2Y2MA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e08)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PENICILLIN-BINDING PROTEIN 1B
total genus 163
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2mA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2mA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2mA02
2JC7A 4C6YA 4WMCA 4E3MA 4QY6A 4U0XA 1LI9A 3C4PA 3WWXA 2JCHA 1FR1A 4OQHA 1PWDA 4YFMA 4OLDA 2JE5A 4DKIA 2WADA 3V39A 3SS5A 5M18A 2PU4A 3VP3A 2EX9A 2WGVA 4KZ9A 1NY0A 4UA7A 3ZG0A 2Y2OA 1XXMA 4JXWA 1FCNA 4U0TA 5EE8A 5DTTA 3ZVWA 3WS4A 3RXXA 3VOYA 2ZQ8A 1NZOA 4F94A 4RX2A 1GHMA 1PIOA 1PW1A 4KQOA 1BZAA 5DF7A 2WUQA 1IEMA 2Z2MB 3DWZA 1EWZA 1K55A 3GSGA 3MXRA 1QMEA 1RGYA 3G32A 4KQRA 4PMAA 2Q9NA 4S2KA 5GL9A 3UO9A 3ZG8B 1YLPA 2Q9MA 5FI6A 4KZ8A 4KENB 5AQAA 5CEBA 4X53A 4X69A 1WYCA 5KSHA 2HDSA 5GLBA 3E2LA 1DY6A 5M19A 3FV7A 3IWOA 3MXSA 4R4RA 1XGIA 1JTGA 2P74A 4GDBA 2EX2A 1N4OA 4E6WA 4P87A 3QNBA 5TR7A 4OLGA 1KE0A 4PM9A 1GA9A 4UA6A 2Y4AA 4HBUA 4DE1A 3CZDA 3GV9A 1XKZA 2WKEA 3VFFA 4JF6A 1E25A 3IQAA 2J9PA 4E3JA 1ESIA 4GKUA 5A91A 4K0WA 3S1YA 2WK0A 1YLWA 1ERMA 1XA1A 4JF5A 1S0WA 5M1AA 4N9KA 3C7VA 3MZFA 3BFDA 4OONA 3V50A 2VGKA 3W8KA 1EROA 3Q07A 1WYBA 5F82A 5FQIA 3ZG5A 1BUEA 4KZAA 1OMEA 1MXOA 4GDNA 3I7JA 3HUNA 4BL2A 5L2FA 3P98A 3MZDA 1FQGA 3LO7A 2V1ZA 5CGWA 1TEMA 2HDRA 5FQ9A 1E3UD 3IWQA 3N8LA 4KZ7A 5F83A 4WMCD 5IHVA 3BLMA 4ID4A 1CK3A 1ESUA 1W8YA 2EX8A 5CHMA 5TGFA 5HFOA 1SDNA 3O3VA 4EBPA 5FI2A 2ZC6B 3ZGAB 3TG9A 4PM5A 2HP9A 3UPOA 1IELA 3PBRA 5HX9A 4LV0A 3GVBA 5AQ9A 4WZ4A 4N1XA 3IF5A 2V20A 3G35A 3UDXA 2Y2IA 1FCMA 1VM1A 2XF3A 3BRMA 4BENA 4QB8A 4DF6A 4MBFA 1YMSA 2XFSA 5FA7A 3ZVTA 5I94A 4C3QA 3MKFA 1KGEA 2JBFA 4P0MA 5DVAA 5TFQA 1XGJA 3DW0A 3LCEA 3D4FA 1K56D 1KE3A 3HLEA 3SS4A 4XXRA 5A92A 4BL3A 1GHIA 2XK1A 3UDIA 4XUXA 1MWTA 3VP1A 3V5MA 2P9VB 1IYQA 3B3XA 3IWIA 3BECA 1K25A 4LCLA 2J9OA 2HDQA 3FWLA 3VP0A 3WRTA 4WBGA 4EUZA 4R3BA 4R1GA 5G18A 4GB7A 4KG6A 3NBLA 4O7DA 1G6AA 3IF6C 1E4DA 2WAEA 1YT4A 2X02A 2WKHA 1W5DA 1FR6A 3GRJA 4OQIA 1K57A 4WZ5A 4YINA 1XA7A 4QD4A 3VP2A 3WS2A 1H5XA 5FAOA 2ZQAA 3LY3A 5E2EA 4RYEA 1MY8A 5FAQA 3G4PA 3W4OA 4ZDXA 2EFXA 1IKIA 4OPRA 4Y0UA 1MWSA 5CHJA 4ZBEA 5A90A 4OQGA 1W8QA 2RL3A 4NETA 5JYPA 4OP8A 1K54A 4QJGA 3UE1A 3IH8A 3HUMA 3FYZA 5GLAA 1K54C 3HLWA 3V3RA 4EBNA 1NYMA 4OOLA 1L0GA 1N9BA 3BM6A 1ZG4A 2XGNA 3MBZA 1JWZA 3A3EA 4EBLA 3ITAA 2Y2MA 1K6SA 2R9WA 1YLJA 2ZLYA 3PBOA 5GLDA 4BLMA 1ES5A 5GLCA 1E3UA 1S6RA 4KZ6A 3HVFA 1VQQA 5EVLA 2ZC5B 5EVIA 3DTMA 2WKIA 3AGEA 4EWFA 4EQIA 2OV5A 5KZHA 4HBTA 4OPQA 5HAPA 1LL5A 4JLFA 4DE0A 1PI5A 2BG1A 3HREA 4RVAA 2V2FF 5KSCA 3QNCA 2B5RA 2P9VA 5CRFA 3M2JA 2Y55A 3BFEA 4WM9A 2J7VA 1KGFA 1NYYA 3HLGA 3CJMA 3O87A 2G2WA 4LV1A 3M6HA 3PAEA 3VP4A 4FH2A 4N92A 2Y2GA 4KG2A 2XR0A 1I2SA 1FSYA 1HVBA 1M6KA 3BYDA 3GQZA 2Y59A 3HLFA 2Z2LB 4IBXA 4JXSA 3N8RA 4OPYA 3WS5A 2R9XA 5GHZA 2C6WB 3S4XA 1I5QA 4GD8A 4S2PA 3O88A 3SH8A 1KVLA 3OCNA 5EECA 2RCXA 4WYYA 1DJAA 3NCKA 1RCJA 2EXAA 4WEJA 1O07A 3P09A 1ZKJA 4CJNA 4GNUA 4S2MA 1AXBA 2WZZA 2X01A 3ITBA 3BLSA 5EVIC 3MFDA 3M2KA 4X68A 3A3DA 3ZCZA 2OLUA 3W4QA 2I72A 3G31A 3IF6B 3N6IA 1K4FA 1ZC2A 3OZHA 3IH9A 4R23A 3RJUA 4PM7A 1M40A 4QY5A 1MPLA 2XQZA 4K0XA 2XD1A 4QHCA 1WE4A 3IXHA 1FSWA 2EXBA 