAMA 3PBTA 3PBQA 4ID4A 4WYYA 4B4XA 2OSUA 4JLFA 1TDGA 4OLDA 4OPYA 3UE3A 3FZCA 1JTGA 3PTEA 5DTKA 1AXBA 2E8IA 3ZNYA 1KGGA 3A3FA 1JWPA 3GMWA 3MZFA 2R9XA 4P6BA 3LO7A 4EBPA 3VFHA 2WZZA 3RXWA 2PU4A 5M19A 5CGXA 1ONGA 4E3MA 4K0XA 5JYOA 3IWOA 1LHYA 2BLSA 2XDMA 4OVDA 3Q7ZA 3GV9A 3OPLA 4ZJ1A 3BYDA 1ONHA 1N9BA 1U60A 4X56A 4RA7A 3IXDA 3LEZA 4BENA 4KZBA 1XA7A 1S0WA 1QMFA 3HVFA 3OPPA 4MLLA 3G2YA 3G32A 4UA9A 3M6HA 3CJMA 5CERA 1GCEA 4DKIA 1ZKJA 2ZC7A 3BLSA 4FD8A 5EVIB 3VSKA 4JF6A 2XR0A 3I7JA 4JXSA 1MWSA 3N6IA 1IKIA 5F1GA 1E3UD 2G2UA 4ZJ2A 3S1YA 4LV1A 3W8KA 1IYOA 2WGIA 5EVIA 4OOLA 5FI7A 2UWXA 5HARA 3MXRA 1NXYA 1RP5A 2Y2NA 1JWVA 1QMEA 2DNSA 2EXBA 3N8LA 4IBRA 1W8YA 3N4IA 4Z9QA 5G18A 4BLMA 4C75A 3ZVTA 2Q9NA 5DF9A 3HLGA 3IF6A 3BRMA 4PM9A 5KSCA 2G2WA 1ZG4A 2I72A 3PBNA 1ES4A 5FQQA 1XX2A 2ZQ9A 2DCFA 2XQZA 1K54A 3E2KA 1BZAA 3FYZA 4KZ4A 3PBOA 5DTTA 1YLTA 4ZTKA 4PMAA 2Y2MA 4E3IA 3O3VA 4NETA 3ZG7B 1RCJA 2A49A 4WBGA 5A92A 1CI9A 1L2SA 5GHYA 3HLFA 4DRTA 4WMCA 4N92A 1ZG6A 3QNBA 3M6BA 1HTZA 3HBRA 4OP8A 1CK3A 1DJCA 2QMIA 3W4PA 4DF6A 4KG5A 2IWBA 3UPNA 2QZ6A 3GSGA 4Y0UA 2ZC4B 2WAEA 2JBFA 5IHVA 1MWTA 3VOZA 4JPMA 1L0FA 4DDSA 1IEMA 5EE8A 1O7EA 1WE4A 2ZQAA 4N1HA 2XH9A 3UY6A 4OONA 5FATA 4EQIA 1WYBA 4IBXA 3IH8A 3PBSA 3CG5A 5EOEA 5M1AA 4N9KA 4GZBA 4X55A 1ES2A 1FSYA 4KQRA 2Y2HA 5CECA 2Y2LA 3NDGA 4OQ0A 2JC7A 4RYEA 4OQHA 1PWDA 2ZQDA 1Q2PA 5CTMA 5AQBA 4XUXA 2Y55A 1YLYA 4KZ7A 2Y2GA 3AGFA 4JF4A 2PU2A 2V2FF 1FR6A 1G68A 1HVBA 4WZ5A 4OOYA 3O88A 4JBFA 3UE1A 4GN2A 4HEFA 3SS4A 1K57C 3C7VA 1MWUA 1RGYA 3M2KA 1KE0A 1M6KA 1IYSA 1PZPA 3UDXA 3ZGAB 1H5XA 3A3DA 2XD1A 4Y0OA 5L2FA 4S2NA 5HAIA 2HP6A 1ESUA 5FDHA 3A3JA 2JCHA 4OKPA 5F83A 1K56D 4JF5A 4DE0A 2PBYA 2X71A 1EI5A 3JYIA 2Q9MA 1XKZA 1L0EA 5A90A 2ZQ7A 2ZM0A 3PAGA 4KG6A 4OPQA 1IYPA 4R4SA 2QPNA 4DE1A 1LI9A 4MBHA 5FAQA 5J8XA 5FSRA 4QY5A 3VP3A 4GD8A 5DVAA 1LL5A 4X69A 1S6RA 4FCFA 5A93A 2EX2A 5AQ7A 4OQIA 3ZG5A 5F1FA 4JKTA 2A3UA 5FAOA 5EUAA 3IF5A 5FQMA 4GD6A 1XA1A 2V1ZA 3NBLA 1KVLA 1NYMA 3C7UA 1GHIA 4E6WA 1KE3A 4E6XA 3LY4A 3UNWA 3V39A 1MY8A 2EX8A 1KDWA 4IVKA 4LENA 4R3BA 3TOIA 1WYCA 5CGWA 2ZQCA 3BFDA 1PI5A 2H5SA 4S2JA 3Q7VB 3VFFA 4PM8A 5GHXA 4BJPA 4KZAA 4QJGA 2H10A 4OP5A 1YLWA 3HLEA 4BL3A 1CI8A 1KE4A 1XGJA 3BFGA 4C6YA 5FI2A 3Q7VA 5FQJA 1PI4A 2XK1A 1JWZA 1TDLA 5TGFA 3Q1FA 1K6RA 4DDYA 1LI0A 3NDEA 1SDNA 3V5MA 3IHAA 3V3SA 1MWRA 3DW0A 1PW1A 3PBRA 4RX2A 5F82A 1L0GA 3VP2A 3C5AA 5DF7A 5FI6A 1PYYA 4CJNA 2IWDA 5CTNA 3BFFA 3QHYA 2EX9A 3CMZA 5GLAA 4B88A 2XFTA 5FQKA 3S4XA 5KSHA 5E2FA 3N8SA 2XLNA 4GKUA 3GTCA 4R1GA 5BOHA 1N4OA 3UPOA 3C4OA 3DWKA 1E25A 1NYYA 3FKWA 1Q2QA 3OCLA 4Y0TA 4DXBA 1TVFA 1K38A 4ZDXA 4GDNA 1K4EA 1YLZA 5FQIA 3SH7A 4A5RA 4B4ZA 4CPKA 4BD1A 1K55C 4OOMA 4Y7PA 1BLHA 2ZC5B 3BFEA 2HPBA 1SHVA 3LY3A 4KZ6A 4LV0A 4WMCD 3O86A 5EOOA 3HLWA 4HBTA 3TSGA 4K0WA 1MPLA 4ZJ3A 1E3UA 1NZOA 2FFFB 2J9OA 1EWZA 4LCMA 4QD4A 1YT4A 3W4OA 2WGVA 2EFXA 5DF8A 5EPHA 3MFDA 3ZFZA 2GDNA 4EBNA 4M3KA 3HL9A 5HX9A 5AQ9A 1PIOA 2P9VB 4KZ8A 1BLPA 4JXVA 2HP5A 3V3RA 1Y54A 3WS2A 4X53A 3CZDA 2WUQA 1H8ZA 4GOGA 2EX6A 2WGWB 4H8RA 3WS0A 1W5DA 1NZUA 2Y2OA 3NC8A 3GRJA 2C5WB 3IXHA 1CEGA 3ZNTA 3GR2A 5EECA 4BL2A 3IXBA 4X6TA 2OV5A 3WS4A 2WGWA 1H8YA 2Y2QA 3WRZA 3HUNA 2Z2MB 3ZG9B 3V50A 3IWQA 4LV3A 5D3OA 2ZJ9A 4U3TA 3VMAA 3G2ZA 5CEBA 2ZMAA 4KQQA 2WAFA 3VSLA 4N1XA 3SOIA 3M2JA 3WS1A 1YLPA 4RX3A 4F94A 3SH8A 4D2OA 3G30A 4E3OA 3N8RA 4UA7A 4S2IA 5EVIC 4WZ4A 5CRFA 2BG1A 1XGIA 3NIAA 5CEDA 3LCEA 2R9WA 3A3IA 5CGSA 1MKIA 4L0LA 1XP4A 1L0DA 4PM6A 3IF6C 3IQAA 3IHBA 5HFOA 1K6SA 1LL9A 1RGZA 1NY0A 2EXAA 4E3NA 5M18A 3MKFA 3W4QA 2WK0A 3FV7A 1ZC2A 3AGDA 1K54C 4EV4A 1NJ4A 2Y59A 4XXRA 1GA9A 4PPRA 2RL3A 4FH2A 4U0TA 4QU3A 4WELA 1KGFA 2H0TA 2C6WB 2XD5A 1PWGA 3E2LA 1DJAA 1KDSA 3MXSA 3P98A 4PM7A 4UA6A 2J9PA 2VGKA 1J9MA 1LLBA 3S22A 3WWXA 1YQSA 1GA0A 4YINA
chains in the Genus database with same CATH superfamily
1IYQA 3H7WB 4IBJA 1VHMA 1M1AC 3LZ0C 3KSGA 2WKEA 4YFMA 5FAPA 4LRXC 3KXBC 1TS8A 2Z2LB 1P3LA 1IOUA 3UPPA 3AZMC 3IXGA 5AV9B 3G6OA 4I38A 4FUWA 4G3KA 1ERMA 1LSXA 5E2GA 5B40B 3A3EA 1XFQA 2WYXA 4Y3IA 3TG9A 3OC2A 1T19A 5GT0A 3QNCA 4R70A 3HUMA 4S2NC 3JVUA 1YPRA 3H9WA 3AZNC 1BSGA 4HBUA 4N9LA 5GHZA 3WD1A 3JPUA 4X23C 4E3LA 3MGPD 2EFUA 1O07A 1PRQA 3UTAC 1CF0A 4OLGA 4XZQB 3N7WA 4NXEA 3LR5A 3VP4A 3MSHA 5CHJA 5B2IB 2Q0OA 3B42A 4HMDA 5B24B 3DTMA 5E43A 3VOYA 3P09A 1ES5A 2H0YA 4J8XC 1GHMA 1XJ6A 1FOFA 4H9QB 5HWVA 2JKRM 2F8NB 3ZG0A 1XJ3A 4KUDB 5DNMA 1S32A 1OTIA 4JJNC 2HIOC 1P97A 2ZQ8A 2LB9A 5CP6D 1B6WA 3BFCA 3Q81A 3ZQ5A 3WS5A 1YMXA 1ZHHB 4MN5A 3UTBB 1PNEA 3E4QA 3FKVA 3IBRA 1M1AB 3LZ0B 3AV1D 1OTBA 3TE8A 3D3OA 1P3AB 2P08A 3VP0A 1WWSA 3KXBB 3TJZC 2HDSA 5FA7A 2KDKA 4P87A 1FSWA 3W2ZA 5HPFA 4NXFA 2WKHA 3AZMB 1NWZA 2FJ7D 2PYRA 2ZM2A 5E5AA 2KOIA 4Y2FA 3KUYD 2VKSA 1TAFB 3AYWD 3W99A 1HTAA 2W3FA 1OJ5A 5U47A 3OOVA 1PZOA 4NE6A 3VP1A 1MBLA 1YLJA 1F9IA 4LRZE 1E4DA 3Q82A 3IP4C 4HESA 2P74A 1Z6FA 3AZNB 2K7SA 2XA7S 4JXGA 3R7WB 3MBZA 4P0MA 3HUOA 1PW8A 4X23B 3MGPC 4BD0A 1P3BA 4U0XA 1AWIA 5CXWA 1FQGA 1TEMA 4IEDA 4DRAA 5CX7A 3OZHA 3QP2A 4Z1WA 1K56A 4XUZA 2B5RA 3IT9A 2J7VA 1P3LD 2Y4AA 2R78A 1U35A 1IELA 4J8XB 1AIWA 5AV8B 3EQVA 2JKTI 1S1YA 4QHCA 5B2JC 4NK3A 3D72A 4O01A 5IT5A 5E2EA 3LGOA 5DTSA 4JJNB 5GL9A 2HIOB 4ZAMA 3PBTA 5CP6C 3MXQA 4ID4A 2OSUA 1TDGA 3UE3A 3M7PA 5I5LA 3ZNYA 1J3WA 3MGSA 3A3FA 2R9XA 4GHIB 3VFHA 2WZZA 5M19A 5CGXA 1ONGA 4NZ4A 4K0XA 2D49A 1F5MA 1LHYA 2BLSA 4GHAA 5JYOA 5F68A 4ZJ1A 2FJ7C 1W63Q 2AVXA 1BH9B 4RA7A 3TU4A 3KUYC 3AZFA 3G32A 3AYWC 3H82B 3M6HA 3BLSA 2ZC7A 1TD5A 3MJQA 3BWLA 4WLAA 4FD8A 3VSKA 1YU0A 4JF6A 3I7JA 4YWZA 3NHQA 4H9OB 4J8UA 2PT7A 1IKIA 5F1GA 5EM0A 1E3UD 3LJAD 3MQ0A 3V67A 3AZEC 3O5YA 3B6GA 1JWVA 1Z09A 4Z9QA 3V9RB 3N4IA 5DNMD 4BLMA 3W96A 1XJ2A 3F1OA 2V8FA 3LZ1A 3MGPB 5DF9A 3HLGA 3FPWA 2BTFP 3AN2B 3UE6A 1ZG4A 1ES4A 1UGUA 4KHAA 1XX2A 1E6RA 2W1TA 2ZQ9A 1K54A 4KZ4A 3PBOA 2OAP1 4CAYB 4ZTKA 4XT2B 4IHQA 3T4OA 1P3LC 5A92A 2QHKA 4WMCA 4NXBA 4F3LA 3HBRA 3GSGA 5HDSA 2JBFA 5E5AD 5CP6B 3WD3A 1L0FA 3LEQA 1O7EA 3UY6A 5KDMA 2V1AA 4OONA 4HJ6A 5G49A 4EUVA 3W99D 2L0WA 4IBXA 4I39A 3PBSA 3CG5A 4QWOA 1P3OA 3AV1B 1ES2A 4KQRA 3C1CA 5GT0C 5CECA 4RYEA 4BBVA 4YOFA 1PWDA 4KZ7A 4NKPA 2Y2GA 2FJ7B 5L07A 4JBFA 4EXOA 4TX8A 3T1QB 3KUYB 4GN2A 4H9RB 3F1PA 3AYWB 4BWIA 1KE0A 2B95A 1E88A 1IYSA 3A3DA 2XD1A 2HP6A 1ESUA 2JCHA 1K56D 4JF5A 3B0BA 1T1BA 1EI5A 3LUQA 1F1EA 4M6BA 3LJAC 1U35D 3PAGA 2QPNA 2VEAA 4HH2A 4MBHA 5FAQA 1P0ZA 5DNMC 1S32C 2J8PA 3GDIA 1LL5A 2F8NK 3CLOA 1E8BA 3ZG5A 4JKTA 1GOIA 1TZYA 3IF5A 3MGSD 1GHIA 1KE3A 5MC7A 2BYKA 4E6XA 5DFYA 3C1BB 1P3LB 4UEYA 4IVKA 4LENA 4PHTA 4R3BA 1PI5A 3TU4D 5E5AC 3Q7VB 3VFFA 4BBUA 3AZFD 2H10A 5HWTA 4DN0A 3W99C 5JA4A 5FI2A 1E6ZA 4H9NB 4JGPA 3Q1FA 3W97A 4J8UD 2WKPA 1LI0A 1OT6A 1SDNA 3IHAA 5EV0A 3PHYA 4ETXA 2KX6A 3B6GD 2K2NA 3A1IA 1ZLAB 3W96D 2IWDA 5B1LA 2CV5A 3S4XA 5E2FA 4YS3A 2XLNA 4GKUA 4R1GA 3UPOA 3DWKA 1Q2QA 3OCLA 4Y0TA 2B18A 5FQIA 1U35C 3LJAB 4OOMA 2NQBD 1SHVA 4WMCD 5TBMB 3L7HA 3HLWA 3WD2A 3L29A 5DNMB 1GPFA 4Q0IA 1YT4A 2WGVA 3KO6A 4JGOA 3ZFZA 2O9BA 1YSPA 4MB3A 1UWPX 4EBNA 4P6ZM 5JRGA 4QLCA 3MGSC 4GJ4A 5HWWA 4O8GA 3V3RA 3REHD 3C1CD 2EX6A 2WGWB 3WS0A 3GRJA 3GR2A 4KGCA 3B6FA 4CQHA 3TU4C 5F6AA 1H8YA 2Y2QA 2JN7A 2Z2MB 3AZFC 3JVVA 3W99B 4Y17A 3VMAA 3NQUA 3VH6T 3T1RA 2Z6DA 2WAFA 3QP4A 4N1XA 4J8UC 4IJGA 1HLUP 2INWA 4UA7A 4S2IA 5J3WA 5AJGA 5CRFA 3B6GC 1S4RA 3NIAA 3LCEA 2R9WA 3W96C 2W3DA 3A3IA 5CGSA 1Y4OA 3MNNA 2CWEA 3LZ1C 1XP4A 3VE3A 1LL9A 3KSYA 3E98A 4E3NA 2V0WA 1TZYD 3W4QA 2WK0A 4QNLA 1DP6A 1P3GD 1K54C 4EV4A 2Y59A 3L2AA 2VJWA 1QO6A 1YU1A 4WELA 1PWGA 4AWLC 2XD5A 1U35B 3E2LA 3MXSA 2A24A 3S22A 3WWXA 1GA0A 3WD4A 3NQJA 1HD8A 1HZOA 4GB7A 5FDSA 2HZ5A 3ZCZA 4PAUA 3F1NA 5TJJA 2NZDA 3MGSB 3WA9D 1BTLA 5KIZA 5J7EA 1TS6A 3C1CC 4O7DA 2GJ3A 2K31A 2Z6CA 4S2PA 3UE0A 1ESIA 5HAPA 3VE4A 5GLCA 1W2EA 1N9OA 1R4VA 1PWCA 3TU4B 2JE5A 4FSFA 2Y2JA 5B1LD 3AZFB 1FCNA 3A6NA 1I5QA 4YS3D 1YMSA 3A0VA 3G4PA 4K91A 2VGJA 5C3IC 4LCLA 3IX4A 5CHLB 4J8UB 5BNXA 3HCYA 3NY4A 1N9LA 1K57A 5CPID 3B6GB 1YM1A 4MDZA 3BLMA 3W96B 3F1OB 5B31A 2J3TD 4KZ9A 3C30A 4WEJA 4GLQA 3T1XA 1TZYC 5JRGD 4QLCD 4KHAB 2W1TB 1IKGA 4MEZA 5HW3A 3MZEA 1W8QA 4ZBEA 1S66L 2JKRI 4C3QA 3HLCA 3VH5A 4AWLB 1EQZA 1C3BA 2NQBB 3B3XA 5AVCA 4F3LB 4CSRB 3HSHA 1ACFA 3B6FD 2P9VA 4Q8IA 4R4RA 1ERQA 1SKFA 4S2KA 5KDMB 5GLBA 3VOLA 4P85A 5G49B 2MJ6A 4DE3A 3X1SA 2OLUA 2X01A 5LBRA 3REHB 3C1CB 5KZHA 3DBAA 5B32A 3W97C 4UAAA 2EA9A 2V20A 2PYOA 2YFWA 2Y2IA 3O87A 3GVBA 1P3FA 4H9PA 1VETB 1H0IA 5B1LC 2CV5C 3UTAD 3SS3A 4YS3C 3D4FA 1H0MA 4OUIA 3MKEA 3CPTA 4DE2A 5C3IB 2HDRA 4G91C 2XEPA 4Z2HA 3D9YA 5TFQA 1DP8A 3P5JB 3RELA 2ZD8A 1CK7A 4X68A 3HONA 5CPIC 5A91A 1OMEA 1YKDA 3DWZA 3L25A 3Q07A 1DP9A 3C2WA 3EPKA 1CQAA 4DJ3A 5FL3A 5JRGC 3UO9A 1TZYB 2VGLM 4QLCC 1P3GB 3T50A 3LIBA 5HDCA 3TRCA 3PXPA 2DRWA 4OPZA 2BYKB 4IBEA 3AZHA 2XFSA 2VA0A 4S2MA 3PBQA 4KGCC 4JLFA 3H0RC 3FZCA 5DTKA 2E8IA 3B6FC 4IBIA 3GMWA 5CPKA 1SZVA 3LO7A 3VH6W 3RXWA 3A6ND 2ZMFA 3LR3A 4R8PA 3WA9B 5F5YA 1H3QA 4OVDA 1G5UA 3Q7ZA 3OPLA 2W3HA 5L8MA 4IJEA 3VH5W 3IXDA 3LEZA 4KZBA 1S0WA 3ICYA 4MLLA 3LR0A 3K2NA 3CJMA 3R4KA 2ZBBA 5B1LB 4Z5TD 1IFQA 3N6IA 3VV4A 4YS3B 4IUHA 4ZJ2A 3S1YA 4LV1A 2CMNA 1IYOA 2WGIA 5EVIA 2UWXA 1NXYA 5BNVA 4G91B 2EXBA 1QMEA 2DNSA 2VLGA 5G18A 4UUZA 3IS2B 1E15A 3L9KA 3NJAA 4OJPA 1EQZD 5B2JD 5AVCD 4PM9A 5CPIB 2PBDP 2VV8A 5KSCA 3PBNA 1UR8A 3E2KA 2E8JA 4EERA 5DTTA 4NETA 1P3PA 5JRGB 3X1SD 4QLCB 3HJKA 1L2SA 2P04A 3HLFA 1JNUA 1ZG6A 1LSWA 3QNBA 4OP8A 3L27A 1CK3A 3W4PA 4DF6A 1BH8A 4KG5A 5B32D 1LSVA 4WZSB 3L26A 4JPMA 2PYOD 4DDSA 3X1UA 1IEMA 5EE8A 4HJ3A 4J8VA 2ZQAA 4N1HA 5FATA 2IOUA 3IH8A 4N9KA 4X55A 1HQ3A 3A6NC 2Y2LA 3NDGA 1N1JA 3NQUB 5EVEA 4XUXA 1YLYA 3AGFA 4UPKA 4WZ5A 1FR6A 2V2FF 3O88A 2PD8A 3UE1A 5HPIA 3AZED 3RELD 3S7NA 1YAXA 