1LL9A 4R4SA 4B4XA 3UE0A 5HAIA 3NY4A 1BLHA 2Y91A 1PW8A 4WZ5C 5FATA 3NC8A 4L0LA 1KGGA 4X56A 4U3TA 2ZQDA 1ZG6A 2ZJ9A 2ZQCA 3N4IA 2XD5A 4BJPA 5DF9A 3ZNTA 2A3UA 2ZM0A 3Q7VA 1SCWA 5EOOA 3ZDJA 2ZM8A 5CERA 3ZFZA 2ZQ7A 1IYSA 3MKEA 4ZJ1A 5EVID 1NJ4A 3HLCA 4KZBA 4LV3A 3CMZA 3VOZA 4CPKA 3A3IA 3IT9A 1K56A 3OPLA 3Q82A 5AQBA 5DTKA 3HUOA 3OPHA 4MNRA 3AGDA 3E2KA 3FKVA 3UPNA 5FASA 2A49A 2XLNA 3ZNYA 3A3FA 4MBKA 4OP5A 2H10A 3BEBA 3QHYA 2Y2PA 3SOIA 5FDHA 1K4EA 4E6XA 3UY6A 3BFCA 2DNSA 4NK3A 2G2UA 1BULA 1EI5A 1O7EA 1QMFA 1TDLA 4S2JA 5E2HA 1KE4A 2OSUA 4MLLA 2ZD8A 5GHYA 1Q2QA 5CXWA 4E3IA 1H8YA 3EQVA 1IKGA 1FCOA 3VMAA 3SH9A 3UN7A 4BD0A 1JTDA 1SKFA 4HESA 2XDMA 4BD1A 4X6TA 4A5RA 1SHVA 1ERQA 4FH4A 4N9LA 5FQJA 1CEGA 4C75A 1CI8A 4JXVA 1BLPA 2H0YA 2Y2NA 4R3JA 1IYOA 1KDWA 1NXYA 2QPNA 5EVIB 5U47A 3LY4A 2WYXA 3GMWA 5E43A 5FQMA 3FZCA 1MWRA 2ZQ9A 4WELA 1BSGA 4OPZA 1XPBA 3V3SA 2QZ6A 4Y7PA 4DE3A 4IBRA 4UAAA 1JWPA 4S2NA 1PI4A 4WEKA 5HARA 1YLTA 1ES4A 5D3OA 3HLBA 3Q1FA 2C5WB 1LLBA 2DRWA 1PWGA 2EX6A 4GN2A 1CI9A 2IWBA 2X71A 3WRZA 1GCEA 4E3NA 1BLCA 3EQUA 4HEFA 1YQSA 4M3KA 4XUZA 3LEZA 4RX3A 3TOIA 2EFUA 4ZJ2A 4B88A 4LENA 3PAGA 1Y54A 3OC2A 1ALQA 2Y2HA 2WGWA 1XP4A 4Y0TA 3MZEA 2PBYA 3OPPA 5J8XA 1IYPA 4ZJ3A 4DXCA 4H8RA 3NI9A 2Y2QA 5F1GA 1U60A 3N8SA 2HPBA 4ZTKA 3SH7A 3IF6A 3IXGA 2GDNA 3G2ZA 5AQ7A 2ZC4B 2IWCA 5EUAA 1PZPA 1K57C 4KG5A 2Y2LA 4Y0OA 2IWDA 4UHUA 2HP5A 4RA7A 3VSKA 3A3JA 1YM1A 1PYYA 4IVKA 3IXBA 4DDYA 1YMXA 4IVIA 1NZUA 1LHYA 3NIAA 4JF4A 5HL1A 1BT5A 2XH9A 4KZ5A 2ZM2A 3G2YA 5FSRA 2H0TA 2FFFB 2ZMAA 3PTEA 3S22A 4S2OA 1LI0A 2HDUA 3ISGA 3HL9A 2VGJA 3WS0A 2FFYA 3SS3A 5CGXA 3DWKA 1SDEA 1CEFA 1MBLA 1BTLA 5HAQA 1TVFA 4S2IA 4E3OA 5DF8A 1K55C 3RXWA 2E8IA 2WAFA 2Y2KA 1DJCA 4OH0A 3UNWA 1HD8A 1RP5A 4FD8A 3OCLA 4LV2A 4R0QA 3PBTA 1MKIA 4MEZA 1DJBA 4D2OA 5HW3A 1C3BA 1GA0A 4GOGA 3NDEA 1YLYA 2Y2JA 4DDSA 4JPMA 4JBFA 4PM6A 1K6RA 1RGZA 5FQKA 4EV4A 2J8YA 3BFGA 3N7WA 3OPRA 1ONHA 3WS1A 4Z9QA 2UWXA 3BFFA 4UA9A 3GR2A 4JXGA 4PPRA 1ES3A 1L2SA 1PZOA 1W7FA 1TDGA 4OQ0A 2XEPA 4LCMA 2XFTA 4JKTA 5BOHA 4E3KA 5CECA 3IHBA 4DXBA 3C4OA 5DTSA 1YLZA 3PBNA 1KDSA 1J9MA 3G34A 3TSGA 4FCFA 2CC1A 4OOYA 5KMWA 5E2GA 4OOMA 5CTNA 3C7UA 5EOEA 3UDFA 5F1FA 1Z6FA 5FQQA 2HP6A 1XX2A 1PWCA 4PM8A 3O86A 1ONGA 2OLVA 2H5SA 3VFHA 1FOFA 4S2NC 3UE3A 3ZHHA 4OVDA 5CEDA 3UPPA 2WGIA 4K91A 4OKPA 3Q7VB 5JYOA 5A93A 4BQMA 4IEDA 2WGWB 3W4PA 5EPHA 1NRFA 3ZG7B 1G68A 2ZC3B 1ES2A 4FSFA 1JWVA 2WZXA 3JYIA 5E2FA 5FAPA 3M6BA 4E3LA 4ZAMA 4Q8IA 4KQQA 3IHAA 3Q81A 4DE2A 2QMIA 1W79A 2ZC7A 3PBSA 1L0FA 2PU2A 4GD6A 1I2WA 3PBQA 3GTCA 4DRTA 3G30A 4KZ3A 3C5AA 1GHPA 3AGFA 5CHUA 1JVJA 1Q2PA 2DCFA 4P6BA 5FI7A 1HTZA 3ZG9B 3IXDA 5GHXA 4S2LA 3VSLA 3Q7ZA 1HZOA 3CG5A 2BLSA 4N1HA 5CGSA 1K38A 1KVMA 3HLDA 1BLSA 4B4ZA 3FKWA 4P85A 1L0DA 1MWUA 3HBRA 1L0EA 4QU3A 4X55A 5CTMA 4KZ4A 4GZBA 1H8ZA 4MBHA 3NDGA
chains in the Genus database with same CATH superfamily
1OTBA 4E3MA 4QY6A 1S1YA 5B31B 2L5AA 2V9AA 4H9SA 3KSIA 1EW0A 4OLDA 2JE5A 3UT9C 4KUDA 5B0YB 2WADA 3SS5A 5M18A 5CPJD 3AL0C 3X1UC 2AVXA 3KWQB 2HF6A 5BNXA 1NY0A 2Y2OA 2RVQD 5AV6C 4JXWA 4I38A 3MNNA 1T19A 3WS4A 3RXXA 3REHA 5AV6A 1NZOA 1PIOA 4WU8D 1PW1A 2WUQA 3GSGA 3TU4A 4L9GA 1B6WA 1TS0A 3G32A 4KQRA 3S7PA 3B0BA 2WKPA 5GL9A 5HPIA 3QP4A 1YLPA 4KENB 3TU4B 2FJ7B 1M19D 2P08A 2H28A 1P3OD 3F1OA 3EWKA 5KSHA 2MJ6A 3E2LA 3QP6A 1DP8A 5L10A 3H9WA 4GDBA 1N1JB 3AN2A 2XRNA 4P87A 5TR7A 4ETXA 3KXBA 2Y4AA 4R38A 3GV9A 4Z2LA 1XKZA 3VFFA 3O5YA 1E25A 3KSHA 4J8VD 2J9PA 3IX3A 1ESIA 3WA9A 4GKUA 2OAQ1 5CPID 3C7VA 4XZQC 1WYBA 5FQIA 3LELA 3AZFD 1BUEA 1OMEA 3X1VC 3U2AA 3I7JA 3C1CB 5EV0A 1TEMA 1MKMA 5FQ9A 1S32C 3W2ZA 1G28A 4KZ7A 4J8WD 5IHVA 3VE3A 3AZFC 1CK3A 1ESUA 3AZIA 5CHMA 4J8XC 3F1NA 2G5HC 3WKJB 3ZGAB 3LR3A 4HI4A 5AVCA 4XZQB 2HP9A 1P3LB 4LV0A 4ESPA 3GVBA 5AQ9A 4WZ4A 4N1XA 2V20A 1VM1A 4AFIA 2QHKA 5CP6D 4C3QA 3MKFA 4P0MA 4JJNA 5TFQA 1XGJA 3T4LA 1P3FD 3AZMD 1S66L 3EPLA 4GS9B 1GHIA 5HD3A 4XUXA 4J8WC 4MB5A 1TD5A 4E45A 3VP1A 2R78A 3WTPB 3A0VA 3B3XA 2Z6DA 4YM6D 3UB9A 5BPVA 3FPWA 1P3BD 3REHB 2J9OA 3VP0A 5B24D 4R3BA 4R1GA 5DNMB 4HMDA 1KS0A 5G18A 2YKFA 4FOFA 1XJ6A 1PRQA 2PR6A 5EVEA 1AIWA 2ZOIA 3NQUA 5GXQB 2GX5A 2WKHA 1FR6A 3KSYA 5DNND 1P3AA 4WZ5A 4YINA 4NY2A 1H5XA 1VETA 2YKHA 4ZRRA 4NZ1A 4RYEA 5FAQA 2ZL1A 2E8JA 2F8NG 1OPXA 3MVDC 4BBTA 2KX6A 1KX5B 4DJ3A 1IKIA 4Y0UA 1MWSA 3ZQ5A 2D01A 3MJQA 4OP8A 3N3FA 3AV1C 3T12B 3FYZA 4EBNA 4WU8A 3S7OA 3BM6A 3R7WA 4R8PA 2W1RA 1Y28A 1ZG4A 3L2AA 4KUDD 1K6SA 2R9WA 5CPJA 1E6ZA 4Z5TD 1ES5A 5F99B 3NDGA 1E3UA 5AVBD 1G6OA 1M18B 5E5AD 4KZ6A 4KHAB 3B0CW 1VQQA 2YFVB 5EVIA 4G3WA 4H9PA 2VV8A 4EWFA 4EQIA 2OV5A 4EEUA 3NQUB 4JLFA 2BG1A 3A0SA 4MMNA 3C1BA 4K08A 4GW9A 3M2JA 1NRJA 2Y55A 1KGFA 1KX3C 4IBEA 4LV1A 3B42A 4KUKA 4N92A 2Y2GA 4QLCC 2XR0A 1I2SA 1HVBA 3GQZA 3MQ0A 2Y59A 3NHQA 1D1JA 2R9XA 3AZHC 5GHZA 2C6WB 4ZUXD 2YFWA 4S2PA 4GD8A 3O88A 1KOUA 4BBVA 4EO5B 2V5OA 3CAXA 3NCKA 4GNUA 1AXBA 4IUHA 5HDSA 4NE5A 5B32B 5CPJB 3A6NC 2NZDA 4Z2KA 3G31A 3IF6B 5HSQA 3UB8A 1TAFA 3IH9A 5AY8C 3RJUA 4JGPA 2XQZA 2XD1A 1OTEA 1YKDA 3IXHA 1FSWA 1LL9A 3H82A 1ID3B 1OT6A 3NY4A 4GCZA 2Y91A 5FATA 1PW8A 1W63M 1KGGA 4L0LA 4U3TA 1ID3A 1CJFA 3N4IA 5CX7A 3LJAC 4MN5A 3V9RA 5B1MC 3P7NA 5B31G 3AFAD 2EA9A 5DF9A 1OJ5A 3T4JA 3ZNTA 4ARZA 4WU9B 3CPTB 3ZYTA 1SCWA 2ZM8A 5CP6A 3ZFZA 1IYSA 1NJ4A 4KZBA 4IBDA 1P3IB 3A3IA 1P3FA 3RH8B 2HUEC 3OPHA 4MNRA 3FKVA 3AZED 5KDMB 2B95A 4WU9C 2Y2PA 2RIQA 4NFTA 3KWQC 3KS8A 3WA9C 3LI9A 1O7EA 5E2HA 1QMFA 3AZFB 4CAYB 1GPFA 1IKGA 1FCOA 3VMAA 1JTDA 4O8GA 3KYEA 3T50A 1ERQA 3F6TA 4G3VA 4C75A 1CI8A 4LD9D 2H0YA 2Y2NA 4R3JA 5HPFA 3AZEC 5EVIB 3LY4A 5FL3A 1CQAA 4MN6A 2NQBB 5FQMA 4KUDB 1BSGA 3S7NA 4HNBA 2QZ6A 5B1LD 3CHWP 2BYKA 3AZKA 1P3BC 1YLTA 3AZGC 5D3OA 3AZMB 3HLBA 3Q1FA 2DRWA 2VA0A 2PYOC 1CI9A 2IWBA 4Y15A 3HJKA 5BS7C 1YQSA 4M3KA 4XUZA 3LEZA 3AZMC 1P34C 5TBMB 5B24B 2EFUA 5DNMD 3PAGA 3MGPC 1OJGA 1XP4A 4LRYC 1YU2A 5J8XA 1IYPA 4ZJ3A 4DXCA 2Y2QA 3N8SA 1H0GA 3IXGA 3BW6A 2GDNA 4J8XD 4KUOA 1PZPA 5AV8D 4HGAB 2EWWA 5HWWA 4UHUA 4JGRA 3EG5B 1YM1A 1PYYA 3IS2B 2BYMA 2VLGA 2BYKB 4TX8A 3DBAA 3G2YA 2FFFB 3UTBB 1KX5C 1LI0A 2V0UA 3HL9A 3SS3A 4EO5C 1ID3D 2F2AC 4WUJA 3E4QA 1MBLA 3KXBD 5HAQA 5DF8A 1K55C 3RXWA 2E8IA 2WAFA 2NQBA 4L9FA 3JPUA 4ZBJB 2FN2A 2W3FA 3CLOA 3C30A 3PBTA 4WN5A 1DJBA 5HW3A 1Z09A 5E5AC 1C3BA 1GA0A 1KX3B 5AVBC 1H3QA 3O62A 3WD0A 2A2LA 3B6GB 3LYXA 3AN2C 4DDSA 4PM6A 1K6RA 5FQKA 3TW8A 3BFGA 3AZEA 3N7WA 3OPRA 5DKLA 5EFWA 5GT0C 4PPRA 1ES3A 1L2SA 1TS8A 5AV6D 3W98D 5CECA 1W63Q 2HV1A 4DXBA 2IA2A 1EQZC 5DTSA 2HIOD 