1K57C 3AZGA 5B0ZA 5GXQA 2QJ7A 3KS4A 4NYUA 1PZPA 3UDXA 5HAIA 5B31C 1D1JA 3UTAB 4RQ9A 3A3JA 2JSSA 4OKPA 4Z5TC 2PBYA 3EPHA 1OTAA 1WA9A 2ZM0A 4R4SA 5AY8A 4Z2GA 4DE1A 5L09A 5J8XA 2LB5A 3UT9A 3AZHD 5DVAA 1EQZC 1GXDA 1S6RA 5A93A 2F8NH 2EX2A 5AVCC 2A24B 3SZTA 5HD5A 1GSXA 2XSSA 3HJIA 3NQJB 4GD6A 5CPKD 1XA1A 4DQYB 2V1ZA 3NBLA 1KVLA 5CPJA 3EPJA 3F1NB 4NFTA 4I5SA 3KFUG 3LY4A 4MN6A 2W0NA 3X1SC 4R8PD 5BS7A 5GT0D 2OOLA 3WAAA 3TOIA 5B32C 3E4OA 2ZQCA 3BFDA 1S67L 4ZUXA 1PZRA 4S2JA 4PM8A 5GHXA 2PYOC 1TS0A 4QJGA 1YLWA 4BL3A 1CI8A 1XGJA 3BFGA 4C6YA 2NUPC 3C8CA 2VGLS 5K5BA 4EU0A 2ZY2A 2Y8HA 4H9SA 3A6NB 3V3SA 2JKFA 3PBRA 1L0GA 4ARZA 5DF7A 3CAXA 3RELC 4CJNA 3X1VA 3BFFA 3CMZA 5GLAA 2XFTA 5FQKA 1S32D 3N8SA 1M18A 1M19A 2VV7A 3IBJA 2HUEC 1N4OA 4Z5TB 1E25A 1NYYA 3DTIA 1JFIA 4DXBA 2OWJA 4A5RA 3L28A 3SH7A 5FEGA 1H0GA 3BFEA 3LY3A 3PYPA 1YU4A 3TW8A 5FEFA 5DJUA 3TSGA 3S7OA 3T4TA 1NZOA 3AZHC 2FFFB 3W4OA 1EQZB 5B2JB 5AVCB 3MFDA 1KX5A 2GDNA 3X1UD 3UB9A 2NUTC 3KWQA 2F2AC 5AQ9A 2P9VB 5CPKC 1S1ZA 4WL9A 4GHLA 1Y54A 4X53A 3CZDA 1HQ3D 3MFXA 1XFNA 2Y2OA 3X1SB 2C5WB 1ULYA 4R8PC 3UB7A 3IXBA 5B32B 1P34A 2ZMVA 1K0KA 3BW6A 3HUNA 5B31G 2PYOB 2YFWB 3AZGD 5B0ZD 5GXQD 3SW1A 2W3EA 3CHWP 3IWQA 2HJEA 1P3BD 3WTPE 4HMCA 3U4LP 2J80A 3W98A 3M2JA 4WNNB 3CPTB 3MGQA 1MZUA 5EVIC 5AY8D 1WWIA 2BG1A 2DF4C 1KX3A 4MB5A 1MKIA 3AZEB 3RELB 3UT9D 1YUEA 3S7QA 1L0DA 5FUGB 1H3OA 1K6SA 3T12B 5M18A 3MKFA 1TF1A 1ZC2A 4X25A 2HUEB 4XXRA 2V5OA 5CPJD 3BY8A 2G5IC 1P3PC 1P9RA 5B32G 1KU5A 3P98A 4PM7A 1DJAA 1D06A 2XROA 1LLBA 4NEED 1YQSA 1Q9CA 2DQNC 4YINA 2FFYA 5GSUA 4ME4A 3AZHB 2ZLYA 2CC1A 4IBGA 4S2LA 5FQ9A 2A2LA 3X1UC 4J8VC 3K3DA 2HJ9C 5DJTA 2ZM8A 3ISGA 5CPKB 3H7WA 5EFWA 4R38A 1HQ3C 4LGWA 4WU9A 3UDFA 3BY9A 4EBLA 4IVIA 2QKPA 4R8PB 3N3FA 1NRFA 3NI9A 4MBKA 1G6AA 2WADA 5GT0B 4EUZA 4WZ5C 5AV9A 1PDCA 2HDUA 4LG2A 3FPVA 3X1VD 3AZGC 5B0ZC 4GH9A 5GXQC 3WD0A 1BULA 3RFBA 5B40A 3AZLA 1M18D 3OPRA 3LZ1D 1P3BC 3OBFA 1M19D 1F2KA 4E3JA 1X0OA 4OQGA 3OCNA 5HDDA 2OAQ1 4FOFA 3ZHHA 4HMEA 2YKFA 4JXWA 3HLDA 5AY8C 1E6NA 3EPLA 3ITBA 1DJBA 1VEUA 5E2HA 5BNVB 3CITA 4EEUA 4HIAA 3E0YA 1SCWA 4UUZB 5KMWA 3UT9C 4H6JA 1P3MA 3EQUA 1W7FA 3G35A 2GNXA 1KX5D 1S32B 1EROA 3B0CT 4XZQA 2J8YA 3MQOA 4HH3A 5B1MA 4GS9A 4L9EA 5CPJC 1BT5A 1OTDA 3LFVA 1P3OD 3P7NA 1DY6A 5HAQA 3G34A 1KGEA 5BS7C 4YM6A 3WAAC 1W79A 3ZVWA 2F8NA 1BH8B 4RVAA 4R23A 1GSWA 1P34D 4HGAC 4ZUXC 5DNNA 4GNUA 4PKYA 4X1MA 5GLDA 3X1UB 2IA2A 3BJNA 5E5AB 2ZL1A 5AVFA 2Y91A 5TR7A 3PAEA 1K25A 1HQ3B 4R0QA 1P3AA 4H9SC 4DMZA 3LI9A 3F6TA 4PM5A 1B67A 1CEFA 1N1JB 3MGQD 4KQOA 3NECA 3OPHA 4S2OA 2BASA 2WKIA 2ZC6B 4FTXA 1STZA 1GHPA 5GT3A 1KX3D 3X1VC 3VH5T 1L6JA 3AZGB 5B0ZB 3P01A 5GXQB 4GW9A 4G92C 3RXXA 4HY8A 5EVLA 1M18C 2L1MA 2HV1A 5AQAA 3SH9A 1M19C 1P3BB 3REKA 4EWFA 2WZXA 1I2SA 2O9AA 3UB6A 3C4PA 1FCOA 3NCKA 1N9NA 2VK3A 4LV2A 1BLCA 2Y2PA 3FC7A 3LI8A 5AY8B 2Y2KA 1E6PA 4WM9A 3A1KA 2HDQA 3AZIA 3IWIA 3GQZA 2OLVA 3ZDJA 3UT9B 1OGBA 4GDBA 1H8MA 4MNRA 1KX5C 3X1TA 3KWQC 2FZ0A 1J7MA 1BUEA 4WF0A 4LD9A 5CPJB 2HP9A 4MN7A 2D02A 1I2WA 2LY8A 4E44A 1MXOA 1P3OC 4WU9D 4KUOA 3ZYTA 4Q0JA 5AV8A 4OLDA 1JTGA 3W97D 4M4XA 1P34C 1KGGA 1JWPA 4HGAB 4EBPA 4NY2A 4G3WA 2PU4A 5B40D 3AZLD 4E3MA 2CV5D 3IWOA 4GHIA 2XDMA 2PYPA 3ULFA 4Z2LA 1ONHA 1N9BA 3KSHA 4X56A 3MGQC 1QMFA 3HVFA 3OPPA 4I3JA 2W1RA 3A0SA 5CERA 1GCEA 4DKIA 1ZKJA 4ARZB 1KX3C 3X1VB 2P7JA 4JXSA 1P3MD 4G92B 1M18B 2G2UA 2O9CA 3LZ1B 1XJ4A 3W8KA 1M19B 5B1MD 3WKJA 1F98A 1W8YA 3WX7A 3ZVTA 4QPRA 2Q9NA 3NOTC 2HF6A 3IF6A 2ZY3A 4YM6D 2I72A 5GSUC 2ZOIA 3UMDA 2XQZA 3KYEA 5DNND 1BZAA 4KGCD 1YLTA 2Y2MA 1KX5B 3AN2A 3O3VA 5HD3A 3ZG7B 4E3IA 2A49A 1UWNX 4WBGA 5GHYA 4N92A 1HTZA 1DJCA 2QMIA 3EEHA 1P3AD 3LIDA 2IWBA 2ZY4A 1KS0A 2ACGA 4Y0UA 4WU9C 2WAEA 2ZC4B 1P3OB 1F66A 5IHVA 1MWTA 3VOZA 1P9WA 2XH9A 5AV9C 1P34B 1FILA 5GT3D 3H0LC 4GZBA 5CP6A 5B40C 2Y2HA 4OQ0A 4Z2MG 3EG5B 3AZLC 4P6ZS 4OQHA 3MNND 3WTPA 3REKD 4XUJA 3F1PB 5AQBA 3AV1A 2Y55A 3T4SA 5B0YA 1G68A 1HVBA 4KQDA 2AROA 2V9AA 4HEFA 3SS4A 5AVBA 2G5HC 1MWUA 3M2KA 2VZWA 1M6KA 3AZID 3MF0A 1KX3B 1H5XA 3QP8A 3B0CW 4Y0OA 1T1AA 5DKLA 5FDHA 5F83A 1P3MC 4Z2JA 1H3OB 1ODVA 3X1TD 3JYIA 4XZQC 1XKZA 5B1MC 4WJ3C 4IBKA 2ZQ7A 4KG6A 5A90A 4OPQA 1BFMA 4LD9D 2NZDD 5FSRA 4QY5A 2J3WA 5BO0A 3VP3A 4GD8A 3RTYA 4D60A 4FCFA 2UV0E 5AV8D 2HGVA 5F1FA 4YM6C 4EO5C 2A3UA 5DNNC 3LIAA 3C7UA 1KOUA 4LRYC 4E6WA 4WN5A 1NLYA 4I3IA 4ZRRA 3UNWA 1MY8A 1P3AC 4DJ2A 1WYCA 2GX5A 3LYXA 2DMWA 3T4LA 4WU9B 3C1BA 5JA4B 3O62A 4BJPA 3LICA 1P3IA 4KZAA 3AFAA 1V9YA 4OP5A 3W97B 3RH8B 5GT3C 2EWWA 2ZY5A 4Z66A 3Q7VA 1KX4A 5FQJA 3DTEA 1TDLA 3AZLB 4DDYA 3MNNC 3NDEA 4ETZA 5B31D 2CV5B 3REKC 4NG2A 2YFVA 3WKJD 3DW0A 1PW1A 4H9NA 5AV5A 4RX2A 3DTKA 5FI6A 3MQLA 4AFIA 3NOPC 2EX9A 1VEUB 2D01A 5G4ZA 3AZIC 1ZLAA 4H6JB 1NRJA 5BOHA 1P3MB 4L9FA 3AN2D 3X1TC 2QYBA 3LIEA 1YLZA 2BYMA 5B1MB 4Y7PA 4GS9B 4LD9C 1BLHA 4LV0A 2NZDC 4LPZA 2VX8A 3O86A 2W27A 3KYQA 1OPXA 4NYYA 4ZJ3A 1E3UA 4LCMA 3AV2A 1F66D 2EFXA 4NE5A 3LJAA 5AV8C 2OWHA 3AZJA 4YM6B 5TBMA 4M3KA 4EO5B 2WKRA 1BLPA 5DNNB 4JXVA 4KGCB 3WS2A 2WUQA 1P3FD 3B6FB 4OJ5A 1TS7A 4GOGA 4H8RA 2ZL1B 3NC8A 3WTPD 3IXHA 1CEGA 4XUJD 4UQIM 3ZNTA 5EECA 4BL2A 4X6TA 2OV5A 4CLCA 5B0YD 3WS4A 2WGWA 2AROD 4HQAA 2I9VA 3WRZA 3KS8A 3IX8A 5AVBD 3V50A 3NOUC 4LV3A 2ZJ9A 4U3TA 5GT3B 3G2ZA 1O6IA 5CEBA 2ZMAA 1OT9A 1T3UA 3SOIA 1CXWA 3WS1A 1YLPA 4R3AA 4RX3A 3SH8A 4D2OA 1OGGA 3CUEA 5HZHA 3G30A 3MNNB 4NE3A 3REKB 4WZ4A 3WKJC 4HOIA 2F8NG 4PM6A 3IF6C 3IQAA 4Q0HA 4PKYG 1RGZA 1NY0A 3AZIB 3FV7A 3AGDA 1NJ4A 1GA9A 4PPRA 2RL3A 4IBFA 3AN2C 4U0TA 4HP9A 4QU3A 3X1TB 3BQ8A 3S7PA 1KGFA 2C6WB 2H0TA 4KUKA 1KDSA 4LD9B 2NZDB 4UA6A 2VGKA 1J9MA 1S4SA 3REIA 2IO5C 4EESA 3IH9A 3C1BD 1F66C 3BEBA 1CJFA 3O62D 4FH4A 1P3ID 3AFAD 4QB8A 1K4FA 4Z2KA 4Z66D 1KX4D 3G31A 1P3FC 1VM1A 5AV6A 3UB8A 1SKOA 3WTPC 4XUJC 4K08A 3AV1C 5IU1A 3HLBA 3UDIA 4WEKA 5B0YC 5AV5D 2AROC 5EVID 3GECA 2RVQD 4KENB 1FIKA 5AVBC 4OPRA 1SDEA 5BNXB 3AL0C 2RCXA 3QP1A 1ZLAD 3FDDA 4UHUA 2FH5A 2V1BA 3HREA 3T4QA 5B31B 2V8CA 3LIFA 1JVJA 3MMHA 3WRTA 4ZBJC 1KVMA 3WKJB 1ID3A 1AOIA 1BYWA 1P3PD 3RJUA 3MR0A 1D7EA 1YSQA 2X02A 4KZ3A 3AV2D 3IF6B 4MBFA 3AZJD 1XPBA 4B9OA 5F99A 1A0KA 3R45A 3MVDA 4KZ5A 2XF3A 4X1LA 1M40A 4J8VD 1VQQA 2RIQA 1V9ZA 4KG2A 3BECA 4Y15A 3MGRA 5CHUA 4OJ6A 5I94A 4CLCD 2IO5B 3C1BC 1ALQA 2PDRA 1F66B 5HL6A 3O62C 1P3IC 2NQBA 1ZTUA 3AFAC 3BM6A 3UB5P 4CSRA 4NXGA 4OH0A 4IBBA 4Z66C 1KX4C 3EOIA 1P3FB 1FR1A 3C38A 3FWLA 3KSIA 5CHMA 4H9PB 1BLSA 3UN7A 1P3KA 3WTPB 1UR9A 1XXMA 4XUJB 4HNBA 4QY6A 3REHA 5B33A 5AV5C 5B0YB 1T1CA 2PD7A 2AROB 2ZC3B 4E3KA 2RVQC 3B33A 1JTDA 2QJ5A 3REJA 4WU8A 5AVBB 5HL1A 4EETB 1ZLAC 3LR4A 3AGEA 1VETA 1OJGA 4R3JA 5BT1D 3KX0X 4UQIS 3ITAA 4J8WA 4ZBJB 4HJ4A 3MZDA 3ZG8B 1T18A 3REID 4DXCA 5JYPA 3AZKA 5BO0B 3AV2C 3LELA 3WAAD 3AZJC 4Y5FA 1L3LA 2W8SA 1ES3A 4IBCA 2XGNA 4ZUXD 4MB4A 1FCMA 1K55A 1LL8A 2O0YA 2JKTM 1NLZA 3KSFA 4BQMA 3SS5A 2GZAA 4Y13A 5FASA 3EGXC 4E04A 2IWCA 5AV6D 2B02A 1P3GA 2WKQA 4WYYA 4B4XA 4GCZA 3BQAA 5AVEA 3EWKA 4OPYA 3PTEA 4CLCC 1AXBA 4II7A 4NZ1A 3MZFA 4P6BA 3O62B 2PR5A 1P3IB 3AFAB 3H0MC 1W1YA 4JGQA 2V0UA 4Z66B 1KX4B 5IS1A 2YKHA 3GV9A 3BYDA 1U60A 3K3CA 3CUEC 4BENA 1XA7A 3WA9A 3T4JA 2YFVB 3G2YA 1ID3D 1AOID 2M1CA 4UA9A 2VQRA 5AV5B 3IX3A 5EVIB 2PAVP 2XR0A 2M7UA 1MWSA 3NULA 5F99D 1EW0A 5G4YA 3MVDD 4OOLA 5FI7A 4HP4A 5HARA 3MXRA 5BT1C 2ZM5A 2Y2NA 1RP5A 4HHDA 3KWQD 3N8LA 4IBRA 4C75A 1W1VA 2BYMB 3MGRD 5B2IA 3BRMA 4BBTA 5B24A 1P3PB 2G2WA 2L5AA 3REIC 5FQQA 3MQQA 3IS2A 2DCFA 3OLOA 4H9QA 3AV2B 3FYZA 4LLOB 4PMAA 3AZJB 5CPIA 4KUDA 2QWSA 1RCJA 2EWVA 1CI9A 4DRTA 4NZ5A 4J8VB 3M6BA 1H8PA 3UTBA 4WV4B 3UPNA 1GSVA 1YU2A 2QZ6A 5AV6C 1M1AA 3LZ0A 1P3KD 5HSQA 3E4PA 3KXBA 3W98D 4CLCE 1WE4A 4EQIA 5C5KA 1W63M 5B33D 4CLCB 1WYBA 4JGRA 5M1AA 5EOEA 2VV6A 3REJD 1FSYA 3AZMA 4WU8D 2W3GA 2JC7A 1Y28A 1ED7A 4ESPA 2ZQDA 1Q2PA 5CTMA 4OJOA 1TAFA 4JF4A 2PU2A 1G28A 1DRMA 4OOYA 4EQ1A 4R6LA 4J8WD 5F69A 1MKMA 1ID3C 3C7VA 1AOIC 3FG8A 3FKEA 1RGYA 3ZGAB 3AZKD 5L2FA 4S2NA 3LELD 3AZNA 2JHEA 4DE0A 3R7WA 2H28A 5GSUD 2X71A 2PHYA 2Q9MA 5F99C 2Y79A 1L0EA 4X23A 3MVDC 1IYPA 4O0PA 1LI9A 3UTAA 2G7UA 1MC0A 3EEAA 4YNRA 3MGRC 4X69A 5AQ7A 4OQIA 1Z2CB 3REIB 2L4RA 5FAOA 5EUAA 5FQMA 4J8XA 1NYMA 2NQBC 3WAAB 1W1PA 4EW7A 4IBDA 5AV9D 4L9GA 2RTSA 4Z2IA 4ZUXB 4JJNA 3V39A 2HIOA 2EX8A 1KDWA 4E45A 5CGWA 1G6OA 5AV6B 4DRBA 1SKOB 2H5SA 1P3KC 2M7VA 3T1SA 3W98C 3REHC 5B33C 3HLEA 1KE4A 3A0RA 3REJC 4EEPA 1OTEA 4WU8C 1PFLA 1PI4A 2XK1A 1JWZA 5TGFA 4LFUA 1BH9A 1K6RA 4BMWA 4WUJA 3V5MA 3B0DC 1MWRA 5L10A 3H82A 4XZQD 5F82A 3VP2A 3C5AA 1PYYA 5CTNA 4B88A 4J8WC 3QHYA 5B2ID 4B93A 1ID3B 4H9OA 1AOIB 1JFIB 5B24D 5KSHA 4NZ3A 3AZKC 3EGDC 3GTCA 1YU3A 3LELC 3C4OA 3FKWA 2F8ND 4KUDD 3V9RA 1TVFA 1K38A 1EAKA 4ZDXA 4MMNA 5F99B 1K4EA 4GDNA 4HI4A 5EM1A 4B4ZA 4CPKA 3MGPA 1K55C 2KLIA 3R45B 3MVDB 2ZC5B 4IJFA 4IUKA 2HPBA 4BD1A 4KZ6A 5BPVA 5EOOA 4Z5TA 3KWQB 4HBTA 3UTBD 5A8BA 4K0WA 1MPLA 2XRNA 3VH6A 3MGRB 2J9OA 1EWZA 4QD4A 1P3GC 1M1AD 3LZ0D 3B47A 4G3VA 5DF8A 4CAYA 4XT2A 5EPHA 1W1TA 3KXBD 3HL9A 5HX9A 1PIOA 4KZ8A 2HP5A 5B2JA 3QP6A 3AZMD 1H8ZA 3CI6A 2JKGA 1W5DA 1NZUA 4I3AA 1A7WA 2XA7M 4OJLA 3KYZA 1P3KB 3WA9C 5J4EA 3ZG9B 3W98B 4MCWA 5B33B 5DFXA 5D3OA 3MGQB 3UMEA 3DAVA 3REJB 4KQQA 4WU8B 3AZND 3VSLA 3T4KA 2FJ7A 3U2AA 4F94A 3MS6A 3CWFA 2PRFA 4E3OA 3N8RA 4X23D 3KUYA 3B0DB 4H9RA 5DKKA 3AYWA 1XGIA 5CEDA 2O99A 4WNNA 4L0LA 5B2IC 4J8WB 2FN2A 3PR6A 3IHBA 4Z2MH 5HFOA 5B24C 2EXAA 3AZKB 2ZOHA 1LT0A 4J8XD 3AZEA 2PR6A 3LELB 5FUGA 4KUDC 4FH2A 5GSUB 1VB6A 3QP5A 4JJND 2HIOD 2J3TC 2J9PA 3UTBC
chains in the Genus database with same CATH topology
1IYQA 4IBJA 1M1AC 3LZ0C 2WKEA 4YFMA 5FAPA 3KXBC 2Z2LB 1P3LA 3UPPA 3AZMC 3IXGA 5AV9B 1ERMA 5E2GA 5B40B 3A3EA 2WYXA 3TG9A 3OC2A 5GT0A 3QNCA 3HUMA 4S2NC 3AZNC 1BSGA 4HBUA 4N9LA 5GHZA 4X23C 4E3LA 3MGPD 2EFUA 1O07A 3UTAC 4OLGA 4XZQB 3N7WA 3VP4A 5CHJA 5B2IB 5B24B 3DTMA 5E43A 3VOYA 3P09A 1ES5A 2H0YA 4J8XC 1GHMA 1FOFA 4H9QB 2F8NB 3ZG0A 4KUDB 5DNMA 1S32A 4JJNC 2HIOC 2ZQ8A 5CP6D 1B6WA 3BFCA 3Q81A 3WS5A 1YMXA 3UTBB 3FKVA 1M1AB 3LZ0B 3AV1D 1P3AB 3VP0A 1WWSA 3KXBB 2HDSA 5FA7A 4P87A 1FSWA 2WKHA 3AZMB 2FJ7D 2ZM2A 5E5AA 3KUYD 1TAFB 3AYWD 3W99A 1HTAA 5U47A 1PZOA 4NE6A 3VP1A 1MBLA 1YLJA 1E4DA 3Q82A 3IP4C 4HESA 2P74A 1Z6FA 3AZNB 4JXGA 3MBZA 4P0MA 3HUOA 1PW8A 4X23B 3MGPC 4BD0A 1P3BA 4U0XA 5CXWA 1FQGA 1TEMA 4IEDA 4DRAA 3OZHA 1K56A 4XUZA 2B5RA 3IT9A 2J7VA 1P3LD 2Y4AA 1U35A 1IELA 4J8XB 5AV8B 3EQVA 4QHCA 5B2JC 4NK3A 5E2EA 5DTSA 4JJNB 5GL9A 2HIOB 4ZAMA 3PBTA 5CP6C 4ID4A 2OSUA 1TDGA 3UE3A 3ZNYA 3MGSA 3A3FA 2R9XA 3VFHA 2WZZA 5M19A 5CGXA 1ONGA 4NZ4A 4K0XA 5JYOA 1LHYA 2BLSA 4GHAA 4ZJ1A 2FJ7C 1BH9B 4RA7A 3TU4A 3KUYC 3AZFA 3G32A 3AYWC 3M6HA 3BLSA 2ZC7A 4FD8A 3VSKA 1YU0A 4JF6A 3I7JA 4H9OB 4J8UA 1IKIA 5F1GA 1E3UD 3LJAD 3AZEC 3B6GA 1JWVA 4Z9QA 3V9RB 3N4IA 5DNMD 4BLMA 3W96A 3LZ1A 3MGPB 5DF9A 3HLGA 3AN2B 1ZG4A 1ES4A 4KHAA 1XX2A 2ZQ9A 1K54A 4KZ4A 3PBOA 4CAYB 4ZTKA 1P3LC 5A92A 4WMCA 3HBRA 3GSGA 2JBFA 5E5AD 5CP6B 1L0FA 1O7EA 3UY6A 5KDMA 4OONA 5G49A 3W99D 4IBXA 3PBSA 3CG5A 1P3OA 3AV1B 1ES2A 4KQRA 3C1CA 5GT0C 5CECA 4RYEA 1PWDA 4KZ7A 2Y2GA 2FJ7B 4JBFA 3KUYB 4GN2A 4H9RB 3AYWB 1KE0A 1IYSA 3A3DA 2XD1A 2HP6A 1ESUA 2JCHA 1K56D 4JF5A 3B0BA 1EI5A 1F1EA 4M6BA 3LJAC 1U35D 3PAGA 2QPNA 4MBHA 5FAQA 5DNMC 1S32C 2J8PA 1LL5A 2F8NK 3ZG5A 4JKTA 1TZYA 3IF5A 3MGSD 1GHIA 1KE3A 2BYKA 4E6XA 3C1BB 1P3LB 4IVKA 4LENA 4R3BA 1PI5A 3TU4D 5E5AC 3Q7VB 3VFFA 3AZFD 2H10A 3W99C 5JA4A 5FI2A 4H9NB 3Q1FA 3W97A 4J8UD 1LI0A 1SDNA 3IHAA 3B6GD 3A1IA 1ZLAB 3W96D 2IWDA 5B1LA 2CV5A 3S4XA 5E2FA 4YS3A 2XLNA 4GKUA 4R1GA 3UPOA 3DWKA 1Q2QA 3OCLA 4Y0TA 5FQIA 1U35C 3LJAB 4OOMA 2NQBD 1SHVA 4WMCD 3HLWA 3L29A 5DNMB 1YT4A 2WGVA 3ZFZA 4EBNA 5JRGA 4QLCA 3MGSC 3V3RA 3REHD 3C1CD 2EX6A 2WGWB 3WS0A 3GRJA 3GR2A 4KGCA 3B6FA 3TU4C 1H8YA 2Y2QA 2Z2MB 3AZFC 3W99B 3VMAA 3NQUA 3VH6T 2WAFA 4N1XA 4J8UC 4UA7A 4S2IA 5CRFA 3B6GC 3NIAA 3LCEA 2R9WA 3W96C 3A3IA 5CGSA 3MNNA 2CWEA 3LZ1C 1XP4A 1LL9A 3KSYA 4E3NA 1TZYD 3W4QA 2WK0A 4QNLA 1P3GD 1K54C 4EV4A 2Y59A 3L2AA 1YU1A 4WELA 1PWGA 4AWLC 3E2LA 2XD5A 1U35B 3MXSA 3S22A 3WWXA 1GA0A 3NQJA 1HD8A 1HZOA 4GB7A 3ZCZA 2NZDA 3MGSB 3WA9D 1BTLA 3C1CC 4O7DA 4S2PA 3UE0A 1ESIA 5HAPA 5GLCA 1W2EA 1R4VA 1PWCA 3TU4B 2JE5A 4FSFA 2Y2JA 5B1LD 3AZFB 1FCNA 3A6NA 1I5QA 4YS3D 1YMSA 3G4PA 4K91A 2VGJA 5C3IC 4LCLA 5CHLB 4J8UB 5BNXA 3NY4A 1K57A 5CPID 3B6GB 1YM1A 3BLMA 3W96B 5B31A 4KZ9A 4WEJA 1TZYC 5JRGD 4QLCD 4KHAB 4MEZA 1IKGA 5HW3A 3MZEA 1W8QA 4ZBEA 4C3QA 3HLCA 3VH5A 4AWLB 1EQZA 1C3BA 2NQBB 3B3XA 5AVCA 4CSRB 3HSHA 3B6FD 2P9VA 4Q8IA 4R4RA 1ERQA 1SKFA 4S2KA 5KDMB 5GLBA 4P85A 5G49B 4DE3A 3X1SA 2OLUA 2X01A 3REHB 3C1CB 5KZHA 5B32A 3W97C 4UAAA 2V20A 2PYOA 2YFWA 2Y2IA 3O87A 3GVBA 1P3FA 4H9PA 5B1LC 2CV5C 3UTAD 3SS3A 4YS3C 3D4FA 4OUIA 3MKEA 4DE2A 5C3IB 2HDRA 4G91C 2XEPA 5TFQA 3P5JB 3RELA 2ZD8A 4X68A 3HONA 5CPIC 5A91A 1OMEA 3DWZA 3L25A 3Q07A 3EPKA 5JRGC 3UO9A 1TZYB 4QLCC 1P3GB 2DRWA 4OPZA 2BYKB 4IBEA 3AZHA 2XFSA 4S2MA 3PBQA 4KGCC 4JLFA 3H0RC 3FZCA 5DTKA 2E8IA 3B6FC 4IBIA 3GMWA 5CPKA 3LO7A 3VH6W 3RXWA 3A6ND 4R8PA 3WA9B 4OVDA 3Q7ZA 3OPLA 4IJEA 3VH5W 3IXDA 3LEZA 4KZBA 1S0WA 4MLLA 3CJMA 5B1LB 4Z5TD 3N6IA 4YS3B 4ZJ2A 3S1YA 4LV1A 1IYOA 2WGIA 5EVIA 2UWXA 1NXYA 5BNVA 4G91B 2EXBA 1QMEA 2DNSA 5G18A 4UUZA 4OJPA 1EQZD 5B2JD 5AVCD 4PM9A 5CPIB 5KSCA 3PBNA 3E2KA 5DTTA 4NETA 1P3PA 5JRGB 3X1SD 4QLCB 1L2SA 3HLFA 1ZG6A 3QNBA 4OP8A 3L27A 1CK3A 3W4PA 4DF6A 1BH8A 4KG5A 5B32D 4WZSB 3L26A 4JPMA 2PYOD 4DDSA 3X1UA 1IEMA 5EE8A 4J8VA 2ZQAA 4N1HA 5FATA 2IOUA 3IH8A 4N9KA 4X55A 1HQ3A 3A6NC 2Y2LA 3NDGA 1N1JA 3NQUB 4XUXA 1YLYA 3AGFA 4UPKA 4WZ5A 1FR6A 2V2FF 3O88A 3UE1A 3AZED 3RELD 1K57C 3AZGA 5B0ZA 5GXQA 3KS4A 4NYUA 1PZPA 3UDXA 5HAIA 5B31C 3UTAB 3A3JA 2JSSA 4OKPA 4Z5TC 2PBYA 3EPHA 2ZM0A 4R4SA 5AY8A 4DE1A 5J8XA 3UT9A 3AZHD 5DVAA 1EQZC 5A93A 1S6RA 2F8NH 2EX2A 5AVCC 3NQJB 4GD6A 5CPKD 1XA1A 4DQYB 2V1ZA 3NBLA 1KVLA 5CPJA 3EPJA 4NFTA 3KFUG 3LY4A 3X1SC 4R8PD 5BS7A 5GT0D 3WAAA 3TOIA 5B32C 2ZQCA 3BFDA 4ZUXA 1PZRA 4S2JA 4PM8A 5GHXA 2PYOC 4QJGA 1YLWA 4BL3A 1CI8A 1XGJA 3BFGA 4C6YA 2ZY2A 4H9SA 3A6NB 3V3SA 3PBRA 1L0GA 5DF7A 3RELC 4CJNA 3X1VA 3BFFA 3CMZA 5GLAA 2XFTA 5FQKA 1S32D 3N8SA 1M18A 1M19A 2HUEC 1N4OA 4Z5TB 1E25A 1NYYA 1JFIA 4DXBA 4A5RA 3L28A 3SH7A 3BFEA 3LY3A 1YU4A 3TSGA 3AZHC 1NZOA 2FFFB 3W4OA 1EQZB 5B2JB 5AVCB 3MFDA 1KX5A 2GDNA 3X1UD 3KWQA 2F2AC 5AQ9A 2P9VB 5CPKC 4GHLA 1Y54A 4X53A 3CZDA 1HQ3D 2Y2OA 3X1SB 2C5WB 1ULYA 4R8PC 3IXBA 5B32B 1P34A 3HUNA 5B31G 2PYOB 2YFWB 3AZGD 5B0ZD 5GXQD 3IWQA 1P3BD 3WTPE 3M2JA 3W98A 4WNNB 3MGQA 5EVIC 5AY8D 1WWIA 2BG1A 2DF4C 1KX3A 1MKIA 3AZEB 3RELB 3UT9D 1YUEA 1L0DA 5FUGB 1H3OA 1K6SA 5M18A 3MKFA 1ZC2A 2HUEB 4XXRA 5CPJD 2G5IC 1P3PC 5B32G 1KU5A 3P98A 4PM7A 1DJAA 1LLBA 1YQSA 1Q9CA 2DQNC 4YINA 2FFYA 5GSUA 3AZHB 2ZLYA 2CC1A 4IBGA 4S2LA 5FQ9A 3X1UC 4J8VC 2ZM8A 3ISGA 5CPKB 1HQ3C 4WU9A 3UDFA 4EBLA 4IVIA 4R8PB 3N3FA 1NRFA 3NI9A 4MBKA 1G6AA 2WADA 5GT0B 4EUZA 4WZ5C 5AV9A 2HDUA 4LG2A 3X1VD 3AZGC 5B0ZC 4GH9A 5GXQC 1BULA 5B40A 3AZLA 1M18D 3OPRA 3LZ1D 1P3BC 1M19D 4E3JA 4OQGA 3OCNA 3ZHHA 4JXWA 3HLDA 5AY8C 3EPLA 3ITBA 1DJBA 5E2HA 5BNVB 1SCWA 4UUZB 5KMWA 3UT9C 1P3MA 3EQUA 1W7FA 3G35A 1KX5D 1S32B 1EROA 3B0CT 4XZQA 2J8YA 5B1MA 5CPJC 1BT5A 1P3OD 1DY6A 5HAQA 3G34A 1KGEA 5BS7C 4YM6A 3WAAC 1W79A 3ZVWA 2F8NA 1BH8B 4RVAA 4R23A 1P34D 4HGAC 4ZUXC 5DNNA 4GNUA 5GLDA 3X1UB 5E5AB 2Y91A 5TR7A 3PAEA 1K25A 1HQ3B 4R0QA 1P3AA 4H9SC 3F6TA 4PM5A 1B67A 1CEFA 1N1JB 3MGQD 4KQOA 3OPHA 4S2OA 2WKIA 2ZC6B 1GHPA 5GT3A 1KX3D 3X1VC 3VH5T 3AZGB 5B0ZB 5GXQB 3RXXA 4G92C 5EVLA 1M18C 5AQAA 3SH9A 1M19C 1P3BB 3REKA 4EWFA 2WZXA 1I2SA 3C4PA 1FCOA 3NCKA 4LV2A 1BLCA 2Y2PA 5AY8B 2Y2KA 4WM9A 3A1KA 2HDQA 3AZIA 3IWIA 3GQZA 2OLVA 3ZDJA 3UT9B 4GDBA 4MNRA 1KX5C 3X1TA 3KWQC 1BUEA 4LD9A 5CPJB 2HP9A 1I2WA 2LY8A 4E44A 1MXOA 1P3OC 4WU9D 5AV8A 4OLDA 1JTGA 3W97D 1P34C 1KGGA 1JWPA 4HGAB 4EBPA 4NY2A 2PU4A 5B40D 3AZLD 4E3MA 2CV5D 3IWOA 2XDMA 1ONHA 1N9BA 4X56A 3MGQC 1QMFA 3HVFA 3OPPA 5CERA 1GCEA 4DKIA 1ZKJA 1KX3C 3X1VB 4JXSA 1P3MD 4G92B 1M18B 2G2UA 3LZ1B 3W8KA 1M19B 5B1MD 3WKJA 1W8YA 3WX7A 3ZVTA 2Q9NA 3IF6A 2ZY3A 4YM6D 2I72A 5GSUC 2XQZA 5DNND 1BZAA 4KGCD 1YLTA 2Y2MA 1KX5B 3AN2A 3O3VA 4E3IA 3ZG7B 2A49A 4WBGA 5GHYA 4N92A 1HTZA 1DJCA 2QMIA 1P3AD 2IWBA 2ZY4A 4Y0UA 4WU9C 2WAEA 2ZC4B 1P3OB 1F66A 5IHVA 1MWTA 3VOZA 2XH9A 5AV9C 1P34B 5GT3D 3H0LC 4GZBA 5CP6A 5B40C 2Y2HA 4OQ0A 4Z2MG 3EG5B 3AZLC 4OQHA 3MNND 3WTPA 3REKD 4XUJA 5AQBA 3AV1A 2Y55A 5B0YA 1G68A 1HVBA 2AROA 4HEFA 3SS4A 5AVBA 2G5HC 1MWUA 3M2KA 1M6KA 3AZID 1KX3B 1H5XA 4Y0OA 3B0CW 5FDHA 5F83A 1P3MC 1H3OB 3X1TD 3JYIA 4XZQC 1XKZA 5B1MC 4WJ3C 2ZQ7A 4IBKA 4KG6A 5A90A 4OPQA 1BFMA 4LD9D 2NZDD 5FSRA 4QY5A 5BO0A 3VP3A 4GD8A 4FCFA 5AV8D 5F1FA 4YM6C 4EO5C 2A3UA 5DNNC 3C7UA 4E6WA 3UNWA 1MY8A 1P3AC 1WYCA 4WU9B 3C1BA 5JA4B 3O62A 4BJPA 4KZAA 1P3IA 3AFAA 4OP5A 3W97B 5GT3C 2ZY5A 4Z66A 3Q7VA 1KX4A 5FQJA 1TDLA 3AZLB 4DDYA 3MNNC 3NDEA 5B31D 2CV5B 3REKC 2YFVA 3WKJD 3DW0A 1PW1A 4H9NA 5AV5A 4RX2A 5FI6A 2EX9A 3AZIC 1ZLAA 5BOHA 1P3MB 3AN2D 3X1TC 1YLZA 2BYMA 5B1MB 4Y7PA 4LD9C 1BLHA 4LV0A 2NZDC 3O86A 4NYYA 4ZJ3A 1E3UA 4LCMA 3AV2A 1F66D 2EFXA 4NE5A 3LJAA 5AV8C 3AZJA 4YM6B 4M3KA 4EO5B 1BLPA 5DNNB 4JXVA 4KGCB 3WS2A 2WUQA 1P3FD 3B6FB 4OJ5A 4GOGA 4H8RA 3NC8A 3WTPD 3IXHA 1CEGA 4XUJD 3ZNTA 5EECA 4BL2A 4X6TA 2OV5A 5B0YD 3WS4A 2WGWA 2AROD 3WRZA 3KS8A 5AVBD 3V50A 4LV3A 2ZJ9A 4U3TA 5GT3B 3G2ZA 5CEBA 2ZMAA 1T3UA 3SOIA 3WS1A 1YLPA 4RX3A 3SH8A 4D2OA 3G30A 3MNNB 4NE3A 3REKB 4WZ4A 3WKJC 2F8NG 4PM6A 3IF6C 3IQAA 1RGZA 1NY0A 3AZIB 3FV7A 3AGDA 1NJ4A 1GA9A 4PPRA 2RL3A 4IBFA 3AN2C 4U0TA 4QU3A 3X1TB 1KGFA 2H0TA 2C6WB 1KDSA 4LD9B 2NZDB 4UA6A 2VGKA 1J9MA 3REIA 2IO5C 3IH9A 3C1BD 1F66C 3BEBA 3O62D 4FH4A 1P3ID 3AFAD 4QB8A 1K4FA 4Z66D 1KX4D 3G31A 1P3FC 1VM1A 5AV6A 3WTPC 4XUJC 3AV1C 3HLBA 3UDIA 4WEKA 5B0YC 5AV5D 2AROC 5EVID 2RVQD 4KENB 5AVBC 4OPRA 1SDEA 5BNXB 3AL0C 2RCXA 1ZLAD 3FDDA 4UHUA 3HREA 5B31B 1JVJA 3WRTA 4ZBJC 1KVMA 3WKJB 1ID3A 1AOIA 1P3PD 3RJUA 4KZ3A 2X02A 3AV2D 3IF6B 4MBFA 3AZJD 1XPBA 5F99A 3R45A 3MVDA 4KZ5A 2XF3A 1M40A 4J8VD 1VQQA 2RIQA 4KG2A 3BECA 3MGRA 5CHUA 4OJ6A 5I94A 2IO5B 3C1BC 1ALQA 1F66B 3O62C 1P3IC 2NQBA 3AFAC 3BM6A 4CSRA 4OH0A 4IBBA 4Z66C 1KX4C 1P3FB 1FR1A 3FWLA 5CHMA 4H9PB 1BLSA 3UN7A 1P3KA 3WTPB 1XXMA 4XUJB 4QY6A 3REHA 5B33A 5AV5C 5B0YB 2ZC3B 2AROB 4E3KA 2RVQC 1JTDA 3REJA 4WU8A 5AVBB 5HL1A 1ZLAC 3AGEA 4R3JA 5BT1D 3ITAA 4J8WA 4ZBJB 3MZDA 3ZG8B 4DXCA 3REID 5JYPA 3AZKA 5BO0B 3AV2C 3LELA 3WAAD 3AZJC 2W8SA 1ES3A 4IBCA 2XGNA 4ZUXD 1FCMA 1K55A 4BQMA 3SS5A 5FASA 2IWCA 5AV6D 1P3GA 4WYYA 4B4XA 4OPYA 3PTEA 1AXBA 4NZ1A 3MZFA 4P6BA 3O62B 1P3IB 3AFAB 3H0MC 4Z66B 1KX4B 3GV9A 3BYDA 1U60A 4BENA 1XA7A 3WA9A 2YFVB 3G2YA 1ID3D 1AOID 4UA9A 2VQRA 5AV5B 5EVIB 2XR0A 1MWSA 5F99D 3MVDD 4OOLA 5FI7A 5HARA 3MXRA 5BT1C 2ZM5A 2Y2NA 1RP5A 3KWQD 3N8LA 4IBRA 4C75A 2BYMB 3MGRD 5B2IA 3BRMA 5B24A 1P3PB 2G2WA 2L5AA 3REIC 5FQQA 2DCFA 4H9QA 3AV2B 3FYZA 4PMAA 3AZJB 5CPIA 4KUDA 1RCJA 1CI9A 4DRTA 4NZ5A 4J8VB 3M6BA 3UTBA 4WV4B 3UPNA 1YU2A 2QZ6A 5AV6C 1M1AA 3LZ0A 1P3KD 3KXBA 3W98D 4EQIA 1WE4A 5B33D 1WYBA 5M1AA 5EOEA 3REJD 1FSYA 3AZMA 4WU8D 2JC7A 2ZQDA 1Q2PA 5CTMA 4OJOA 1TAFA 4JF4A 2PU2A 4OOYA 4J8WD 3C7VA 1ID3C 1AOIC 3FKEA 1RGYA 3ZGAB 3AZKD 5L2FA 4S2NA 3LELD 3AZNA 4DE0A 5GSUD 2X71A 2Q9MA 5F99C 1L0EA 4X23A 3MVDC 1IYPA 1LI9A 3UTAA 3MGRC 4X69A 5AQ7A 4OQIA 1Z2CB 3REIB 5FAOA 5EUAA 5FQMA 4J8XA 1NYMA 2NQBC 3WAAB 4IBDA 5AV9D 4ZUXB 4JJNA 3V39A 2HIOA 2EX8A 1KDWA 4E45A 5CGWA 5AV6B 2H5SA 4DRBA 1P3KC 3W98C 3REHC 5B33C 3HLEA 1KE4A 3REJC 4WU8C 1PI4A 2XK1A 1JWZA 5TGFA 1BH9A 1K6RA 3V5MA 