2XA7M 1J9MA 3TSGA 5CPJC 3LIEA 5B32C 5E2GA 5F1FA 5EOEA 4QPRA 3MGQB 5GT3C 3W96D 1TS6A 2OLVA 3UMEA 3AZKC 1P3BA 1M19A 4GH9A 5GT3D 2WGIA 4OKPA 3CPTA 3OBFA 4IBFA 3REJA 5A93A 4IEDA 2PYOA 5EPHA 5B32D 1NRFA 2FJ7C 3ZG7B 3LELB 2WZXA 4ZAMA 2M7UA 2ZC7A 2PU2A 4UQIS 1ACFA 1S32B 1GSWA 3G30A 4Q0HA 4GHLA 3C5AA 1P9RA 5CHUA 1Q2PA 3X1UA 4P6BA 4HY8A 2PHYA 4S2LA 3VSLA 4H9RA 3MNNC 1KVMA 1JFIA 3FKWA 4P85A 5HL6A 1CXWA 3TJZC 3B6FC 5BNXB 4BMWA 1H8ZA 2FJ7A 5KIZA 5B40C 2J3TD 3MSHA 1P3AD 3C4PA 5GSUC 3AZKD 3AZID 5CP6C 3KS4A 1PWDA 3EPJA 4LG2A 4CLCC 4NYUA 3AYWD 2I9VA 3MQOA 1D06A 4UA7A 4EERA 1XXMA 4U0TA 5DTTA 1M1AB 5AVEA 4JJND 4WV4B 4H9NA 3BQ8A 4H6JB 2ZQ8A 1PDCA 3G6OA 4YS3B 4F94A 3VH5T 4KQOA 2F8NK 1EWZA 1K55A 3MXRA 4EQ1A 1QMEA 3WAAB 1RGYA 4WZSB 3OOVA 3ZG8B 1E15A 2Q9MA 1CF0A 5AQAA 2QJ5A 1WYCA 5E5AA 1VHMA 3MGRA 1W1YA 5B24A 2EX2A 5AV8A 1KE0A 1BH9A 1GA9A 4PM9A 4ZUXA 3L26A 2WKEA 4JF6A 5DNMC 3W99C 3S1YA 2WK0A 3IX4A 1XA1A 1BH8B 3V50A 2OWHA 1P3OC 2VGKA 1GSXA 3ZG5A 1W2EA 1NLZA 4BL2A 3P98A 3MZDA 3AZGD 2V1ZA 5CGWA 3UE6A 3N8LA 5B1LC 5F83A 5AY8A 1E6PA 1N9NA 1PZRA 4CSRA 5CPIC 1P3GD 2ZC6B 4LFUA 4EBPA 5B2JB 4AWLC 3UPOA 4NE3A 4Z2MG 3RTYA 4IBGA 4CLCD 3UT9D 3G35A 3UDXA 2Y2IA 5IS1A 4QB8A 2XFSA 3MGQC 1KGEA 5GSUD 4JGQA 2CV5D 3D9YA 3DW0A 2KLIA 1LSWA 3HLEA 3AZHA 3SS4A 4QLCB 2JKGA 3AZJC 4EEPA 1OGBA 4H9OB 1M19C 4F3LA 2XK1A 3WAAA 1MWTA 2Y8HA 3WD2A 3L29A 1WA9A 3KWQD 3UTBD 1IYQA 3IWIA 1S4RA 3BECA 1K25A 4H9SC 3C1CD 5MC7A 4H9NB 1YU0A 3WRTA 1HQ3B 3R45A 1L3LA 3MQQA 3B6GC 4GB7A 4WU9A 4KG6A 3AZJD 4O7DA 3IF6C 2PDRA 1KU5A 4Z2MH 2CV5C 2FJ7D 3WD3A 4XUJC 1W5DA 3CWFA 3GRJA 3KSFA 3NULA 4WU8B 1KX4A 3X1SA 2ZQAA 5CP6B 1MY8A 5J3WA 2O9BA 3G4PA 3W4OA 2EFXA 3LIDA 1P3FB 5B2ID 2JKTI 4OQGA 1WWIA 4OJPA 1W8QA 4NETA 4G3KA 4PKYG 1K54A 3UE1A 3CUEA 3F1PA 1UR8A 5CPIA 3MS6A 4HJ6A 1M1AD 4Z2IA 3A6ND 3REIA 3DTEA 2ZLYA 3AYWA 3AFAA 4J8UC 2DMWA 5GLCA 4NXFA 4GHIB 1S6RA 3HVFA 3SW1A 5B1LA 5EVLA 3LR0A 2ZC5B 1P9WA 3AGEA 2O9CA 1X0OA 3UTAC 4HBTA 5J4EA 5KZHA 5HAPA 3HREA 3LJAD 3T1RA 3HSHA 5KSCA 2B5RA 3VV4A 4J8WB 1ODVA 1VETB 3CJMA 3O87A 3E98A 3M6HA 3A0RA 3VP4A 4KG2A 3LIBA 1AOID 1FSYA 4IBXA 4Z66C 4OPYA 3B47A 2AROD 3D3OA 4EUVA 5G49B 1T1CA 1I5QA 4JJNC 4YM6B 3SZTA 4EW7A 4CJNA 3AZKB 3AZIB 2X01A 5EM1A 3B6FB 5EVIC 3MFDA 3M2KA 3UTAB 1SKOB 3AYWB 3ZCZA 2K7SA 5F99A 3W4QA 1KX3A 3T1QB 1K4FA 3OZHA 3AZIC 4R23A 1M40A 2F8NB 4R70A 1ZTUA 3LICA 4M4XA 4UUZB 2CV5A 5DNNA 4JJNB 1P3MC 1UGUA 1Q9CA 2IO5B 3WKJA 5HAIA 4DN0A 4X56A 3DAVA 1F2KA 2ZQDA 4MB4A 2PYRA 1S67L 5GXQD 2ZM0A 3UTBA 5BS7A 4DJ2A 2ZY4A 4G91C 2JKFA 1E6NA 3MKEA 1TZYA 3X1TA 3HLCA 3W98A 3AV1A 2EWVA 3VOZA 1TZYC 3X1TC 4HGAC 5G49A 3IT9A 3REIB 3Q82A 4R8PD 2NUPC 1XFQA 3AGDA 5DKKA 4EETB 5FASA 3ZNYA 4I39A 4Q0JA 3KWQA 3AV2A 1P3KC 2H10A 2ZOHA 1GXDA 3W96C 2UV0E 1K4EA 5EUAA 3H7WB 3LZ0A 2G2UA 1BULA 2IOUA 4YS3A 2DQNC 2F8NA 5K5BA 3UN7A 4Z5TB 3W98C 4HESA 2KDKA 4FH4A 1NWZA 3C2WA 3OLOA 1P3KB 3R4KA 1P3GB 1BLPA 3A6NA 1KDWA 3LIAA 3BWLA 2A24B 3B33A 5GT0A 3A6NB 5E43A 1P3PD 4KGCD 2Q0OA 1MWRA 2ZQ9A 1U35B 3T4TA 3LZ1A 3V3SA 1T18A 5IT5A 4WEKA 3L25A 5FDSA 5L07A 1ES4A 4H9PB 5TJJA 3O62D 3R7WB 2C5WB 5CPKC 5B0YA 3WRZA 5F69A 2W3EA 3EQUA 4HEFA 3P5JB 4IJEA 3LZ0B 3K3DA 3KYQA 1T3UA 4IJFA 2Y2HA 4Y0TA 3MZEA 5B1MB 5B2JA 2JSSA 4H8RA 1STZA 2O0YA 2GZAA 