3B0DC 1MWRA 4XZQD 5F82A 3VP2A 3C5AA 1PYYA 5CTNA 4B88A 4J8WC 3QHYA 5B2ID 1ID3B 4H9OA 1AOIB 1JFIB 5B24D 5KSHA 4NZ3A 3AZKC 3GTCA 1YU3A 3LELC 3C4OA 3FKWA 2F8ND 4KUDD 3V9RA 1TVFA 1K38A 4ZDXA 5F99B 1K4EA 4GDNA 4B4ZA 4CPKA 3MGPA 1K55C 4BD1A 3R45B 3MVDB 2ZC5B 4IJFA 2HPBA 4KZ6A 5BPVA 5EOOA 4Z5TA 3KWQB 4HBTA 3UTBD 4K0WA 1MPLA 2J9OA 3VH6A 3MGRB 1EWZA 4QD4A 1P3GC 1M1AD 3LZ0D 5DF8A 4CAYA 5EPHA 3KXBD 3HL9A 5HX9A 1PIOA 4KZ8A 2HP5A 5B2JA 3AZMD 1H8ZA 1W5DA 1NZUA 1A7WA 4OJLA 1P3KB 3WA9C 3ZG9B 3W98B 5B33B 5D3OA 3MGQB 3REJB 4KQQA 4WU8B 3AZND 3VSLA 2FJ7A 4F94A 4E3OA 3N8RA 4X23D 3KUYA 3B0DB 4H9RA 3AYWA 1XGIA 5CEDA 4WNNA 4L0LA 5B2IC 4J8WB 3IHBA 4Z2MH 5HFOA 5B24C 2EXAA 3AZKB 4J8XD 3AZEA 3LELB 5FUGA 4KUDC 4FH2A 5GSUB 4JJND 2HIOD 2J9PA 3UTBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFY A;  1IYQ A;  1HD8 A;  1HZO A;  4GB7 A;  3IH9 A;  2ZLY A;  2CC1 A;  3BEB A;  3ZCZ A;  2WKE A;  4S2L A;  5FQ9 A;  4FH4 A;  4YFM A;  5FAP A;  4QB8 A;  2Z2L B;  2ZM8 A;  3ISG A;  1K4F A;  1BTL A;  3UPP A;  3G31 A;  3IXG A;  1VM1 A;  4O7D A;  3UDF A;  4EBL A;  4IVI A;  1ERM A;  4S2P A;  5E2G A;  1NRF A;  3UE0 A;  1ESI A;  3NI9 A;  4MBK A;  1G6A A;  2WAD A;  3A3E A;  3HLB A;  4WEK A;  5GLC A;  3UDI A;  4EUZ A;  5HAP A;  4WZ5 C;  2WYX A;  1PWC A;  2HDU A;  3TG9 A;  5EVI D;  2JE5 A;  4FSF A;  2Y2J A;  4KEN B;  3OC2 A;  1BUL A;  4OPR A;  1FCN A;  1I5Q A;  1SDE A;  2RCX A;  1YMS A;  3QNC A;  3OPR A;  3HUM A;  3G4P A;  4K91 A;  2VGJ A;  4S2N C;  4LCL A;  1BSG A;  4HBU A;  4OQG A;  4UHU A;  4E3J A;  4N9L A;  5GHZ A;  3OCN A;  3ZHH A;  3HRE A;  3NY4 A;  4E3L A;  4JXW A;  3HLD A;  1JVJ A;  2EFU A;  3WRT A;  1O07 A;  1K57 A;  1KVM A;  3ITB A;  1YM1 A;  1DJB A;  5E2H A;  4OLG A;  3RJU A;  4KZ3 A;  1SCW A;  2X02 A;  3BLM A;  3N7W A;  3VP4 A;  5KMW A;  5CHJ A;  4KZ9 A;  3IF6 B;  3EQU A;  1W7F A;  3G35 A;  4MBF A;  1XPB A;  4WEJ A;  3DTM A;  5E43 A;  3VOY A;  1ERO A;  2J8Y A;  3P09 A;  1ES5 A;  2H0Y A;  4MEZ A;  1IKG A;  1GHM A;  1FOF A;  4KZ5 A;  2XF3 A;  1W8Q A;  3MZE A;  5HW3 A;  1M40 A;  1BT5 A;  4ZBE A;  1VQQ A;  4C3Q A;  3ZG0 A;  3HLC A;  4KG2 A;  3BEC A;  2ZQ8 A;  1C3B A;  3B3X A;  1DY6 A;  3BFC A;  5CHU A;  3G34 A;  5HAQ A;  3Q81 A;  1KGE A;  3WS5 A;  1YMX A;  1W79 A;  3ZVW A;  5I94 A;  4RVA A;  4R23 A;  2P9V A;  3FKV A;  1ALQ A;  4Q8I A;  4R4R A;  1ERQ A;  1SKF A;  4GNU A;  4S2K A;  3VP0 A;  3BM6 A;  5GLD A;  5GLB A;  4P85 A;  2HDS A;  4OH0 A;  5FA7 A;  4DE3 A;  4P87 A;  1FSW A;  2OLU A;  2Y91 A;  5TR7 A;  2X01 A;  2WKH A;  3PAE A;  1K25 A;  4R0Q A;  1FR1 A;  3FWL A;  5KZH A;  5CHM A;  2ZM2 A;  4UAA A;  1BLS A;  3UN7 A;  4PM5 A;  1CEF A;  1XXM A;  2V20 A;  4KQO A;  3OPH A;  4QY6 A;  2Y2I A;  3O87 A;  3GVB A;  4S2O A;  2WKI A;  2ZC6 B;  1GHP A;  2ZC3 B;  4E3K A;  1JTD A;  5U47 A;  1PZO A;  3SS3 A;  3VP1 A;  1MBL A;  1YLJ A;  3RXX A;  5EVL A;  3D4F A;  5HL1 A;  1E4D A;  3Q82 A;  5AQA A;  3SH9 A;  3MKE A;  4DE2 A;  4EWF A;  4HES A;  2P74 A;  1I2S A;  2WZX A;  3AGE A;  1Z6F A;  1FCO A;  3C4P A;  2HDR A;  3NCK A;  2XEP A;  4JXG A;  4R3J A;  4LV2 A;  3MBZ A;  1BLC A;  4P0M A;  5TFQ A;  3HUO A;  3ITA A;  2Y2P A;  1PW8 A;  2ZD8 A;  4BD0 A;  2Y2K A;  4X68 A;  4U0X A;  3MZD A;  4WM9 A;  5A91 A;  3ZG8 B;  2HDQ A;  4DXC A;  1OME A;  5JYP A;  3IWI A;  3GQZ A;  1FQG A;  1TEM A;  2OLV A;  4IED A;  5CXW A;  3DWZ A;  3ZDJ A;  3OZH A;  3Q07 A;  1K56 A;  4XUZ A;  4GDB A;  4MNR A;  2B5R A;  3IT9 A;  1ES3 A;  2J7V A;  3UO9 A;  2XGN A;  2Y4A A;  1BUE A;  1FCM A;  1IEL A;  1K55 A;  3EQV A;  2HP9 A;  4QHC A;  4NK3 A;  1I2W A;  4BQM A;  2DRW A;  3SS5 A;  5FAS A;  4OPZ A;  5E2E A;  1MXO A;  5DTS A;  2IWC A;  2XFS A;  5GL9 A;  4S2M A;  4ZAM A;  3PBT A;  3PBQ A;  4ID4 A;  4WYY A;  4B4X A;  2OSU A;  4JLF A;  1TDG A;  4OLD A;  4OPY A;  3UE3 A;  3FZC A;  1JTG A;  3PTE A;  5DTK A;  1AXB A;  2E8I A;  3ZNY A;  1KGG A;  3A3F A;  1JWP A;  3GMW A;  3MZF A;  2R9X A;  4P6B A;  3LO7 A;  4EBP A;  3VFH A;  2WZZ A;  3RXW A;  2PU4 A;  5M19 A;  5CGX A;  1ONG A;  4E3M A;  4K0X A;  5JYO A;  3IWO A;  1LHY A;  2BLS A;  2XDM A;  4OVD A;  3Q7Z A;  3GV9 A;  3OPL A;  4ZJ1 A;  3BYD A;  1ONH A;  1N9B A;  1U60 A;  4X56 A;  4RA7 A;  3IXD A;  3LEZ A;  4BEN A;  4KZB A;  1XA7 A;  1S0W A;  1QMF A;  3HVF A;  3OPP A;  4MLL A;  3G2Y A;  3G32 A;  4UA9 A;  3M6H A;  3CJM A;  5CER A;  1GCE A;  4DKI A;  1ZKJ A;  2ZC7 A;  3BLS A;  4FD8 A;  5EVI B;  3VSK A;  4JF6 A;  2XR0 A;  3I7J A;  4JXS A;  1MWS A;  3N6I A;  1IKI A;  5F1G A;  1E3U D;  2G2U A;  4ZJ2 A;  3S1Y A;  4LV1 A;  3W8K A;  1IYO A;  2WGI A;  5EVI A;  4OOL A;  5FI7 A;  2UWX A;  5HAR A;  3MXR A;  1NXY A;  1RP5 A;  2Y2N A;  1JWV A;  1QME A;  2DNS A;  2EXB A;  3N8L A;  4IBR A;  1W8Y A;  3N4I A;  4Z9Q A;  5G18 A;  4BLM A;  4C75 A;  3ZVT A;  2Q9N A;  5DF9 A;  3HLG A;  3IF6 A;  3BRM A;  4PM9 A;  5KSC A;  2G2W A;  1ZG4 A;  2I72 A;  3PBN A;  1ES4 A;  5FQQ A;  1XX2 A;  2ZQ9 A;  2DCF A;  2XQZ A;  1K54 A;  3E2K A;  1BZA A;  3FYZ A;  4KZ4 A;  3PBO A;  5DTT A;  1YLT A;  4ZTK A;  4PMA A;  2Y2M A;  4E3I A;  3O3V A;  4NET A;  3ZG7 B;  1RCJ A;  2A49 A;  4WBG A;  5A92 A;  1CI9 A;  1L2S A;  5GHY A;  3HLF A;  4DRT A;  4WMC A;  4N92 A;  1ZG6 A;  3QNB A;  3M6B A;  1HTZ A;  3HBR A;  4OP8 A;  1CK3 A;  1DJC A;  2QMI A;  3W4P A;  4DF6 A;  4KG5 A;  2IWB A;  3UPN A;  2QZ6 A;  3GSG A;  4Y0U A;  2ZC4 B;  2WAE A;  2JBF A;  5IHV A;  1MWT A;  3VOZ A;  4JPM A;  1L0F A;  4DDS A;  1IEM A;  5EE8 A;  1O7E A;  1WE4 A;  2ZQA A;  4N1H A;  2XH9 A;  3UY6 A;  4OON A;  5FAT A;  4EQI A;  1WYB A;  4IBX A;  3IH8 A;  3PBS A;  3CG5 A;  5EOE A;  5M1A A;  4N9K A;  4GZB A;  4X55 A;  1ES2 A;  1FSY A;  4KQR A;  2Y2H A;  5CEC A;  2Y2L A;  3NDG A;  4OQ0 A;  2JC7 A;  4RYE A;  4OQH A;  1PWD A;  2ZQD A;  1Q2P A;  5CTM A;  5AQB A;  4XUX A;  2Y55 A;  1YLY A;  4KZ7 A;  2Y2G A;  3AGF A;  4JF4 A;  2PU2 A;  2V2F F;  1FR6 A;  1G68 A;  1HVB A;  4WZ5 A;  4OOY A;  3O88 A;  4JBF A;  3UE1 A;  4GN2 A;  4HEF A;  3SS4 A;  1K57 C;  3C7V A;  1MWU A;  1RGY A;  3M2K A;  1KE0 A;  1M6K A;  1IYS A;  1PZP A;  3UDX A;  3ZGA B;  1H5X A;  3A3D A;  2XD1 A;  4Y0O A;  5L2F A;  4S2N A;  5HAI A;  2HP6 A;  1ESU A;  5FDH A;  3A3J A;  2JCH A;  4OKP A;  5F83 A;  1K56 D;  4JF5 A;  4DE0 A;  2PBY A;  2X71 A;  1EI5 A;  3JYI A;  2Q9M A;  1XKZ A;  1L0E A;  5A90 A;  2ZQ7 A;  2ZM0 A;  3PAG A;  4KG6 A;  4OPQ A;  1IYP A;  4R4S A;  2QPN A;  4DE1 A;  1LI9 A;  4MBH A;  5FAQ A;  5J8X A;  5FSR A;  4QY5 A;  3VP3 A;  4GD8 A;  5DVA A;  1LL5 A;  4X69 A;  1S6R A;  4FCF A;  5A93 A;  2EX2 A;  5AQ7 A;  4OQI A;  3ZG5 A;  5F1F A;  4JKT A;  2A3U A;  5FAO A;  5EUA A;  3IF5 A;  5FQM A;  4GD6 A;  1XA1 A;  2V1Z A;  3NBL A;  1KVL A;  1NYM A;  3C7U A;  1GHI A;  4E6W A;  1KE3 A;  4E6X A;  3LY4 A;  3UNW A;  3V39 A;  1MY8 A;  2EX8 A;  1KDW A;  4IVK A;  4LEN A;  4R3B A;  3TOI A;  1WYC A;  5CGW A;  2ZQC A;  3BFD A;  1PI5 A;  2H5S A;  4S2J A;  3Q7V B;  3VFF A;  4PM8 A;  5GHX A;  4BJP A;  4KZA A;  4QJG A;  2H10 A;  4OP5 A;  1YLW A;  3HLE A;  4BL3 A;  1CI8 A;  1KE4 A;  1XGJ A;  3BFG A;  4C6Y A;  5FI2 A;  3Q7V A;  5FQJ A;  1PI4 A;  2XK1 A;  1JWZ A;  1TDL A;  5TGF A;  3Q1F A;  1K6R A;  4DDY A;  1LI0 A;  3NDE A;  1SDN A;  3V5M A;  3IHA A;  3V3S A;  1MWR A;  3DW0 A;  1PW1 A;  3PBR A;  4RX2 A;  5F82 A;  1L0G A;  3VP2 A;  3C5A A;  5DF7 A;  5FI6 A;  1PYY A;  4CJN A;  2IWD A;  5CTN A;  3BFF A;  3QHY A;  2EX9 A;  3CMZ A;  5GLA A;  4B88 A;  2XFT A;  5FQK A;  3S4X A;  5KSH A;  5E2F A;  3N8S A;  2XLN A;  4GKU A;  3GTC A;  4R1G A;  5BOH A;  1N4O A;  3UPO A;  3C4O A;  3DWK A;  1E25 A;  1NYY A;  3FKW A;  1Q2Q A;  3OCL A;  4Y0T A;  4DXB A;  1TVF A;  1K38 A;  4ZDX A;  4GDN A;  1K4E A;  1YLZ A;  5FQI A;  3SH7 A;  4A5R A;  4B4Z A;  4CPK A;  4BD1 A;  1K55 C;  4OOM A;  4Y7P A;  1BLH A;  2ZC5 B;  3BFE A;  2HPB A;  1SHV A;  3LY3 A;  4KZ6 A;  4LV0 A;  4WMC D;  3O86 A;  5EOO A;  3HLW A;  4HBT A;  3TSG A;  4K0W A;  1MPL A;  4ZJ3 A;  1E3U A;  1NZO A;  2FFF B;  2J9O A;  1EWZ A;  4LCM A;  4QD4 A;  1YT4 A;  3W4O A;  2WGV A;  2EFX A;  5DF8 A;  5EPH A;  3MFD A;  3ZFZ A;  2GDN A;  4EBN A;  4M3K A;  3HL9 A;  5HX9 A;  5AQ9 A;  1PIO A;  2P9V B;  4KZ8 A;  1BLP A;  4JXV A;  2HP5 A;  3V3R A;  1Y54 A;  3WS2 A;  4X53 A;  3CZD A;  2WUQ A;  1H8Z A;  4GOG A;  2EX6 A;  2WGW B;  4H8R A;  3WS0 A;  1W5D A;  1NZU A;  2Y2O A;  3NC8 A;  3GRJ A;  2C5W B;  3IXH A;  1CEG A;  3ZNT A;  3GR2 A;  5EEC A;  4BL2 A;  3IXB A;  4X6T A;  2OV5 A;  3WS4 A;  2WGW A;  1H8Y A;  2Y2Q A;  3WRZ A;  3HUN A;  2Z2M B;  3ZG9 B;  3V50 A;  3IWQ A;  4LV3 A;  5D3O A;  2ZJ9 A;  4U3T A;  3VMA A;  3G2Z A;  5CEB A;  2ZMA A;  4KQQ A;  2WAF A;  3VSL A;  4N1X A;  3SOI A;  3M2J A;  3WS1 A;  1YLP A;  4RX3 A;  4F94 A;  3SH8 A;  4D2O A;  3G30 A;  4E3O A;  3N8R A;  4UA7 A;  4S2I A;  5EVI C;  4WZ4 A;  5CRF A;  2BG1 A;  1XGI A;  3NIA A;  5CED A;  3LCE A;  2R9W A;  3A3I A;  5CGS A;  1MKI A;  4L0L A;  1XP4 A;  1L0D A;  4PM6 A;  3IF6 C;  3IQA A;  3IHB A;  5HFO A;  1K6S A;  1LL9 A;  1RGZ A;  1NY0 A;  2EXA A;  4E3N A;  5M18 A;  3MKF A;  3W4Q A;  2WK0 A;  3FV7 A;  1ZC2 A;  3AGD A;  1K54 C;  4EV4 A;  1NJ4 A;  2Y59 A;  4XXR A;  1GA9 A;  4PPR A;  2RL3 A;  4FH2 A;  4U0T A;  4QU3 A;  4WEL A;  1KGF A;  2H0T A;  2C6W B;  2XD5 A;  1PWG A;  3E2L A;  1DJA A;  1KDS A;  3MXS A;  3P98 A;  4PM7 A;  4UA6 A;  2J9P A;  2VGK A;  1J9M A;  1LLB A;  3S22 A;  3WWX A;  1YQS A;  1GA0 A;  4YIN A; 
#chains in the Genus database with same CATH topology
 1IYQ A;  3H7W B;  4IBJ A;  1VHM A;  1M1A C;  3LZ0 C;  3KSG A;  2WKE A;  4YFM A;  5FAP A;  4LRX C;  3KXB C;  1TS8 A;  2Z2L B;  1P3L A;  1IOU A;  3UPP A;  3AZM C;  3IXG A;  5AV9 B;  3G6O A;  4I38 A;  4FUW A;  4G3K A;  1ERM A;  1LSX A;  5E2G A;  5B40 B;  3A3E A;  1XFQ A;  2WYX A;  4Y3I A;  3TG9 A;  3OC2 A;  1T19 A;  5GT0 A;  3QNC A;  4R70 A;  3HUM A;  4S2N C;  3JVU A;  1YPR A;  3H9W A;  3AZN C;  1BSG A;  4HBU A;  4N9L A;  5GHZ A;  3WD1 A;  3JPU A;  4X23 C;  4E3L A;  3MGP D;  2EFU A;  1O07 A;  1PRQ A;  3UTA C;  1CF0 A;  4OLG A;  4XZQ B;  3N7W A;  4NXE A;  3LR5 A;  3VP4 A;  3MSH A;  5CHJ A;  5B2I B;  2Q0O A;  3B42 A;  4HMD A;  5B24 B;  3DTM A;  5E43 A;  3VOY A;  3P09 A;  1ES5 A;  2H0Y A;  4J8X C;  1GHM A;  1XJ6 A;  1FOF A;  4H9Q B;  5HWV A;  2JKR M;  2F8N B;  3ZG0 A;  1XJ3 A;  4KUD B;  5DNM A;  1S32 A;  1OTI A;  4JJN C;  2HIO C;  1P97 A;  2ZQ8 A;  2LB9 A;  5CP6 D;  1B6W A;  3BFC A;  3Q81 A;  3ZQ5 A;  3WS5 A;  1YMX A;  1ZHH B;  4MN5 A;  3UTB B;  1PNE A;  3E4Q A;  3FKV A;  3IBR A;  1M1A B;  3LZ0 B;  3AV1 D;  1OTB A;  3TE8 A;  3D3O A;  1P3A B;  2P08 A;  3VP0 A;  1WWS A;  3KXB B;  3TJZ C;  2HDS A;  5FA7 A;  2KDK A;  4P87 A;  1FSW A;  3W2Z A;  5HPF A;  4NXF A;  2WKH A;  3AZM B;  1NWZ A;  2FJ7 D;  2PYR A;  2ZM2 A;  5E5A A;  2KOI A;  4Y2F A;  3KUY D;  2VKS A;  1TAF B;  3AYW D;  3W99 A;  1HTA A;  2W3F A;  1OJ5 A;  5U47 A;  3OOV A;  1PZO A;  4NE6 A;  3VP1 A;  1MBL A;  1YLJ A;  1F9I A;  4LRZ E;  1E4D A;  3Q82 A;  3IP4 C;  4HES A;  2P74 A;  1Z6F A;  3AZN B;  2K7S A;  2XA7 S;  4JXG A;  3R7W B;  3MBZ A;  4P0M A;  3HUO A;  1PW8 A;  4X23 B;  3MGP C;  4BD0 A;  1P3B A;  4U0X A;  1AWI A;  5CXW A;  1FQG A;  1TEM A;  4IED A;  4DRA A;  5CX7 A;  3OZH A;  3QP2 A;  4Z1W A;  1K56 A;  4XUZ A;  2B5R A;  3IT9 A;  2J7V A;  1P3L D;  2Y4A A;  2R78 A;  1U35 A;  1IEL A;  4J8X B;  1AIW A;  5AV8 B;  3EQV A;  2JKT I;  1S1Y A;  4QHC A;  5B2J C;  4NK3 A;  3D72 A;  4O01 A;  5IT5 A;  5E2E A;  3LGO A;  5DTS A;  4JJN B;  5GL9 A;  2HIO B;  4ZAM A;  3PBT A;  5CP6 C;  3MXQ A;  4ID4 A;  2OSU A;  1TDG A;  3UE3 A;  3M7P A;  5I5L A;  3ZNY A;  1J3W A;  3MGS A;  3A3F A;  2R9X A;  4GHI B;  3VFH A;  2WZZ A;  5M19 A;  5CGX A;  1ONG A;  4NZ4 A;  4K0X A;  2D49 A;  1F5M A;  1LHY A;  2BLS A;  4GHA A;  5JYO A;  5F68 A;  4ZJ1 A;  2FJ7 C;  1W63 Q;  2AVX A;  1BH9 B;  4RA7 A;  3TU4 A;  3KUY C;  3AZF A;  3G32 A;  3AYW C;  3H82 B;  3M6H A;  3BLS A;  2ZC7 A;  1TD5 A;  3MJQ A;  3BWL A;  4WLA A;  4FD8 A;  3VSK A;  1YU0 A;  4JF6 A;  3I7J A;  4YWZ A;  3NHQ A;  4H9O B;  4J8U A;  2PT7 A;  1IKI A;  5F1G A;  5EM0 A;  1E3U D;  3LJA D;  3MQ0 A;  3V67 A;  3AZE C;  3O5Y A;  3B6G A;  1JWV A;  1Z09 A;  4Z9Q A;  3V9R B;  3N4I A;  5DNM D;  4BLM A;  3W96 A;  1XJ2 A;  3F1O A;  2V8F A;  3LZ1 A;  3MGP B;  5DF9 A;  3HLG A;  3FPW A;  2BTF P;  3AN2 B;  3UE6 A;  1ZG4 A;  1ES4 A;  1UGU A;  4KHA A;  1XX2 A;  1E6R A;  2W1T A;  2ZQ9 A;  1K54 A;  4KZ4 A;  3PBO A;  2OAP 1;  4CAY B;  4ZTK A;  4XT2 B;  4IHQ A;  3T4O A;  1P3L C;  5A92 A;  2QHK A;  4WMC A;  4NXB A;  4F3L A;  3HBR A;  3GSG A;  5HDS A;  2JBF A;  5E5A D;  5CP6 B;  3WD3 A;  1L0F A;  3LEQ A;  1O7E A;  3UY6 A;  5KDM A;  2V1A A;  4OON A;  4HJ6 A;  5G49 A;  4EUV A;  3W99 D;  2L0W A;  4IBX A;  4I39 A;  3PBS A;  3CG5 A;  4QWO A;  1P3O A;  3AV1 B;  1ES2 A;  4KQR A;  3C1C A;  5GT0 C;  5CEC A;  4RYE A;  4BBV A;  4YOF A;  1PWD A;  4KZ7 A;  4NKP A;  2Y2G A;  2FJ7 B;  5L07 A;  4JBF A;  4EXO A;  4TX8 A;  3T1Q B;  3KUY B;  4GN2 A;  4H9R B;  3F1P A;  3AYW B;  4BWI A;  1KE0 A;  2B95 A;  1E88 A;  1IYS A;  3A3D A;  2XD1 A;  2HP6 A;  1ESU A;  2JCH A;  1K56 D;  4JF5 A;  3B0B A;  1T1B A;  1EI5 A;  3LUQ A;  1F1E A;  4M6B A;  3LJA C;  1U35 D;  3PAG A;  2QPN A;  2VEA A;  4HH2 A;  4MBH A;  5FAQ A;  1P0Z A;  5DNM C;  1S32 C;  2J8P A;  3GDI A;  1LL5 A;  2F8N K;  3CLO A;  1E8B A;  3ZG5 A;  4JKT A;  1GOI A;  1TZY A;  3IF5 A;  3MGS D;  1GHI A;  1KE3 A;  5MC7 A;  2BYK A;  4E6X A;  5DFY A;  3C1B B;  1P3L B;  4UEY A;  4IVK A;  4LEN A;  4PHT A;  4R3B A;  1PI5 A;  3TU4 D;  5E5A C;  3Q7V B;  3VFF A;  4BBU A;  3AZF D;  2H10 A;  5HWT A;  4DN0 A;  3W99 C;  5JA4 A;  5FI2 A;  1E6Z A;  4H9N B;  4JGP A;  3Q1F A;  3W97 A;  4J8U D;  2WKP A;  1LI0 A;  1OT6 A;  1SDN A;  3IHA A;  5EV0 A;  3PHY A;  4ETX A;  2KX6 A;  3B6G D;  2K2N A;  3A1I A;  1ZLA B;  3W96 D;  2IWD A;  5B1L A;  2CV5 A;  3S4X A;  5E2F A;  4YS3 A;  2XLN A;  4GKU A;  4R1G A;  3UPO A;  3DWK A;  1Q2Q A;  3OCL A;  4Y0T A;  2B18 A;  5FQI A;  1U35 C;  3LJA B;  4OOM A;  2NQB D;  1SHV A;  4WMC D;  5TBM B;  3L7H A;  3HLW A;  3WD2 A;  3L29 A;  5DNM B;  1GPF A;  4Q0I A;  1YT4 A;  2WGV A;  3KO6 A;  4JGO A;  3ZFZ A;  2O9B A;  1YSP A;  4MB3 A;  1UWP X;  4EBN A;  4P6Z M;  5JRG A;  4QLC A;  3MGS C;  4GJ4 A;  5HWW A;  4O8G A;  3V3R A;  3REH D;  3C1C D;  2EX6 A;  2WGW B;  3WS0 A;  3GRJ A;  3GR2 A;  4KGC A;  3B6F A;  4CQH A;  3TU4 C;  5F6A A;  1H8Y A;  2Y2Q A;  2JN7 A;  2Z2M B;  3AZF C;  3JVV A;  3W99 B;  4Y17 A;  3VMA A;  3NQU A;  3VH6 T;  3T1R A;  2Z6D A;  2WAF A;  3QP4 A;  4N1X A;  4J8U C;  4IJG A;  1HLU P;  2INW A;  4UA7 A;  4S2I A;  5J3W A;  5AJG A;  5CRF A;  3B6G C;  1S4R A;  3NIA A;  3LCE A;  2R9W A;  3W96 C;  2W3D A;  3A3I A;  5CGS A;  1Y4O A;  3MNN A;  2CWE A;  3LZ1 C;  1XP4 A;  3VE3 A;  1LL9 A;  3KSY A;  3E98 A;  4E3N A;  2V0W A;  1TZY D;  3W4Q A;  2WK0 A;  4QNL A;  1DP6 A;  1P3G D;  1K54 C;  4EV4 A;  2Y59 A;  3L2A A;  2VJW A;  1QO6 A;  1YU1 A;  4WEL A;  1PWG A;  4AWL C;  2XD5 A;  1U35 B;  3E2L A;  3MXS A;  2A24 A;  3S22 A;  3WWX A;  1GA0 A;  3WD4 A;  3NQJ A;  1HD8 A;  1HZO A;  4GB7 A;  5FDS A;  2HZ5 A;  3ZCZ A;  4PAU A;  3F1N A;  5TJJ A;  2NZD A;  3MGS B;  3WA9 D;  1BTL A;  5KIZ A;  5J7E A;  1TS6 A;  3C1C C;  4O7D A;  2GJ3 A;  2K31 A;  2Z6C A;  4S2P A;  3UE0 A;  1ESI A;  5HAP A;  3VE4 A;  5GLC A;  1W2E A;  1N9O A;  1R4V A;  1PWC A;  3TU4 B;  2JE5 A;  4FSF A;  2Y2J A;  5B1L D;  3AZF B;  1FCN A;  3A6N A;  1I5Q A;  4YS3 D;  1YMS A;  3A0V A;  3G4P A;  4K91 A;  2VGJ A;  5C3I C;  4LCL A;  3IX4 A;  5CHL B;  4J8U B;  5BNX A;  3HCY A;  3NY4 A;  1N9L A;  1K57 A;  5CPI D;  3B6G B;  1YM1 A;  4MDZ A;  3BLM A;  3W96 B;  3F1O B;  5B31 A;  2J3T D;  4KZ9 A;  3C30 A;  4WEJ A;  4GLQ A;  3T1X A;  1TZY C;  5JRG D;  4QLC D;  4KHA B;  2W1T B;  1IKG A;  4MEZ A;  5HW3 A;  3MZE A;  1W8Q A;  4ZBE A;  1S66 L;  2JKR I;  4C3Q A;  3HLC A;  3VH5 A;  4AWL B;  1EQZ A;  1C3B A;  2NQB B;  3B3X A;  5AVC A;  4F3L B;  4CSR B;  3HSH A;  1ACF A;  3B6F D;  2P9V A;  4Q8I A;  4R4R A;  1ERQ A;  1SKF A;  4S2K A;  5KDM B;  5GLB A;  3VOL A;  4P85 A;  5G49 B;  2MJ6 A;  4DE3 A;  3X1S A;  2OLU A;  2X01 A;  5LBR A;  3REH B;  3C1C B;  5KZH A;  3DBA A;  5B32 A;  3W97 C;  4UAA A;  2EA9 A;  2V20 A;  2PYO A;  2YFW A;  2Y2I A;  3O87 A;  3GVB A;  1P3F A;  4H9P A;  1VET B;  1H0I A;  5B1L C;  2CV5 C;  3UTA D;  3SS3 A;  4YS3 C;  3D4F A;  1H0M A;  4OUI A;  3MKE A;  3CPT A;  4DE2 A;  5C3I B;  2HDR A;  4G91 C;  2XEP A;  4Z2H A;  3D9Y A;  5TFQ A;  1DP8 A;  3P5J B;  3REL A;  2ZD8 A;  1CK7 A;  4X68 A;  3HON A;  5CPI C;  5A91 A;  1OME A;  1YKD A;  3DWZ A;  3L25 A;  3Q07 A;  1DP9 A;  3C2W A;  3EPK A;  1CQA A;  4DJ3 A;  5FL3 A;  5JRG C;  3UO9 A;  1TZY B;  2VGL M;  4QLC C;  1P3G B;  3T50 A;  3LIB A;  5HDC A;  3TRC A;  3PXP A;  2DRW A;  4OPZ A;  2BYK B;  4IBE A;  3AZH A;  2XFS A;  2VA0 A;  4S2M A;  3PBQ A;  4KGC C;  4JLF A;  3H0R C;  3FZC A;  5DTK A;  2E8I A;  3B6F C;  4IBI A;  3GMW A;  5CPK A;  1SZV A;  3LO7 A;  3VH6 W;  3RXW A;  3A6N D;  2ZMF A;  3LR3 A;  4R8P A;  3WA9 B;  5F5Y A;  1H3Q A;  4OVD A;  1G5U A;  3Q7Z A;  3OPL A;  2W3H A;  5L8M A;  4IJE A;  3VH5 W;  3IXD A;  3LEZ A;  4KZB A;  1S0W A;  3ICY A;  4MLL A;  3LR0 A;  3K2N A;  3CJM A;  3R4K A;  2ZBB A;  5B1L B;  4Z5T D;  1IFQ A;  3N6I A;  3VV4 A;  4YS3 B;  4IUH A;  4ZJ2 A;  3S1Y A;  4LV1 A;  2CMN A;  1IYO A;  2WGI A;  5EVI A;  2UWX A;  1NXY A;  5BNV A;  4G91 B;  2EXB A;  1QME A;  2DNS A;  2VLG A;  5G18 A;  4UUZ A;  3IS2 B;  1E15 A;  3L9K A;  3NJA A;  4OJP A;  1EQZ D;  5B2J D;  5AVC D;  4PM9 A;  5CPI B;  2PBD P;  2VV8 A;  5KSC A;  3PBN A;  1UR8 A;  3E2K A;  2E8J A;  4EER A;  5DTT A;  4NET A;  1P3P A;  5JRG B;  3X1S D;  4QLC B;  3HJK A;  1L2S A;  2P04 A;  3HLF A;  1JNU A;  1ZG6 A;  1LSW A;  3QNB A;  4OP8 A;  3L27 A;  1CK3 A;  3W4P A;  4DF6 A;  1BH8 A;  4KG5 A;  5B32 D;  1LSV A;  4WZS B;  3L26 A;  4JPM A;  2PYO D;  4DDS A;  3X1U A;  1IEM A;  5EE8 A;  4HJ3 A;  4J8V A;  2ZQA A;  4N1H A;  5FAT A;  2IOU A;  3IH8 A;  4N9K A;  4X55 A;  1HQ3 A;  3A6N C;  2Y2L A;  3NDG A;  1N1J A;  3NQU B;  5EVE A;  4XUX A;  1YLY A;  3AGF A;  4UPK A;  4WZ5 A;  1FR6 A;  2V2F F;  3O88 A;  2PD8 A;  3UE1 A;  5HPI A;  3AZE D;  3REL D;  3S7N A;  1YAX A;  1K57 C;  3AZG A;  5B0Z A;  5GXQ A;  2QJ7 A;  3KS4 A;  4NYU A;  1PZP A;  3UDX A;  5HAI A;  5B31 C;  1D1J A;  3UTA B;  4RQ9 A;  3A3J A;  2JSS A;  4OKP A;  4Z5T C;  2PBY A;  3EPH A;  1OTA A;  1WA9 A;  2ZM0 A;  4R4S A;  5AY8 A;  4Z2G A;  4DE1 A;  5L09 A;  5J8X A;  2LB5 A;  3UT9 A;  3AZH D;  5DVA A;  1EQZ C;  1GXD A;  1S6R A;  5A93 A;  2F8N H;  2EX2 A;  5AVC C;  2A24 B;  3SZT A;  5HD5 A;  1GSX A;  2XSS A;  3HJI A;  3NQJ B;  4GD6 A;  5CPK D;  1XA1 A;  4DQY B;  2V1Z A;  3NBL A;  1KVL A;  5CPJ A;  3EPJ A;  3F1N B;  4NFT A;  4I5S A;  3KFU G;  3LY4 A;  4MN6 A;  2W0N A;  3X1S C;  4R8P D;  5BS7 A;  5GT0 D;  2OOL A;  3WAA A;  3TOI A;  5B32 C;  3E4O A;  2ZQC A;  3BFD A;  1S67 L;  4ZUX A;  1PZR A;  4S2J A;  4PM8 A;  5GHX A;  2PYO C;  1TS0 A;  4QJG A;  1YLW A;  4BL3 A;  1CI8 A;  1XGJ A;  3BFG A;  4C6Y A;  2NUP C;  3C8C A;  2VGL S;  5K5B A;  4EU0 A;  2ZY2 A;  2Y8H A;  4H9S A;  3A6N B;  3V3S A;  2JKF A;  3PBR A;  1L0G A;  4ARZ A;  5DF7 A;  3CAX A;  3REL C;  4CJN A;  3X1V A;  3BFF A;  3CMZ A;  5GLA A;  2XFT A;  5FQK A;  1S32 D;  3N8S A;  1M18 A;  1M19 A;  2VV7 A;  3IBJ A;  2HUE C;  1N4O A;  4Z5T B;  1E25 A;  1NYY