4ZTKA 3SH7A 4J8UD 2V8FA 2ZC4B 5CPKA 5AV9B 2PD8A 1OTAA 3V67A 2Y2LA 5AV5C 4Y0OA 4HP4A 5B2IB 2HP5A 4H9OA 4NE6A 2VKSA 4IVKA 5F68A 4I3IA 4JF4A 5B2IC 4KZ5A 3PTEA 3S22A 4B93A 3H82B 4S2OA 3EEAA 3ISGA 2IO5C 5CGXA 4J8VC 3DWKA 1BTLA 4E3OA 3AZEB 3AV2C 4WF0A 4OH0A 1P3AC 3QP1A 2K2NA 4FD8A 3RELA 3PYPA 1IOUA 3B0CT 5B40A 2VX8A 1MKIA 4MEZA 3KX0X 1P3GA 3LJAB 1YLYA 3UT9A 4KUDC 4NYYA 5B33D 1ONHA 5B31A 4G92C 3C1BC 4NXGA 3L28A 1AOIB 3AV1D 4E3KA 3IHBA 1YLZA 3MGSB 1P3KA 1KDSA 1ZLAC 4OOYA 5KMWA 5CTNA 3C7UA 3MGSA 1TZYB 3X1TB 1PWCA 3WA9D 3O86A 2H5SA 3C1CA 3MGSC 1FOFA 4S2NC 3UE3A 1P3OA 4OVDA 3ZHHA 4K91A 2QWSA 4OJ6A 5L8MA 2QJ7A 3W4PA 5F5YA 1P3OB 1P3GC 1G68A 4FSFA 5FAPA 5E2FA 4HH2A 1EQZD 1BFMA 2F8ND 3Q81A 3BQAA 1TF1A 5F99C 3S7QA 3PBSA 1L0FA 1M18A 4I5SA 4EXOA 4HMEA 2DCFA 4Z66A 1HTZA 3ZG9B 1P3MA 1VEUA 2PAVP 3IXDA 2G7UA 3Q7ZA 3CG5A 2VZWA 4UPKA 4N1HA 3AZJA 1K38A 3HLDA 5CGSA 4B4ZA 3EGXC 5DJUA 3U4LP 3W99D 1L0EA 5CTMA 4KZ4A 4GZBA 3AZLA 4U0XA 3WWXA 1O6IA 3B0DC 5AY8D 2JCHA 1W1PA 3LIFA 4OQHA 3KXBC 2ZL1B 4H9QB 5HWVA 3V39A 3LZ1B 2PU4A 5B0YD 5B32G 3EOIA 2B02A 4CLCA 5B2IA 3VP3A 2EX9A 4KZ9A 3ZG0A 5EE8A 2FZ0A 1B67A 5AV9C 4RX2A 1HQ3C 3TU4C 5DF7A 3AZHD 5AV9D 1F66A 1IEMA 2Z2MB 3M7PA 3LFVA 4PMAA 4S2KA 3UO9A 3NQJA 3H0LC 1S32A 5A8BA 3PR6A 5CEBA 2J8PA 4X69A 1P0ZA 3AZND 1M19B 3T4KA 5B0ZB 3FV7A 3MXSA 4R4RA 1A0KA 5AV6B 3W98B 1JTGA 1XGIA 2P74A 1N4OA 4E6WA 3QNBA 4DE1A 3CZDA 4XUJD 3EEHA 3TRCA 3VOLA 2PR5A 1U35D 5CPKB 3RELD 3X1VB 5A91A 3LZ0C 4K0WA 4O0PA 1YLWA 1ERMA 4JF5A 5M1AA 3MZFA 3X1VA 4OONA 1KX4D 3W8KA 2PRFA 5F82A 1H0MA 4XZQA 1MXOA 1S4SA 4JGOA 3HUNA 5L2FA 1AWIA 3VE4A 4I3JA 5B31D 1E3UD 4WMCD 4ID4A 5LBRA 3WKJD 1W8YA 5HFOA 3B6GA 5AV5B 3TG9A 4GS9A 1IELA 4LD9C 4J8UB 1TAFB 4M6BA 5GT0B 3MGSD 4BENA 3BRMA 2XF3A 4DF6A 5B40B 1ULYA 1YMSA 2M7VA 3ZVTA 5J7EA 5I94A 5DVAA 2JKTM 3R45B 1KE3A 4XXRA 4X23C 2ZY5A 5AVCB 4OJOA 3DTIA 3NECA 1OTIA 1SKOA 3V5MA 3C1BD 2P9VB 2CWEA 1OT9A 4YM6C 5BO0B 3AZGB 2XROA 3BJNA 1TS7A 3FWLA 3REHD 3AZLB 2W1TB 2PYOB 4YS3D 4EUZA 4GHAA 4WNNA 2NZDD 2L0WA 1QO6A 4J8VA 1V9ZA 4H9QA 1YT4A 5JRGD 5AJGA 2X02A 5KDMA 4Z1WA 3AV2D 4XT2A 4OQIA 1HLUP 3REKC 5DNNB 4QD4A 3VP2A 3WS2A 5FAOA 3FDDA 2GNXA 3LY3A 5B1MA 2VEAA 3AZLC 4ZDXA 4BWIA 4OPRA 4ME4A 5A90A 1D7EA 2BYMB 3ICYA 2RL3A 3LZ1D 1ED7A 3EPKA 4QJGA 1GOIA 3HUMA 5GLAA 1K54C 3V3RA 4R3AA 4LGWA 5FUGA 2D02A 1L0GA 2P7JA 3MBZA 3A3EA 2NQBC 3ITAA 2Y2MA 3PBOA 1YLJA 4LLOB 1DP6A 5AVBB 5HD5A 5B0YC 1UWNX 4EU0A 3DTKA 3LELC 3HJIA 3AZNB 3W97B 4UEYA 4FUWA 3MR0A 3V9RB 2ZMVA 3WTPD 1F66D 1LL5A 1PI5A 5IU1A 1YSQA 2V2FF 3CUEC 1T1AA 2P9VA 3QNCA 4LRXC 5CRFA 4WM9A 2J7VA 3X1SB 3FPVA 2G2WA 5CPKD 3P01A 2M1CA 4UQIM 3BY9A 3BYDA 4P6ZS 3HLFA 3N8RA 3WS5A 3UT9B 2ZBBA 2L4RA 3W99B 4HOIA 4E44A 4XUJA 1KVLA 2L1MA 4YWZA 2RCXA 5GSUB 4J8UA 1UR9A 2EXAA 4WEJA 1P34A 5JA4B 4Z5TC 4S2MA 5AY8B 3CI6A 3ITBA 3BLSA 4X68A 3A3DA 1W1VA 3FG8A 2OLUA 2I72A 1FIKA 3N6IA 4LD9B 1PFLA 4PM7A 1MPLA 1WE4A 5B40D 2EXBA 2HIOC 4WZ5C 3MMHA 3K2NA 4I3AA 4YOFA 4Z5TA 3Q7VA 5B0ZD 3VH6T 2PT7A 2AROB 3ZDJA 5CERA 5B33C 4NKPA 4NZ5A 3L7HA 4IUKA 4CPKA 1K56A 3B0DB 5DTKA 3UPNA 2ZM5A 1V9YA 4IBJA 3E2KA 2A49A 2XLNA 5JRGA 3A3FA 5GXQC 2YFWB 3QHYA 4E6XA 3UY6A 3BFCA 4NK3A 4S2JA 1TDLA 1KE4A 1F98A 2OSUA 4HMCA 3C38A 2ZD8A 4L9EA 1Q2QA 1DRMA 1H8YA 