A;  3DTI A;  1JFI A;  4DXB A;  2OWJ A;  4A5R A;  3L28 A;  3SH7 A;  5FEG A;  1H0G A;  3BFE A;  3LY3 A;  3PYP A;  1YU4 A;  3TW8 A;  5FEF A;  5DJU A;  3TSG A;  3S7O A;  3T4T A;  1NZO A;  3AZH C;  2FFF B;  3W4O A;  1EQZ B;  5B2J B;  5AVC B;  3MFD A;  1KX5 A;  2GDN A;  3X1U D;  3UB9 A;  2NUT C;  3KWQ A;  2F2A C;  5AQ9 A;  2P9V B;  5CPK C;  1S1Z A;  4WL9 A;  4GHL A;  1Y54 A;  4X53 A;  3CZD A;  1HQ3 D;  3MFX A;  1XFN A;  2Y2O A;  3X1S B;  2C5W B;  1ULY A;  4R8P C;  3UB7 A;  3IXB A;  5B32 B;  1P34 A;  2ZMV A;  1K0K A;  3BW6 A;  3HUN A;  5B31 G;  2PYO B;  2YFW B;  3AZG D;  5B0Z D;  5GXQ D;  3SW1 A;  2W3E A;  3CHW P;  3IWQ A;  2HJE A;  1P3B D;  3WTP E;  4HMC A;  3U4L P;  2J80 A;  3W98 A;  3M2J A;  4WNN B;  3CPT B;  3MGQ A;  1MZU A;  5EVI C;  5AY8 D;  1WWI A;  2BG1 A;  2DF4 C;  1KX3 A;  4MB5 A;  1MKI A;  3AZE B;  3REL B;  3UT9 D;  1YUE A;  3S7Q A;  1L0D A;  5FUG B;  1H3O A;  1K6S A;  3T12 B;  5M18 A;  3MKF A;  1TF1 A;  1ZC2 A;  4X25 A;  2HUE B;  4XXR A;  2V5O A;  5CPJ D;  3BY8 A;  2G5I C;  1P3P C;  1P9R A;  5B32 G;  1KU5 A;  3P98 A;  4PM7 A;  1DJA A;  1D06 A;  2XRO A;  1LLB A;  4NEE D;  1YQS A;  1Q9C A;  2DQN C;  4YIN A;  2FFY A;  5GSU A;  4ME4 A;  3AZH B;  2ZLY A;  2CC1 A;  4IBG A;  4S2L A;  5FQ9 A;  2A2L A;  3X1U C;  4J8V C;  3K3D A;  2HJ9 C;  5DJT A;  2ZM8 A;  3ISG A;  5CPK B;  3H7W A;  5EFW A;  4R38 A;  1HQ3 C;  4LGW A;  4WU9 A;  3UDF A;  3BY9 A;  4EBL A;  4IVI A;  2QKP A;  4R8P B;  3N3F A;  1NRF A;  3NI9 A;  4MBK A;  1G6A A;  2WAD A;  5GT0 B;  4EUZ A;  4WZ5 C;  5AV9 A;  1PDC A;  2HDU A;  4LG2 A;  3FPV A;  3X1V D;  3AZG C;  5B0Z C;  4GH9 A;  5GXQ C;  3WD0 A;  1BUL A;  3RFB A;  5B40 A;  3AZL A;  1M18 D;  3OPR A;  3LZ1 D;  1P3B C;  3OBF A;  1M19 D;  1F2K A;  4E3J A;  1X0O A;  4OQG A;  3OCN A;  5HDD A;  2OAQ 1;  4FOF A;  3ZHH A;  4HME A;  2YKF A;  4JXW A;  3HLD A;  5AY8 C;  1E6N A;  3EPL A;  3ITB A;  1DJB A;  1VEU A;  5E2H A;  5BNV B;  3CIT A;  4EEU A;  4HIA A;  3E0Y A;  1SCW A;  4UUZ B;  5KMW A;  3UT9 C;  4H6J A;  1P3M A;  3EQU A;  1W7F A;  3G35 A;  2GNX A;  1KX5 D;  1S32 B;  1ERO A;  3B0C T;  4XZQ A;  2J8Y A;  3MQO A;  4HH3 A;  5B1M A;  4GS9 A;  4L9E A;  5CPJ C;  1BT5 A;  1OTD A;  3LFV A;  1P3O D;  3P7N A;  1DY6 A;  5HAQ A;  3G34 A;  1KGE A;  5BS7 C;  4YM6 A;  3WAA C;  1W79 A;  3ZVW A;  2F8N A;  1BH8 B;  4RVA A;  4R23 A;  1GSW A;  1P34 D;  4HGA C;  4ZUX C;  5DNN A;  4GNU A;  4PKY A;  4X1M A;  5GLD A;  3X1U B;  2IA2 A;  3BJN A;  5E5A B;  2ZL1 A;  5AVF A;  2Y91 A;  5TR7 A;  3PAE A;  1K25 A;  1HQ3 B;  4R0Q A;  1P3A A;  4H9S C;  4DMZ A;  3LI9 A;  3F6T A;  4PM5 A;  1B67 A;  1CEF A;  1N1J B;  3MGQ D;  4KQO A;  3NEC A;  3OPH A;  4S2O A;  2BAS A;  2WKI A;  2ZC6 B;  4FTX A;  1STZ A;  1GHP A;  5GT3 A;  1KX3 D;  3X1V C;  3VH5 T;  1L6J A;  3AZG B;  5B0Z B;  3P01 A;  5GXQ B;  4GW9 A;  4G92 C;  3RXX A;  4HY8 A;  5EVL A;  1M18 C;  2L1M A;  2HV1 A;  5AQA A;  3SH9 A;  1M19 C;  1P3B B;  3REK A;  4EWF A;  2WZX A;  1I2S A;  2O9A A;  3UB6 A;  3C4P A;  1FCO A;  3NCK A;  1N9N A;  2VK3 A;  4LV2 A;  1BLC A;  2Y2P A;  3FC7 A;  3LI8 A;  5AY8 B;  2Y2K A;  1E6P A;  4WM9 A;  3A1K A;  2HDQ A;  3AZI A;  3IWI A;  3GQZ A;  2OLV A;  3ZDJ A;  3UT9 B;  1OGB A;  4GDB A;  1H8M A;  4MNR A;  1KX5 C;  3X1T A;  3KWQ C;  2FZ0 A;  1J7M A;  1BUE A;  4WF0 A;  4LD9 A;  5CPJ B;  2HP9 A;  4MN7 A;  2D02 A;  1I2W A;  2LY8 A;  4E44 A;  1MXO A;  1P3O C;  4WU9 D;  4KUO A;  3ZYT A;  4Q0J A;  5AV8 A;  4OLD A;  1JTG A;  3W97 D;  4M4X A;  1P34 C;  1KGG A;  1JWP A;  4HGA B;  4EBP A;  4NY2 A;  4G3W A;  2PU4 A;  5B40 D;  3AZL D;  4E3M A;  2CV5 D;  3IWO A;  4GHI A;  2XDM A;  2PYP A;  3ULF A;  4Z2L A;  1ONH A;  1N9B A;  3KSH A;  4X56 A;  3MGQ C;  1QMF A;  3HVF A;  3OPP A;  4I3J A;  2W1R A;  3A0S A;  5CER A;  1GCE A;  4DKI A;  1ZKJ A;  4ARZ B;  1KX3 C;  3X1V B;  2P7J A;  4JXS A;  1P3M D;  4G92 B;  1M18 B;  2G2U A;  2O9C A;  3LZ1 B;  1XJ4 A;  3W8K A;  1M19 B;  5B1M D;  3WKJ A;  1F98 A;  1W8Y A;  3WX7 A;  3ZVT A;  4QPR A;  2Q9N A;  3NOT C;  2HF6 A;  3IF6 A;  2ZY3 A;  4YM6 D;  2I72 A;  5GSU C;  2ZOI A;  3UMD A;  2XQZ A;  3KYE A;  5DNN D;  1BZA A;  4KGC D;  1YLT A;  2Y2M A;  1KX5 B;  3AN2 A;  3O3V A;  5HD3 A;  3ZG7 B;  4E3I A;  2A49 A;  1UWN X;  4WBG A;  5GHY A;  4N92 A;  1HTZ A;  1DJC A;  2QMI A;  3EEH A;  1P3A D;  3LID A;  2IWB A;  2ZY4 A;  1KS0 A;  2ACG A;  4Y0U A;  4WU9 C;  2WAE A;  2ZC4 B;  1P3O B;  1F66 A;  5IHV A;  1MWT A;  3VOZ A;  1P9W A;  2XH9 A;  5AV9 C;  1P34 B;  1FIL A;  5GT3 D;  3H0L C;  4GZB A;  5CP6 A;  5B40 C;  2Y2H A;  4OQ0 A;  4Z2M G;  3EG5 B;  3AZL C;  4P6Z S;  4OQH A;  3MNN D;  3WTP A;  3REK D;  4XUJ A;  3F1P B;  5AQB A;  3AV1 A;  2Y55 A;  3T4S A;  5B0Y A;  1G68 A;  1HVB A;  4KQD A;  2ARO A;  2V9A A;  4HEF A;  3SS4 A;  5AVB A;  2G5H C;  1MWU A;  3M2K A;  2VZW A;  1M6K A;  3AZI D;  3MF0 A;  1KX3 B;  1H5X A;  3QP8 A;  3B0C W;  4Y0O A;  1T1A A;  5DKL A;  5FDH A;  5F83 A;  1P3M C;  4Z2J A;  1H3O B;  1ODV A;  3X1T D;  3JYI A;  4XZQ C;  1XKZ A;  5B1M C;  4WJ3 C;  4IBK A;  2ZQ7 A;  4KG6 A;  5A90 A;  4OPQ A;  1BFM A;  4LD9 D;  2NZD D;  5FSR A;  4QY5 A;  2J3W A;  5BO0 A;  3VP3 A;  4GD8 A;  3RTY A;  4D60 A;  4FCF A;  2UV0 E;  5AV8 D;  2HGV A;  5F1F A;  4YM6 C;  4EO5 C;  2A3U A;  5DNN C;  3LIA A;  3C7U A;  1KOU A;  4LRY C;  4E6W A;  4WN5 A;  1NLY A;  4I3I A;  4ZRR A;  3UNW A;  1MY8 A;  1P3A C;  4DJ2 A;  1WYC A;  2GX5 A;  3LYX A;  2DMW A;  3T4L A;  4WU9 B;  3C1B A;  5JA4 B;  3O62 A;  4BJP A;  3LIC A;  1P3I A;  4KZA A;  3AFA A;  1V9Y A;  4OP5 A;  3W97 B;  3RH8 B;  5GT3 C;  2EWW A;  2ZY5 A;  4Z66 A;  3Q7V A;  1KX4 A;  5FQJ A;  3DTE A;  1TDL A;  3AZL B;  4DDY A;  3MNN C;  3NDE A;  4ETZ A;  5B31 D;  2CV5 B;  3REK C;  4NG2 A;  2YFV A;  3WKJ D;  3DW0 A;  1PW1 A;  4H9N A;  5AV5 A;  4RX2 A;  3DTK A;  5FI6 A;  3MQL A;  4AFI A;  3NOP C;  2EX9 A;  1VEU B;  2D01 A;  5G4Z A;  3AZI C;  1ZLA A;  4H6J B;  1NRJ A;  5BOH A;  1P3M B;  4L9F A;  3AN2 D;  3X1T C;  2QYB A;  3LIE A;  1YLZ A;  2BYM A;  5B1M B;  4Y7P A;  4GS9 B;  4LD9 C;  1BLH A;  4LV0 A;  2NZD C;  4LPZ A;  2VX8 A;  3O86 A;  2W27 A;  3KYQ A;  1OPX A;  4NYY A;  4ZJ3 A;  1E3U A;  4LCM A;  3AV2 A;  1F66 D;  2EFX A;  4NE5 A;  3LJA A;  5AV8 C;  2OWH A;  3AZJ A;  4YM6 B;  5TBM A;  4M3K A;  4EO5 B;  2WKR A;  1BLP A;  5DNN B;  4JXV A;  4KGC B;  3WS2 A;  2WUQ A;  1P3F D;  3B6F B;  4OJ5 A;  1TS7 A;  4GOG A;  4H8R A;  2ZL1 B;  3NC8 A;  3WTP D;  3IXH A;  1CEG A;  4XUJ D;  4UQI M;  3ZNT A;  5EEC A;  4BL2 A;  4X6T A;  2OV5 A;  4CLC A;  5B0Y D;  3WS4 A;  2WGW A;  2ARO D;  4HQA A;  2I9V A;  3WRZ A;  3KS8 A;  3IX8 A;  5AVB D;  3V50 A;  3NOU C;  4LV3 A;  2ZJ9 A;  4U3T A;  5GT3 B;  3G2Z A;  1O6I A;  5CEB A;  2ZMA A;  1OT9 A;  1T3U A;  3SOI A;  1CXW A;  3WS1 A;  1YLP A;  4R3A A;  4RX3 A;  3SH8 A;  4D2O A;  1OGG A;  3CUE A;  5HZH A;  3G30 A;  3MNN B;  4NE3 A;  3REK B;  4WZ4 A;  3WKJ C;  4HOI A;  2F8N G;  4PM6 A;  3IF6 C;  3IQA A;  4Q0H A;  4PKY G;  1RGZ A;  1NY0 A;  3AZI B;  3FV7 A;  3AGD A;  1NJ4 A;  1GA9 A;  4PPR A;  2RL3 A;  4IBF A;  3AN2 C;  4U0T A;  4HP9 A;  4QU3 A;  3X1T B;  3BQ8 A;  3S7P A;  1KGF A;  2C6W B;  2H0T A;  4KUK A;  1KDS A;  4LD9 B;  2NZD B;  4UA6 A;  2VGK A;  1J9M A;  1S4S A;  3REI A;  2IO5 C;  4EES A;  3IH9 A;  3C1B D;  1F66 C;  3BEB A;  1CJF A;  3O62 D;  4FH4 A;  1P3I D;  3AFA D;  4QB8 A;  1K4F A;  4Z2K A;  4Z66 D;  1KX4 D;  3G31 A;  1P3F C;  1VM1 A;  5AV6 A;  3UB8 A;  1SKO A;  3WTP C;  4XUJ C;  4K08 A;  3AV1 C;  5IU1 A;  3HLB A;  3UDI A;  4WEK A;  5B0Y C;  5AV5 D;  2ARO C;  5EVI D;  3GEC A;  2RVQ D;  4KEN B;  1FIK A;  5AVB C;  4OPR A;  1SDE A;  5BNX B;  3AL0 C;  2RCX A;  3QP1 A;  1ZLA D;  3FDD A;  4UHU A;  2FH5 A;  2V1B A;  3HRE A;  3T4Q A;  5B31 B;  2V8C A;  3LIF A;  1JVJ A;  3MMH A;  3WRT A;  4ZBJ C;  1KVM A;  3WKJ B;  1ID3 A;  1AOI A;  1BYW A;  1P3P D;  3RJU A;  3MR0 A;  1D7E A;  1YSQ A;  2X02 A;  4KZ3 A;  3AV2 D;  3IF6 B;  4MBF A;  3AZJ D;  1XPB A;  4B9O A;  5F99 A;  1A0K A;  3R45 A;  3MVD A;  4KZ5 A;  2XF3 A;  4X1L A;  1M40 A;  4J8V D;  1VQQ A;  2RIQ A;  1V9Z A;  4KG2 A;  3BEC A;  4Y15 A;  3MGR A;  5CHU A;  4OJ6 A;  5I94 A;  4CLC D;  2IO5 B;  3C1B C;  1ALQ A;  2PDR A;  1F66 B;  5HL6 A;  3O62 C;  1P3I C;  2NQB A;  1ZTU A;  3AFA C;  3BM6 A;  3UB5 P;  4CSR A;  4NXG A;  4OH0 A;  4IBB A;  4Z66 C;  1KX4 C;  3EOI A;  1P3F B;  1FR1 A;  3C38 A;  3FWL A;  3KSI A;  5CHM A;  4H9P B;  1BLS A;  3UN7 A;  1P3K A;  3WTP B;  1UR9 A;  1XXM A;  4XUJ B;  4HNB A;  4QY6 A;  3REH A;  5B33 A;  5AV5 C;  5B0Y B;  1T1C A;  2PD7 A;  2ARO B;  2ZC3 B;  4E3K A;  2RVQ C;  3B33 A;  1JTD A;  2QJ5 A;  3REJ A;  4WU8 A;  5AVB B;  5HL1 A;  4EET B;  1ZLA C;  3LR4 A;  3AGE A;  1VET A;  1OJG A;  4R3J A;  5BT1 D;  3KX0 X;  4UQI S;  3ITA A;  4J8W A;  4ZBJ B;  4HJ4 A;  3MZD A;  3ZG8 B;  1T18 A;  3REI D;  4DXC A;  5JYP A;  3AZK A;  5BO0 B;  3AV2 C;  3LEL A;  3WAA D;  3AZJ C;  4Y5F A;  1L3L A;  2W8S A;  1ES3 A;  4IBC A;  2XGN A;  4ZUX D;  4MB4 A;  1FCM A;  1K55 A;  1LL8 A;  2O0Y A;  2JKT M;  1NLZ A;  3KSF A;  4BQM A;  3SS5 A;  2GZA A;  4Y13 A;  5FAS A;  3EGX C;  4E04 A;  2IWC A;  5AV6 D;  2B02 A;  1P3G A;  2WKQ A;  4WYY A;  4B4X A;  4GCZ A;  3BQA A;  5AVE A;  3EWK A;  4OPY A;  3PTE A;  4CLC C;  1AXB A;  4II7 A;  4NZ1 A;  3MZF A;  4P6B A;  3O62 B;  2PR5 A;  1P3I B;  3AFA B;  3H0M C;  1W1Y A;  4JGQ A;  2V0U A;  4Z66 B;  1KX4 B;  5IS1 A;  2YKH A;  3GV9 A;  3BYD A;  1U60 A;  3K3C A;  3CUE C;  4BEN A;  1XA7 A;  3WA9 A;  3T4J A;  2YFV B;  3G2Y A;  1ID3 D;  1AOI D;  2M1C A;  4UA9 A;  2VQR A;  5AV5 B;  3IX3 A;  5EVI B;  2PAV P;  2XR0 A;  2M7U A;  1MWS A;  3NUL A;  5F99 D;  1EW0 A;  5G4Y A;  3MVD D;  4OOL A;  5FI7 A;  4HP4 A;  