3EQVA 4BD0A 3LJAA 1SKFA 1BH9B 4II7A 4BD1A 4CLCE 4X6TA 2YFVA 4A5RA 1SHVA 1P97A 3O62C 2O9AA 4N9LA 2PYPA 1CEGA 3GDIA 4HQAA 2HUEB 5JRGC 1IYOA 5AV5D 1NXYA 5U47A 2AROA 5C3IB 2Z6CA 3W99A 1JFIB 3FZCA 5DJTA 2NQBD 3KUYB 4OPZA 1XPBA 1JWPA 2J3WA 4Z66D 1AOIC 4GN2A 3MXQA 4D60A 3MGPD 5HZHA 3F1NB 1GCEA 1KX3D 4E3NA 1L6JA 1BLCA 1LL8A 5AVFA 4X23D 4Y13A 3C1BB 1BYWA 4RX3A 3TOIA 3JVVA 3AZLD 1XFNA 4ZJ2A 1P3MB 1VEUB 4B88A 4LENA 1Y54A 5FEGA 2PYOD 3UTAD 2HGVA 1PNEA 1YU1A 2HIOA 5FUGB 5C3IC 1P3KD 1VB6A 1ZHHB 3NI9A 1P3LC 5GXQA 1U60A 3W96A 3AV2B 1G5UA 5AQ7A 4H6JA 2IWCA 4YS3C 3REJD 4KG5A 4ARZB 4MN7A 3VSKA 3A3JA 3UTBC 4BBUA 1YMXA 2V0WA 1NZUA 3NIAA 3E0YA 1H8MA 2VGLM 2XH9A 3T4OA 2ZM2A 3VH5A 2H0TA 2ZMAA 1P34D 3LEQA 5F6AA 3X1UD 3LZ0D 3WS0A 1E8BA 3KXBB 1SDEA 1CEFA 2A24A 2INWA 1TVFA 4S2IA 4Y2FA 2Y2KA 1YU4A 4HJ4A 4KQDA 5B0ZA 3UNWA 1HD8A 3OCLA 2W0NA 3TE8A 4D2OA 3B6GD 4HJ3A 4GOGA 3MVDA 2Y2JA 4JPMA 1Z2CB 1F66B 4JBFA 1RGZA 2DF4C 2VV7A 5B31C 1P3PB 4KGCB 3NOTC 3WS1A 4Z9QA 3BFFA 4UA9A 3GR2A 4JXGA 4X1MA 1Y4OA 1PZOA 1W7FA 3MGRD 1TDGA 4ZBJC 4JKTA 5CPIB 1A7WA 3PHYA 2HZ5A 5B2JC 4NXEA 3E4OA 3PBNA 3G34A 3RELC 2CC1A 4HIAA 3MGQD 1Z6FA 2HP6A 1P3IC 4PM8A 3VFHA 4E04A 3T1XA 5I5LA 5CEDA 3UPPA 3Q7VB 5JYOA 4BQMA 2WGWB 3LELD 3AZFA 3T4QA 2ZC3B 1ES2A 1JWVA 3AZNC 3JYIA 4PHTA 3M6BA 4KQQA 3IHAA 2NZDC 4DE2A 4DRTA 3WD1A 1SZVA 4J8XA 4KZ3A 3KUYC 5B33B 1JVJA 3KUYD 1M1AC 2AROC 5FI7A 1HQ3A 1R4VA 4Y17A 3LI8A 5B1MD 5GHXA 1P3IA 1MZUA 4XZQD 1HZOA 4EESA 4X23A 2JKRI 1L0DA 3HBRA 4QU3A 4X55A 3S4XA 4MBHA 2JC7A 2OOLA 5GSUA 4DQYB 1P3AB 4C6YA 4WMCA 1LI9A 1FR1A 4J8VB 2CMNA 4P6ZM 4YFMA 4DKIA 4Z2JA 5AVCC 4MB3A 1ZLAD 1WWSA 3MNNB 4MCWA 2WGVA 2J80A 4Q0IA 5EM0A 2Y79A 1FCNA 3ZVWA 4CLCB 3VOYA 2O99A 1GHMA 1BZAA 3EPHA 3VH6W 4H9RB 3DWZA 3L27A 2Q9NA 3WAAD 5B33A 5FI6A 4KZ8A 3UB6A 4X53A 1KX4C 2HDSA 4OJ5A 5GLBA 2W3HA 4CAYA 1DY6A 2JHEA 3IWOA 5M19A 1P3LD 4X1LA 4WJ3C 4NZ3A 2F8NH 2GJ3A 4OLGA 4UA6A 3X1UB 3L9KA 1W1TA 4HBUA 3MQLA 1MC0A 3IQAA 4E3JA 4GJ4A 1S0WA 5GT3A 4N9KA 3AV1B 2LY8A 1E88A 4AWLB 3BFDA 4Z66B 1EROA 3Q07A 4KZAA 5B32A 4GDNA 3WAAC 1P3BB 1FQGA 3LO7A 4X23B 2HDRA 3IWQA 5AVBA 3REJC 1M18D 3LGOA 3BLMA 2EX8A 5TGFA 4IBCA 1SDNA 3O3VA 5FI2A 1M1AA 3MVDD 3UB5P 1EQZB 4PM5A 3PBRA 5HX9A 4CQHA 5BT1D 3IF5A 1FCMA 4MBFA 5FA7A 3REKA 2JBFA 2WKRA 4FTXA 2RTSA 1AOIA 3REJB 3LCEA 3D4FA 3QP2A 1KX5D 3VH5W 4Z2HA 1K56D 5A92A 3JVUA 5JA4A 3HONA 4BL3A 3NJAA 3UDIA 1HTAA 5L09A 4KHAA 3W97C 2ACGA 2ZMFA 1XJ2A 2HJEA 2VJWA 4LCLA 1P34B 1HQ3D 2HDQA 5AV8C 4IBIA 3AN2D 5DFYA 4WBGA 3REIC 3AZHB 5F99D 5AV9A 1IFQA 5C5KA 3NBLA 3WD4A 1G6AA 2V1BA 1E4DA 3AZJB 3AFAB 2WAEA 4DRAA 2V1AA 3IS2A 1K57A 5B0ZC 3FC7A 1XA7A 1ID3C 3W97A 3IP4C 5E2EA 1P3ID 2W3GA 5HWTA 3B6FD 4ZBEA 5CHJA 1F5MA 3MGRB 3WX7A 5JYPA 4ETZA 3MNND 2P04A 3IH8A 2PBDP 3HLWA 1NYMA 5CHLB 5HDCA 4OOLA 2JKRM 1N9BA 4WU8C 2W8SA 1T1BA 2KOIA 2XGNA 1JWZA 4EBLA 4R8PC 5BO0A 3AZGA 1ZLAA 5GLDA 2RVQC 4UUZA 2CV5B 4BLMA 2VQRA 2NZDB 2W3DA 2D49A 4WNNB 4IHQA 4QWOA 1KX4B 3AZMA 3DTMA 4NXBA 2WKIA 4OUIA 2BTFP 3IX8A 4OPQA 4DE0A 4RVAA 3MGPA 4PAUA 2NUTC 3BFEA 4YM6A 1NYYA 3HLGA 3PAEA 1N9OA 4FH2A 1P3LA 2W1TA 3UE0A 1M6KA 4JXSA 1GSVA 2Z2LB 4WU9D 3MFXA 1YPRA 5GT0D 1YAXA 3SH8A 3OCNA 5EECA 4WYYA 4J8WA 1DJAA 3NQJB 1RCJA 1UWPX 3A1KA 3KO6A 5B1LB 1O07A 3P09A 