5HAR A;  3MXR A;  5BT1 C;  2ZM5 A;  2Y2N A;  1RP5 A;  4HHD A;  3KWQ D;  3N8L A;  4IBR A;  4C75 A;  1W1V A;  2BYM B;  3MGR D;  5B2I A;  3BRM A;  4BBT A;  5B24 A;  1P3P B;  2G2W A;  2L5A A;  3REI C;  5FQQ A;  3MQQ A;  3IS2 A;  2DCF A;  3OLO A;  4H9Q A;  3AV2 B;  3FYZ A;  4LLO B;  4PMA A;  3AZJ B;  5CPI A;  4KUD A;  2QWS A;  1RCJ A;  2EWV A;  1CI9 A;  4DRT A;  4NZ5 A;  4J8V B;  3M6B A;  1H8P A;  3UTB A;  4WV4 B;  3UPN A;  1GSV A;  1YU2 A;  2QZ6 A;  5AV6 C;  1M1A A;  3LZ0 A;  1P3K D;  5HSQ A;  3E4P A;  3KXB A;  3W98 D;  4CLC E;  1WE4 A;  4EQI A;  5C5K A;  1W63 M;  5B33 D;  4CLC B;  1WYB A;  4JGR A;  5M1A A;  5EOE A;  2VV6 A;  3REJ D;  1FSY A;  3AZM A;  4WU8 D;  2W3G A;  2JC7 A;  1Y28 A;  1ED7 A;  4ESP A;  2ZQD A;  1Q2P A;  5CTM A;  4OJO A;  1TAF A;  4JF4 A;  2PU2 A;  1G28 A;  1DRM A;  4OOY A;  4EQ1 A;  4R6L A;  4J8W D;  5F69 A;  1MKM A;  1ID3 C;  3C7V A;  1AOI C;  3FG8 A;  3FKE A;  1RGY A;  3ZGA B;  3AZK D;  5L2F A;  4S2N A;  3LEL D;  3AZN A;  2JHE A;  4DE0 A;  3R7W A;  2H28 A;  5GSU D;  2X71 A;  2PHY A;  2Q9M A;  5F99 C;  2Y79 A;  1L0E A;  4X23 A;  3MVD C;  1IYP A;  4O0P A;  1LI9 A;  3UTA A;  2G7U A;  1MC0 A;  3EEA A;  4YNR A;  3MGR C;  4X69 A;  5AQ7 A;  4OQI A;  1Z2C B;  3REI B;  2L4R A;  5FAO A;  5EUA A;  5FQM A;  4J8X A;  1NYM A;  2NQB C;  3WAA B;  1W1P A;  4EW7 A;  4IBD A;  5AV9 D;  4L9G A;  2RTS A;  4Z2I A;  4ZUX B;  4JJN A;  3V39 A;  2HIO A;  2EX8 A;  1KDW A;  4E45 A;  5CGW A;  1G6O A;  5AV6 B;  4DRB A;  1SKO B;  2H5S A;  1P3K C;  2M7V A;  3T1S A;  3W98 C;  3REH C;  5B33 C;  3HLE A;  1KE4 A;  3A0R A;  3REJ C;  4EEP A;  1OTE A;  4WU8 C;  1PFL A;  1PI4 A;  2XK1 A;  1JWZ A;  5TGF A;  4LFU A;  1BH9 A;  1K6R A;  4BMW A;  4WUJ A;  3V5M A;  3B0D C;  1MWR A;  5L10 A;  3H82 A;  4XZQ D;  5F82 A;  3VP2 A;  3C5A A;  1PYY A;  5CTN A;  4B88 A;  4J8W C;  3QHY A;  5B2I D;  4B93 A;  1ID3 B;  4H9O A;  1AOI B;  1JFI B;  5B24 D;  5KSH A;  4NZ3 A;  3AZK C;  3EGD C;  3GTC A;  1YU3 A;  3LEL C;  3C4O A;  3FKW A;  2F8N D;  4KUD D;  3V9R A;  1TVF A;  1K38 A;  1EAK A;  4ZDX A;  4MMN A;  5F99 B;  1K4E A;  4GDN A;  4HI4 A;  5EM1 A;  4B4Z A;  4CPK A;  3MGP A;  1K55 C;  2KLI A;  3R45 B;  3MVD B;  2ZC5 B;  4IJF A;  4IUK A;  2HPB A;  4BD1 A;  4KZ6 A;  5BPV A;  5EOO A;  4Z5T A;  3KWQ B;  4HBT A;  3UTB D;  5A8B A;  4K0W A;  1MPL A;  2XRN A;  3VH6 A;  3MGR B;  2J9O A;  1EWZ A;  4QD4 A;  1P3G C;  1M1A D;  3LZ0 D;  3B47 A;  4G3V A;  5DF8 A;  4CAY A;  4XT2 A;  5EPH A;  1W1T A;  3KXB D;  3HL9 A;  5HX9 A;  1PIO A;  4KZ8 A;  2HP5 A;  5B2J A;  3QP6 A;  3AZM D;  1H8Z A;  3CI6 A;  2JKG A;  1W5D A;  1NZU A;  4I3A A;  1A7W A;  2XA7 M;  4OJL A;  3KYZ A;  1P3K B;  3WA9 C;  5J4E A;  3ZG9 B;  3W98 B;  4MCW A;  5B33 B;  5DFX A;  5D3O A;  3MGQ B;  3UME A;  3DAV A;  3REJ B;  4KQQ A;  4WU8 B;  3AZN D;  3VSL A;  3T4K A;  2FJ7 A;  3U2A A;  4F94 A;  3MS6 A;  3CWF A;  2PRF A;  4E3O A;  3N8R A;  4X23 D;  3KUY A;  3B0D B;  4H9R A;  5DKK A;  3AYW A;  1XGI A;  5CED A;  2O99 A;  4WNN A;  4L0L A;  5B2I C;  4J8W B;  2FN2 A;  3PR6 A;  3IHB A;  4Z2M H;  5HFO A;  5B24 C;  2EXA A;  3AZK B;  2ZOH A;  1LT0 A;  4J8X D;  3AZE A;  2PR6 A;  3LEL B;  5FUG A;  4KUD C;  4FH2 A;  5GSU B;  1VB6 A;  3QP5 A;  4JJN D;  2HIO D;  2J3T C;  2J9P A;  3UTB C; 
#chains in the Genus database with same CATH homology
 1IYQ A;  4IBJ A;  1M1A C;  3LZ0 C;  2WKE A;  4YFM A;  5FAP A;  3KXB C;  2Z2L B;  1P3L A;  3UPP A;  3AZM C;  3IXG A;  5AV9 B;  1ERM A;  5E2G A;  5B40 B;  3A3E A;  2WYX A;  3TG9 A;  3OC2 A;  5GT0 A;  3QNC A;  3HUM A;  4S2N C;  3AZN C;  1BSG A;  4HBU A;  4N9L A;  5GHZ A;  4X23 C;  4E3L A;  3MGP D;  2EFU A;  1O07 A;  3UTA C;  4OLG A;  4XZQ B;  3N7W A;  3VP4 A;  5CHJ A;  5B2I B;  5B24 B;  3DTM A;  5E43 A;  3VOY A;  3P09 A;  1ES5 A;  2H0Y A;  4J8X C;  1GHM A;  1FOF A;  4H9Q B;  2F8N B;  3ZG0 A;  4KUD B;  5DNM A;  1S32 A;  4JJN C;  2HIO C;  2ZQ8 A;  5CP6 D;  1B6W A;  3BFC A;  3Q81 A;  3WS5 A;  1YMX A;  3UTB B;  3FKV A;  1M1A B;  3LZ0 B;  3AV1 D;  1P3A B;  3VP0 A;  1WWS A;  3KXB B;  2HDS A;  5FA7 A;  4P87 A;  1FSW A;  2WKH A;  3AZM B;  2FJ7 D;  2ZM2 A;  5E5A A;  3KUY D;  1TAF B;  3AYW D;  3W99 A;  1HTA A;  5U47 A;  1PZO A;  4NE6 A;  3VP1 A;  1MBL A;  1YLJ A;  1E4D A;  3Q82 A;  3IP4 C;  4HES A;  2P74 A;  1Z6F A;  3AZN B;  4JXG A;  3MBZ A;  4P0M A;  3HUO A;  1PW8 A;  4X23 B;  3MGP C;  4BD0 A;  1P3B A;  4U0X A;  5CXW A;  1FQG A;  1TEM A;  4IED A;  4DRA A;  3OZH A;  1K56 A;  4XUZ A;  2B5R A;  3IT9 A;  2J7V A;  1P3L D;  2Y4A A;  1U35 A;  1IEL A;  4J8X B;  5AV8 B;  3EQV A;  4QHC A;  5B2J C;  4NK3 A;  5E2E A;  5DTS A;  4JJN B;  5GL9 A;  2HIO B;  4ZAM A;  3PBT A;  5CP6 C;  4ID4 A;  2OSU A;  1TDG A;  3UE3 A;  3ZNY A;  3MGS A;  3A3F A;  2R9X A;  3VFH A;  2WZZ A;  5M19 A;  5CGX A;  1ONG A;  4NZ4 A;  4K0X A;  5JYO A;  1LHY A;  2BLS A;  4GHA A;  4ZJ1 A;  2FJ7 C;  1BH9 B;  4RA7 A;  3TU4 A;  3KUY C;  3AZF A;  3G32 A;  3AYW C;  3M6H A;  3BLS A;  2ZC7 A;  4FD8 A;  3VSK A;  1YU0 A;  4JF6 A;  3I7J A;  4H9O B;  4J8U A;  1IKI A;  5F1G A;  1E3U D;  3LJA D;  3AZE C;  3B6G A;  1JWV A;  4Z9Q A;  3V9R B;  3N4I A;  5DNM D;  4BLM A;  3W96 A;  3LZ1 A;  3MGP B;  5DF9 A;  3HLG A;  3AN2 B;  1ZG4 A;  1ES4 A;  4KHA A;  1XX2 A;  2ZQ9 A;  1K54 A;  4KZ4 A;  3PBO A;  4CAY B;  4ZTK A;  1P3L C;  5A92 A;  4WMC A;  3HBR A;  3GSG A;  2JBF A;  5E5A D;  5CP6 B;  1L0F A;  1O7E A;  3UY6 A;  5KDM A;  4OON A;  5G49 A;  3W99 D;  4IBX A;  3PBS A;  3CG5 A;  1P3O A;  3AV1 B;  1ES2 A;  4KQR A;  3C1C A;  5GT0 C;  5CEC A;  4RYE A;  1PWD A;  4KZ7 A;  2Y2G A;  2FJ7 B;  4JBF A;  3KUY B;  4GN2 A;  4H9R B;  3AYW B;  1KE0 A;  1IYS A;  3A3D A;  2XD1 A;  2HP6 A;  1ESU A;  2JCH A;  1K56 D;  4JF5 A;  3B0B A;  1EI5 A;  1F1E A;  4M6B A;  3LJA C;  1U35 D;  3PAG A;  2QPN A;  4MBH A;  5FAQ A;  5DNM C;  1S32 C;  2J8P A;  1LL5 A;  2F8N K;  3ZG5 A;  4JKT A;  1TZY A;  3IF5 A;  3MGS D;  1GHI A;  1KE3 A;  2BYK A;  4E6X A;  3C1B B;  1P3L B;  4IVK A;  4LEN A;  4R3B A;  1PI5 A;  3TU4 D;  5E5A C;  3Q7V B;  3VFF A;  3AZF D;  2H10 A;  3W99 C;  5JA4 A;  5FI2 A;  4H9N B;  3Q1F A;  3W97 A;  4J8U D;  1LI0 A;  1SDN A;  3IHA A;  3B6G D;  3A1I A;  1ZLA B;  3W96 D;  2IWD A;  5B1L A;  2CV5 A;  3S4X A;  5E2F A;  4YS3 A;  2XLN A;  4GKU A;  4R1G A;  3UPO A;  3DWK A;  1Q2Q A;  3OCL A;  4Y0T A;  5FQI A;  1U35 C;  3LJA B;  4OOM A;  2NQB D;  1SHV A;  4WMC D;  3HLW A;  3L29 A;  5DNM B;  1YT4 A;  2WGV A;  3ZFZ A;  4EBN A;  5JRG A;  4QLC A;  3MGS C;  3V3R A;  3REH D;  3C1C D;  2EX6 A;  2WGW B;  3WS0 A;  3GRJ A;  3GR2 A;  4KGC A;  3B6F A;  3TU4 C;  1H8Y A;  2Y2Q A;  2Z2M B;  3AZF C;  3W99 B;  3VMA A;  3NQU A;  3VH6 T;  2WAF A;  4N1X A;  4J8U C;  4UA7 A;  4S2I A;  5CRF A;  3B6G C;  3NIA A;  3LCE A;  2R9W A;  3W96 C;  3A3I A;  5CGS A;  3MNN A;  2CWE A;  3LZ1 C;  1XP4 A;  1LL9 A;  3KSY A;  4E3N A;  1TZY D;  3W4Q A;  2WK0 A;  4QNL A;  1P3G D;  1K54 C;  4EV4 A;  2Y59 A;  3L2A A;  1YU1 A;  4WEL A;  1PWG A;  4AWL C;  3E2L A;  2XD5 A;  1U35 B;  3MXS A;  3S22 A;  3WWX A;  1GA0 A;  3NQJ A;  1HD8 A;  1HZO A;  4GB7 A;  3ZCZ A;  2NZD A;  3MGS B;  3WA9 D;  1BTL A;  3C1C C;  4O7D A;  4S2P A;  3UE0 A;  1ESI A;  5HAP A;  5GLC A;  1W2E A;  1R4V A;  1PWC A;  3TU4 B;  2JE5 A;  4FSF A;  2Y2J A;  5B1L D;  3AZF B;  1FCN A;  3A6N A;  1I5Q A;  4YS3 D;  1YMS A;  3G4P A;  4K91 A;  2VGJ A;  5C3I C;  4LCL A;  5CHL B;  4J8U B;  5BNX A;  3NY4 A;  1K57 A;  5CPI D;  3B6G B;  1YM1 A;  3BLM A;  3W96 B;  5B31 A;  4KZ9 A;  4WEJ A;  1TZY C;  5JRG D;  4QLC D;  4KHA B;  4MEZ A;  1IKG A;  5HW3 A;  3MZE A;  1W8Q A;  4ZBE A;  4C3Q A;  3HLC A;  3VH5 A;  4AWL B;  1EQZ A;  1C3B A;  2NQB B;  3B3X A;  5AVC A;  4CSR B;  3HSH A;  3B6F D;  2P9V A;  4Q8I A;  4R4R A;  1ERQ A;  1SKF A;  4S2K A;  5KDM B;  5GLB A;  4P85 A;  5G49 B;  4DE3 A;  3X1S A;  2OLU A;  2X01 A;  3REH B;  3C1C B;  5KZH A;  5B32 A;  3W97 C;  4UAA A;  2V20 A;  2PYO A;  2YFW A;  2Y2I A;  3O87 A;  3GVB A;  1P3F A;  4H9P A;  5B1L C;  2CV5 C;  3UTA D;  3SS3 A;  4YS3 C;  3D4F A;  4OUI A;  3MKE A;  4DE2 A;  5C3I B;  2HDR A;  4G91 C;  2XEP A;  5TFQ A;  3P5J B;  3REL A;  2ZD8 A;  4X68 A;  3HON A;  5CPI C;  5A91 A;  1OME A;  3DWZ A;  3L25 A;  3Q07 A;  3EPK A;  5JRG C;  3UO9 A;  1TZY B;  4QLC C;  1P3G B;  2DRW A;  4OPZ A;  2BYK B;  4IBE A;  3AZH A;  2XFS A;  4S2M A;  3PBQ A;  4KGC C;  4JLF A;  3H0R C;  3FZC A;  5DTK A;  2E8I A;  3B6F C;  4IBI A;  3GMW A;  5CPK A;  3LO7 A;  3VH6 W;  3RXW A;  3A6N D;  4R8P A;  3WA9 B;  4OVD A;  3Q7Z A;  3OPL A;  4IJE A;  3VH5 W;  3IXD A;  3LEZ A;  4KZB A;  1S0W A;  4MLL A;  3CJM A;  5B1L B;  4Z5T D;  3N6I A;  4YS3 B;  4ZJ2 A;  3S1Y A;  4LV1 A;  1IYO A;  2WGI A;  5EVI A;  2UWX A;  1NXY A;  5BNV A;  4G91 B;  2EXB A;  1QME A;  2DNS A;  5G18 A;  4UUZ A;  4OJP A;  1EQZ D;  5B2J D;  5AVC D;  4PM9 A;  5CPI B;  5KSC A;  3PBN A;  3E2K A;  5DTT A;  4NET A;  1P3P A;  5JRG B;  3X1S D;  4QLC B;  1L2S A;  3HLF A;  1ZG6 A;  3QNB A;  4OP8 A;  3L27 A;  1CK3 A;  3W4P A;  4DF6 A;  1BH8 A;  4KG5 A;  5B32 D;  4WZS B;  3L26 A;  4JPM A;  2PYO D;  4DDS A;  3X1U A;  1IEM A;  5EE8 A;  4J8V A;  2ZQA A;  4N1H A;  5FAT A;  2IOU A;  3IH8 A;  4N9K A;  4X55 A;  1HQ3 A;  3A6N C;  2Y2L A;  3NDG A;  1N1J A;  3NQU B;  4XUX A;  1YLY A;  3AGF A;  4UPK A;  4WZ5 A;  1FR6 A;  2V2F F;  3O88 A;  3UE1 A;  3AZE D;  3REL D;  1K57 C;  3AZG A;  5B0Z A;  5GXQ A;  3KS4 A;  4NYU A;  1PZP A;  3UDX A;  5HAI A;  5B31 C;  3UTA B;  3A3J A;  2JSS A;  4OKP A;  4Z5T C;  2PBY A;  3EPH A;  2ZM0 A;  4R4S A;  5AY8 A;  4DE1 A;  5J8X A;  3UT9 A;  3AZH D;  5DVA A;  1EQZ C;  5A93 A;  1S6R A;  2F8N H;  2EX2 A;  5AVC C;  3NQJ B;  4GD6 A;  5CPK D;  1XA1 A;  4DQY B;  2V1Z