1ZKJA 4Y3IA 2WZZA 2ZY2A 4R6LA 3REKB 1F9IA 4HP9A 5AVCD 2OWJA 1ZLAB 3EGDC 1ZC2A 5JRGB 4QY5A 4NG2A 4K0XA 4QHCA 3UB7A 4R4SA 4J8XB 4B4XA 3QP8A 3NOPC 4LRZE 1BLHA 3X1SD 3NC8A 1ZG6A 2ZJ9A 2ZQCA 3D72A 2XD5A 4BJPA 1F66C 2A3UA 5EOOA 2ZQ7A 3NOUC 4ZJ1A 3A1IA 5EVID 4LV3A 1BH8A 2V8CA 3CMZA 5AV8B 3UTAA 1KX5A 3IBRA 3OPLA 5AQBA 3REID 3BY8A 3HUOA 4MDZA 4ZUXC 4MBKA 2QKPA 4OP5A 4X25A 5BNVB 3AFAC 4XT2B 3BEBA 3SOIA 5FDHA 3HCYA 2DNSA 3W97D 1EI5A 4DMZA 3LZ1C 4MLLA 5GHYA 5CXWA 3WTPA 4E3IA 3SH9A 1F1EA 3E4PA 2B18A 2XDMA 4Y5FA 2LB9A 3MGRC 3GECA 1YU3A 1JNUA 5FQJA 2ZY3A 4JXVA 2VK3A 3MVDB 1H3OB 4QLCA 2QPNA 3LR5A 4IBBA 2WYXA 3GMWA 1P3PC 4KGCC 4WELA 3W96B 4Y7PA 4DE3A 1LT0A 3H7WA 4WLAA 4IBRA 4UAAA 3C1CC 4S2NA 1PI4A 5HARA 4WL9A 4NEED 1LLBA 2HIOB 1PWGA 2EX6A 2X71A 1E6RA 4IBKA 1CK7A 1N1JA 3AN2B 1J7MA 1YSPA 4GLQA 1H8PA 5GT3B 1U35C 4R8PB 1EAKA 3OC2A 1ALQA 3F1OB 2WGWA 1H0IA 2PBYA 3OPPA 1EQZA 5G4ZA 4Z2GA 3MGQA 5F1GA 2HPBA 3IF6A 3KSGA 1YUEA 3WKJC 3G2ZA 1TZYD 3X1TD 4HHDA 1K57C 4HH3A 2IWDA 3T4SA 4RA7A 3KYZA 1FILA 3TU4D 3LR4A 1OGGA 3IXBA 4DDYA 2FH5A 4IVIA 3FKEA 3MGPB 1LHYA 5HL1A 1BT5A 5FSRA 4B9OA 4DRBA 3ULFA 1P3FC 3KUYA 2HDUA 4YNRA 4OJLA 2VGJA 2HJ9C 2LB5A 2FFYA 1P3MD 1H3OA 3KFUG 3WTPE 2OAP1 1P3PA 5DNNC 4KGCA 4PKYA 3WTPC 1DJCA 2BASA 1XJ3A 3C8CA 2JN7A 1RP5A 3IBJA 1S1ZA 3PXPA 3O62B 3UMDA 4LV2A 4R0QA 2QYBA 4F3LB 3NDEA 4CSRB 2G5IC 1LSXA 3F1PB 5HDDA 5AV5A 5B24C 1K0KA 4O01A 3VH6A 1S32D 4EV4A 2J8YA 5FEFA 2PD7A 2UWXA 3QP5A 2VV6A 2K31A 3AZNA 1NLYA 1OTDA 5DFXA 5DNMA 4OQ0A 2XEPA 1LSVA 4LCMA 2XFTA 1DP9A 5BOHA 4QNLA 4GHIA 4G92B 3C4OA 3MF0A 3AYWC 4FCFA 4OOMA 4IJGA 3UDFA 5FQQA 1XX2A 1ONGA 3CITA 3WA9B 5E5AB 3K3CA 3REKD 5BT1C 2WKQA 2J3TC 2W27A 3LUQA 3H0RC 4RQ9A 5G4YA 5B2JD 4E3LA 4Q8IA 5TBMA 5BNVA 1M18C 4LPZA 2QMIA 1W79A 1U35A 4GD6A 1I2WA 3PBQA 3GTCA 3H0MC 3T1SA 3REHC 1GHPA 3AGFA 1J3WA 4XUJB 2VGLS 4G91B 3RELB 3X1VD 4LD9A 4NZ4A 4QLCD 2BLSA 1N9LA 3B6FA 2XSSA 1BLSA 3X1SC 2XA7S 1MWUA 3RFBA 4ZUXB 1XJ4A
chains in the Genus database with same CATH topology
4E3MA 4QY6A 5B31B 2L5AA 4H9SA 4OLDA 2JE5A 3UT9C 4KUDA 5B0YB 2WADA 3SS5A 5M18A 5CPJD 3AL0C 3X1UC 3KWQB 5BNXA 1NY0A 2Y2OA 2RVQD 5AV6C 4JXWA 3MNNA 3WS4A 3RXXA 3REHA 5AV6A 1NZOA 1PIOA 4WU8D 1PW1A 2WUQA 3GSGA 3TU4A 1B6WA 3G32A 4KQRA 3B0BA 5GL9A 1YLPA 4KENB 3TU4B 2FJ7B 1M19D 1P3OD 5KSHA 3E2LA 4GDBA 1N1JB 3AN2A 4P87A 5TR7A 3KXBA 2Y4AA 3GV9A 1XKZA 3VFFA 1E25A 4J8VD 2J9PA 1ESIA 3WA9A 4GKUA 5CPID 3C7VA 4XZQC 1WYBA 5FQIA 3LELA 3AZFD 1BUEA 1OMEA 3X1VC 3I7JA 3C1CB 1TEMA 5FQ9A 1S32C 4KZ7A 4J8WD 5IHVA 3AZFC 1CK3A 1ESUA 3AZIA 5CHMA 4J8XC 2G5HC 3WKJB 3ZGAB 5AVCA 4XZQB 2HP9A 1P3LB 4LV0A 3GVBA 5AQ9A 4WZ4A 4N1XA 2V20A 1VM1A 5CP6D 4C3QA 3MKFA 4P0MA 4JJNA 5TFQA 1XGJA 1P3FD 3AZMD 3EPLA 1GHIA 4XUXA 4J8WC 3VP1A 4E45A 3WTPB 3B3XA 4YM6D 5BPVA 1P3BD 3REHB 2J9OA 3VP0A 5B24D 4R3BA 4R1GA 5DNMB 5G18A 3NQUA 5GXQB 2WKHA 1FR6A 3KSYA 5DNND 1P3AA 4WZ5A 4YINA 4NY2A 1H5XA 4NZ1A 4RYEA 5FAQA 2F8NG 3MVDC 1KX5B 1IKIA 4Y0UA 1MWSA 4OP8A 3N3FA 3AV1C 3FYZA 4EBNA 4WU8A 3BM6A 4R8PA 1ZG4A 3L2AA 4KUDD 1K6SA 2R9WA 5CPJA 4Z5TD 1ES5A 5F99B 1E3UA 5AVBD 1M18B 5E5AD 4KZ6A 4KHAB 3B0CW 1VQQA 2YFVB 5EVIA 4H9PA 4EWFA 4EQIA 2OV5A 3NQUB 4JLFA 2BG1A 3C1BA 3M2JA 2Y55A 1KGFA 1KX3C 4IBEA 4LV1A 4N92A 2Y2GA 4QLCC 2XR0A 