A;  3NBL A;  1KVL A;  5CPJ A;  3EPJ A;  4NFT A;  3KFU G;  3LY4 A;  3X1S C;  4R8P D;  5BS7 A;  5GT0 D;  3WAA A;  3TOI A;  5B32 C;  2ZQC A;  3BFD A;  4ZUX A;  1PZR A;  4S2J A;  4PM8 A;  5GHX A;  2PYO C;  4QJG A;  1YLW A;  4BL3 A;  1CI8 A;  1XGJ A;  3BFG A;  4C6Y A;  2ZY2 A;  4H9S A;  3A6N B;  3V3S A;  3PBR A;  1L0G A;  5DF7 A;  3REL C;  4CJN A;  3X1V A;  3BFF A;  3CMZ A;  5GLA A;  2XFT A;  5FQK A;  1S32 D;  3N8S A;  1M18 A;  1M19 A;  2HUE C;  1N4O A;  4Z5T B;  1E25 A;  1NYY A;  1JFI A;  4DXB A;  4A5R A;  3L28 A;  3SH7 A;  3BFE A;  3LY3 A;  1YU4 A;  3TSG A;  3AZH C;  1NZO A;  2FFF B;  3W4O A;  1EQZ B;  5B2J B;  5AVC B;  3MFD A;  1KX5 A;  2GDN A;  3X1U D;  3KWQ A;  2F2A C;  5AQ9 A;  2P9V B;  5CPK C;  4GHL A;  1Y54 A;  4X53 A;  3CZD A;  1HQ3 D;  2Y2O A;  3X1S B;  2C5W B;  1ULY A;  4R8P C;  3IXB A;  5B32 B;  1P34 A;  3HUN A;  5B31 G;  2PYO B;  2YFW B;  3AZG D;  5B0Z D;  5GXQ D;  3IWQ A;  1P3B D;  3WTP E;  3M2J A;  3W98 A;  4WNN B;  3MGQ A;  5EVI C;  5AY8 D;  1WWI A;  2BG1 A;  2DF4 C;  1KX3 A;  1MKI A;  3AZE B;  3REL B;  3UT9 D;  1YUE A;  1L0D A;  5FUG B;  1H3O A;  1K6S A;  5M18 A;  3MKF A;  1ZC2 A;  2HUE B;  4XXR A;  5CPJ D;  2G5I C;  1P3P C;  5B32 G;  1KU5 A;  3P98 A;  4PM7 A;  1DJA A;  1LLB A;  1YQS A;  1Q9C A;  2DQN C;  4YIN A;  2FFY A;  5GSU A;  3AZH B;  2ZLY A;  2CC1 A;  4IBG A;  4S2L A;  5FQ9 A;  3X1U C;  4J8V C;  2ZM8 A;  3ISG A;  5CPK B;  1HQ3 C;  4WU9 A;  3UDF A;  4EBL A;  4IVI A;  4R8P B;  3N3F A;  1NRF A;  3NI9 A;  4MBK A;  1G6A A;  2WAD A;  5GT0 B;  4EUZ A;  4WZ5 C;  5AV9 A;  2HDU A;  4LG2 A;  3X1V D;  3AZG C;  5B0Z C;  4GH9 A;  5GXQ C;  1BUL A;  5B40 A;  3AZL A;  1M18 D;  3OPR A;  3LZ1 D;  1P3B C;  1M19 D;  4E3J A;  4OQG A;  3OCN A;  3ZHH A;  4JXW A;  3HLD A;  5AY8 C;  3EPL A;  3ITB A;  1DJB A;  5E2H A;  5BNV B;  1SCW A;  4UUZ B;  5KMW A;  3UT9 C;  1P3M A;  3EQU A;  1W7F A;  3G35 A;  1KX5 D;  1S32 B;  1ERO A;  3B0C T;  4XZQ A;  2J8Y A;  5B1M A;  5CPJ C;  1BT5 A;  1P3O D;  1DY6 A;  5HAQ A;  3G34 A;  1KGE A;  5BS7 C;  4YM6 A;  3WAA C;  1W79 A;  3ZVW A;  2F8N A;  1BH8 B;  4RVA A;  4R23 A;  1P34 D;  4HGA C;  4ZUX C;  5DNN A;  4GNU A;  5GLD A;  3X1U B;  5E5A B;  2Y91 A;  5TR7 A;  3PAE A;  1K25 A;  1HQ3 B;  4R0Q A;  1P3A A;  4H9S C;  3F6T A;  4PM5 A;  1B67 A;  1CEF A;  1N1J B;  3MGQ D;  4KQO A;  3OPH A;  4S2O A;  2WKI A;  2ZC6 B;  1GHP A;  5GT3 A;  1KX3 D;  3X1V C;  3VH5 T;  3AZG B;  5B0Z B;  5GXQ B;  3RXX A;  4G92 C;  5EVL A;  1M18 C;  5AQA A;  3SH9 A;  1M19 C;  1P3B B;  3REK A;  4EWF A;  2WZX A;  1I2S A;  3C4P A;  1FCO A;  3NCK A;  4LV2 A;  1BLC A;  2Y2P A;  5AY8 B;  2Y2K A;  4WM9 A;  3A1K A;  2HDQ A;  3AZI A;  3IWI A;  3GQZ A;  2OLV A;  3ZDJ A;  3UT9 B;  4GDB A;  4MNR A;  1KX5 C;  3X1T A;  3KWQ C;  1BUE A;  4LD9 A;  5CPJ B;  2HP9 A;  1I2W A;  2LY8 A;  4E44 A;  1MXO A;  1P3O C;  4WU9 D;  5AV8 A;  4OLD A;  1JTG A;  3W97 D;  1P34 C;  1KGG A;  1JWP A;  4HGA B;  4EBP A;  4NY2 A;  2PU4 A;  5B40 D;  3AZL D;  4E3M A;  2CV5 D;  3IWO A;  2XDM A;  1ONH A;  1N9B A;  4X56 A;  3MGQ C;  1QMF A;  3HVF A;  3OPP A;  5CER A;  1GCE A;  4DKI A;  1ZKJ A;  1KX3 C;  3X1V B;  4JXS A;  1P3M D;  4G92 B;  1M18 B;  2G2U A;  3LZ1 B;  3W8K A;  1M19 B;  5B1M D;  3WKJ A;  1W8Y A;  3WX7 A;  3ZVT A;  2Q9N A;  3IF6 A;  2ZY3 A;  4YM6 D;  2I72 A;  5GSU C;  2XQZ A;  5DNN D;  1BZA A;  4KGC D;  1YLT A;  2Y2M A;  1KX5 B;  3AN2 A;  3O3V A;  4E3I A;  3ZG7 B;  2A49 A;  4WBG A;  5GHY A;  4N92 A;  1HTZ A;  1DJC A;  2QMI A;  1P3A D;  2IWB A;  2ZY4 A;  4Y0U A;  4WU9 C;  2WAE A;  2ZC4 B;  1P3O B;  1F66 A;  5IHV A;  1MWT A;  3VOZ A;  2XH9 A;  5AV9 C;  1P34 B;  5GT3 D;  3H0L C;  4GZB A;  5CP6 A;  5B40 C;  2Y2H A;  4OQ0 A;  4Z2M G;  3EG5 B;  3AZL C;  4OQH A;  3MNN D;  3WTP A;  3REK D;  4XUJ A;  5AQB A;  3AV1 A;  2Y55 A;  5B0Y A;  1G68 A;  1HVB A;  2ARO A;  4HEF A;  3SS4 A;  5AVB A;  2G5H C;  1MWU A;  3M2K A;  1M6K A;  3AZI D;  1KX3 B;  1H5X A;  4Y0O A;  3B0C W;  5FDH A;  5F83 A;  1P3M C;  1H3O B;  3X1T D;  3JYI A;  4XZQ C;  1XKZ A;  5B1M C;  4WJ3 C;  2ZQ7 A;  4IBK A;  4KG6 A;  5A90 A;  4OPQ A;  1BFM A;  4LD9 D;  2NZD D;  5FSR A;  4QY5 A;  5BO0 A;  3VP3 A;  4GD8 A;  4FCF A;  5AV8 D;  5F1F A;  4YM6 C;  4EO5 C;  2A3U A;  5DNN C;  3C7U A;  4E6W A;  3UNW A;  1MY8 A;  1P3A C;  1WYC A;  4WU9 B;  3C1B A;  5JA4 B;  3O62 A;  4BJP A;  4KZA A;  1P3I A;  3AFA A;  4OP5 A;  3W97 B;  5GT3 C;  2ZY5 A;  4Z66 A;  3Q7V A;  1KX4 A;  5FQJ A;  1TDL A;  3AZL B;  4DDY A;  3MNN C;  3NDE A;  5B31 D;  2CV5 B;  3REK C;  2YFV A;  3WKJ D;  3DW0 A;  1PW1 A;  4H9N A;  5AV5 A;  4RX2 A;  5FI6 A;  2EX9 A;  3AZI C;  1ZLA A;  5BOH A;  1P3M B;  3AN2 D;  3X1T C;  1YLZ A;  2BYM A;  5B1M B;  4Y7P A;  4LD9 C;  1BLH A;  4LV0 A;  2NZD C;  3O86 A;  4NYY A;  4ZJ3 A;  1E3U A;  4LCM A;  3AV2 A;  1F66 D;  2EFX A;  4NE5 A;  3LJA A;  5AV8 C;  3AZJ A;  4YM6 B;  4M3K A;  4EO5 B;  1BLP A;  5DNN B;  4JXV A;  4KGC B;  3WS2 A;  2WUQ A;  1P3F D;  3B6F B;  4OJ5 A;  4GOG A;  4H8R A;  3NC8 A;  3WTP D;  3IXH A;  1CEG A;  4XUJ D;  3ZNT A;  5EEC A;  4BL2 A;  4X6T A;  2OV5 A;  5B0Y D;  3WS4 A;  2WGW A;  2ARO D;  3WRZ A;  3KS8 A;  5AVB D;  3V50 A;  4LV3 A;  2ZJ9 A;  4U3T A;  5GT3 B;  3G2Z A;  5CEB A;  2ZMA A;  1T3U A;  3SOI A;  3WS1 A;  1YLP A;  4RX3 A;  3SH8 A;  4D2O A;  3G30 A;  3MNN B;  4NE3 A;  3REK B;  4WZ4 A;  3WKJ C;  2F8N G;  4PM6 A;  3IF6 C;  3IQA A;  1RGZ A;  1NY0 A;  3AZI B;  3FV7 A;  3AGD A;  1NJ4 A;  1GA9 A;  4PPR A;  2RL3 A;  4IBF A;  3AN2 C;  4U0T A;  4QU3 A;  3X1T B;  1KGF A;  2H0T A;  2C6W B;  1KDS A;  4LD9 B;  2NZD B;  4UA6 A;  2VGK A;  1J9M A;  3REI A;  2IO5 C;  3IH9 A;  3C1B D;  1F66 C;  3BEB A;  3O62 D;  4FH4 A;  1P3I D;  3AFA D;  4QB8 A;  1K4F A;  4Z66 D;  1KX4 D;  3G31 A;  1P3F C;  1VM1 A;  5AV6 A;  3WTP C;  4XUJ C;  3AV1 C;  3HLB A;  3UDI A;  4WEK A;  5B0Y C;  5AV5 D;  2ARO C;  5EVI D;  2RVQ D;  4KEN B;  5AVB C;  4OPR A;  1SDE A;  5BNX B;  3AL0 C;  2RCX A;  1ZLA D;  3FDD A;  4UHU A;  3HRE A;  5B31 B;  1JVJ A;  3WRT A;  4ZBJ C;  1KVM A;  3WKJ B;  1ID3 A;  1AOI A;  1P3P D;  3RJU A;  4KZ3 A;  2X02 A;  3AV2 D;  3IF6 B;  4MBF A;  3AZJ D;  1XPB A;  5F99 A;  3R45 A;  3MVD A;  4KZ5 A;  2XF3 A;  1M40 A;  4J8V D;  1VQQ A;  2RIQ A;  4KG2 A;  3BEC A;  3MGR A;  5CHU A;  4OJ6 A;  5I94 A;  2IO5 B;  3C1B C;  1ALQ A;  1F66 B;  3O62 C;  1P3I C;  2NQB A;  3AFA C;  3BM6 A;  4CSR A;  4OH0 A;  4IBB A;  4Z66 C;  1KX4 C;  1P3F B;  1FR1 A;  3FWL A;  5CHM A;  4H9P B;  1BLS A;  3UN7 A;  1P3K A;  3WTP B;  1XXM A;  4XUJ B;  4QY6 A;  3REH A;  5B33 A;  5AV5 C;  5B0Y B;  2ZC3 B;  2ARO B;  4E3K A;  2RVQ C;  1JTD A;  3REJ A;  4WU8 A;  5AVB B;  5HL1 A;  1ZLA C;  3AGE A;  4R3J A;  5BT1 D;  3ITA A;  4J8W A;  4ZBJ B;  3MZD A;  3ZG8 B;  4DXC A;  3REI D;  5JYP A;  3AZK A;  5BO0 B;  3AV2 C;  3LEL A;  3WAA D;  3AZJ C;  2W8S A;  1ES3 A;  4IBC A;  2XGN A;  4ZUX D;  1FCM A;  1K55 A;  4BQM A;  3SS5 A;  5FAS A;  2IWC A;  5AV6 D;  1P3G A;  4WYY A;  4B4X A;  4OPY A;  3PTE A;  1AXB A;  4NZ1 A;  3MZF A;  4P6B A;  3O62 B;  1P3I B;  3AFA B;  3H0M C;  4Z66 B;  1KX4 B;  3GV9 A;  3BYD A;  1U60 A;  4BEN A;  1XA7 A;  3WA9 A;  2YFV B;  3G2Y A;  1ID3 D;  1AOI D;  4UA9 A;  2VQR A;  5AV5 B;  5EVI B;  2XR0 A;  1MWS A;  5F99 D;  3MVD D;  4OOL A;  5FI7 A;  5HAR A;  3MXR A;  5BT1 C;  2ZM5 A;  2Y2N A;  1RP5 A;  3KWQ D;  3N8L A;  4IBR A;  4C75 A;  2BYM B;  3MGR D;  5B2I A;  3BRM A;  5B24 A;  1P3P B;  2G2W A;  2L5A A;  3REI C;  5FQQ A;  2DCF A;  4H9Q A;  3AV2 B;  3FYZ A;  4PMA A;  3AZJ B;  5CPI A;  4KUD A;  1RCJ A;  1CI9 A;  4DRT A;  4NZ5 A;  4J8V B;  3M6B A;  3UTB A;  4WV4 B;  3UPN A;  1YU2 A;  2QZ6 A;  5AV6 C;  1M1A A;  3LZ0 A;  1P3K D;  3KXB A;  3W98 D;  4EQI A;  1WE4 A;  5B33 D;  1WYB A;  5M1A A;  5EOE A;  3REJ D;  1FSY A;  3AZM A;  4WU8 D;  2JC7 A;  2ZQD A;  1Q2P A;  5CTM A;  4OJO A;  1TAF A;  4JF4 A;  2PU2 A;  4OOY A;  4J8W D;  3C7V A;  1ID3 C;  1AOI C;  3FKE A;  1RGY A;  3ZGA B;  3AZK D;  5L2F A;  4S2N A;  3LEL D;  3AZN A;  4DE0 A;  5GSU D;  2X71 A;  2Q9M A;  5F99 C;  1L0E A;  4X23 A;  3MVD C;  1IYP A;  1LI9 A;  3UTA A;  3MGR C;  4X69 A;  5AQ7 A;  4OQI A;  1Z2C B;  3REI B;  5FAO A;  5EUA A;  5FQM A;  4J8X A;  1NYM A;  2NQB C;  3WAA B;  4IBD A;  5AV9 D;  4ZUX B;  4JJN A;  3V39 A;  2HIO A;  2EX8 A;  1KDW A;  4E45 A;  5CGW A;  5AV6 B;  2H5S A;  4DRB A;  1P3K C;  3W98 C;  3REH C;  5B33 C;  3HLE A;  1KE4 A;  3REJ C;  4WU8 C;  1PI4 A;  2XK1 A;  1JWZ A;  5TGF A;  1BH9 A;  1K6R A;  3V5M A;  3B0D C;  1MWR A;  4XZQ D;  5F82 A;  3VP2 A;  3C5A A;  1PYY A;  5CTN A;  4B88 A;  4J8W C;  3QHY A;  5B2I D;  1ID3 B;  4H9O A;  1AOI B;  1JFI B;  5B24 D;  5KSH A;  4NZ3 A;  3AZK C;  3GTC A;  1YU3 A;  3LEL C;  3C4O A;  3FKW A;  2F8N D;  4KUD D;  3V9R A;  1TVF A;  1K38 A;  4ZDX A;  5F99 B;  1K4E A;  4GDN A;  4B4Z A;  4CPK A;  3MGP A;  1K55 C;  4BD1 A;  3R45 B;  3MVD B;  2ZC5 B;  4IJF A;  2HPB A;  4KZ6 A;  5BPV A;  5EOO A;  4Z5T A;  3KWQ B;  4HBT A;  3UTB D;  4K0W A;  1MPL A;  2J9O A;  3VH6 A;  3MGR B;  1EWZ A;  4QD4 A;  1P3G C;  1M1A D;  3LZ0 D;  5DF8 A;  4CAY A;  5EPH A;  3KXB D;  3HL9 A;  5HX9 A;  1PIO A;  4KZ8 A;  2HP5 A;  5B2J A;  3AZM D;  1H8Z A;  1W5D A;  1NZU A;  1A7W A;  4OJL A;  1P3K B;  3WA9 C;  3ZG9 B;  3W98 B;  5B33 B;  5D3O A;  3MGQ B;  3REJ B;  4KQQ A;  4WU8 B;  3AZN D;  3VSL A;  2FJ7 A;  4F94 A;  4E3O A;  3N8R A;  4X23 D;  3KUY A;  3B0D B;  4H9R A;  3AYW A;  1XGI A;  5CED A;  4WNN A;  4L0L A;  5B2I C;  4J8W B;  3IHB A;  4Z2M H;  5HFO A;  5B24 C;  2EXA A;  3AZK B;  4J8X D;  3AZE A;  3LEL B;  5FUG A;  4KUD C;  4FH2 A;  5GSU B;  4JJN D;  2HIO D;  2J9P A;  3UTB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...