1I2SA 1HVBA 3GQZA 2Y59A 2R9XA 3AZHC 5GHZA 2C6WB 4ZUXD 2YFWA 4S2PA 4GD8A 3O88A 4EO5B 3NCKA 4GNUA 1AXBA 4NE5A 5B32B 5CPJB 3A6NC 2NZDA 3G31A 3IF6B 1TAFA 3IH9A 5AY8C 3RJUA 2XQZA 2XD1A 3IXHA 1FSWA 1LL9A 1ID3B 3NY4A 2Y91A 5FATA 1PW8A 4L0LA 1KGGA 4U3TA 1ID3A 3N4IA 3LJAC 3V9RA 5B1MC 5B31G 3AFAD 5DF9A 3ZNTA 4WU9B 1SCWA 2ZM8A 5CP6A 3ZFZA 1IYSA 1NJ4A 4KZBA 4IBDA 1P3IB 3A3IA 1P3FA 2HUEC 3OPHA 4MNRA 3FKVA 3AZED 5KDMB 4WU9C 2Y2PA 2RIQA 4NFTA 3KWQC 3KS8A 3WA9C 1O7EA 5E2HA 1QMFA 3AZFB 4CAYB 1IKGA 1FCOA 3VMAA 1JTDA 1ERQA 3F6TA 4C75A 1CI8A 4LD9D 2H0YA 2Y2NA 4R3JA 3AZEC 5EVIB 3LY4A 2NQBB 5FQMA 4KUDB 1BSGA 2QZ6A 5B1LD 2BYKA 3AZKA 1P3BC 1YLTA 3AZGC 5D3OA 3AZMB 3HLBA 3Q1FA 2DRWA 2PYOC 1CI9A 2IWBA 5BS7C 1YQSA 4M3KA 4XUZA 3LEZA 3AZMC 1P34C 5B24B 2EFUA 5DNMD 3PAGA 3MGPC 1XP4A 1YU2A 5J8XA 1IYPA 4ZJ3A 4DXCA 2Y2QA 3N8SA 3IXGA 2GDNA 4J8XD 1PZPA 5AV8D 4HGAB 4UHUA 3EG5B 1YM1A 1PYYA 2BYMA 2BYKB 3G2YA 2FFFB 3UTBB 1KX5C 1LI0A 3HL9A 3SS3A 4EO5C 1ID3D 2F2AC 1MBLA 3KXBD 5HAQA 5DF8A 1K55C 3RXWA 2E8IA 2WAFA 2NQBA 4ZBJB 3PBTA 1DJBA 5HW3A 5E5AC 1C3BA 1GA0A 1KX3B 5AVBC 3O62A 3B6GB 3AN2C 4DDSA 4PM6A 1K6RA 5FQKA 3BFGA 3AZEA 3N7WA 3OPRA 5GT0C 4PPRA 1ES3A 1L2SA 5AV6D 3W98D 5CECA 4DXBA 1EQZC 5DTSA 2HIOD 1J9MA 3TSGA 5CPJC 5B32C 5E2GA 5F1FA 5EOEA 3MGQB 5GT3C 3W96D 2OLVA 3AZKC 1P3BA 1M19A 4GH9A 5GT3D 2WGIA 4OKPA 4IBFA 3REJA 5A93A 4IEDA 2PYOA 5EPHA 5B32D 1NRFA 2FJ7C 3ZG7B 3LELB 2WZXA 4ZAMA 2ZC7A 2PU2A 1S32B 3G30A 4GHLA 3C5AA 5CHUA 1Q2PA 3X1UA 4P6BA 4S2LA 3VSLA 4H9RA 3MNNC 1KVMA 1JFIA 3FKWA 4P85A 3B6FC 5BNXB 1H8ZA 2FJ7A 5B40C 1P3AD 3C4PA 5GSUC 3AZKD 3AZID 5CP6C 3KS4A 1PWDA 3EPJA 4LG2A 4NYUA 3AYWD 4UA7A 1XXMA 4U0TA 5DTTA 1M1AB 4JJND 4WV4B 4H9NA 2ZQ8A 4F94A 4YS3B 3VH5T 4KQOA 2F8NK 1EWZA 1K55A 3MXRA 1QMEA 3WAAB 1RGYA 4WZSB 3ZG8B 2Q9MA 5AQAA 1WYCA 5E5AA 3MGRA 5B24A 2EX2A 5AV8A 1KE0A 1BH9A 1GA9A 4PM9A 4ZUXA 3L26A 2WKEA 4JF6A 5DNMC 3W99C 3S1YA 2WK0A 1XA1A 1BH8B 3V50A 1P3OC 2VGKA 3ZG5A 1W2EA 4BL2A 3P98A 3MZDA 3AZGD 2V1ZA 5CGWA 3N8LA 5B1LC 5F83A 5AY8A 1PZRA 4CSRA 5CPIC 1P3GD 2ZC6B 4EBPA 5B2JB 4AWLC 3UPOA 4NE3A 4Z2MG 4IBGA 3UT9D 3G35A 3UDXA 2Y2IA 4QB8A 2XFSA 3MGQC 1KGEA 5GSUD 2CV5D 3DW0A 3HLEA 3AZHA 3SS4A 4QLCB 3AZJC 4H9OB 1M19C 2XK1A 3WAAA 1MWTA 3L29A 3KWQD 3UTBD 1IYQA 3IWIA 3BECA 1K25A 4H9SC 3C1CD 4H9NB 1YU0A 3WRTA 1HQ3B 3R45A 3B6GC 4GB7A 4WU9A 4KG6A 3AZJD 4O7DA 3IF6C 1KU5A 4Z2MH 2CV5C 2FJ7D 4XUJC 1W5DA 3GRJA 4WU8B 1KX4A 3X1SA 2ZQAA 5CP6B 1MY8A 3G4PA 3W4OA 2EFXA 1P3FB 5B2ID 4OQGA 1WWIA 4OJPA 1W8QA 4NETA 1K54A 3UE1A 5CPIA 1M1AD 3A6ND 3REIA 2ZLYA 3AYWA 3AFAA 4J8UC 5GLCA 1S6RA 3HVFA 5B1LA 5EVLA 2ZC5B 3AGEA 3UTAC 4HBTA 5KZHA 5HAPA 3HREA 3LJAD 3HSHA 5KSCA 2B5RA 4J8WB 3CJMA 3O87A 3M6HA 3VP4A 4KG2A 1AOID 1FSYA 4IBXA 4Z66C 4OPYA 2AROD 5G49B 1I5QA 4JJNC 4YM6B 4CJNA 3AZKB 3AZIB 2X01A 3B6FB 5EVIC 3MFDA 3M2KA 3UTAB 3ZCZA 3AYWB 5F99A 3W4QA 1KX3A 1K4FA 3OZHA 3AZIC 4R23A 1M40A 2F8NB 4UUZB 2CV5A 5DNNA 4JJNB 1P3MC 1Q9CA 2IO5B 3WKJA 5HAIA 4X56A 2ZQDA 5GXQD 2ZM0A 3UTBA 5BS7A 2ZY4A 4G91C 3MKEA 1TZYA 3X1TA 3HLCA 3W98A 3AV1A 3VOZA 1TZYC 3X1TC 4HGAC 5G49A 3IT9A 3REIB 3Q82A 4R8PD 3AGDA 5FASA 3ZNYA 3KWQA 3AV2A 1P3KC 2H10A 3W96C 1K4EA 5EUAA 3LZ0A 2G2UA 1BULA 2IOUA 4YS3A 2DQNC 2F8NA 3UN7A 4Z5TB 3W98C 4HESA 4FH4A 1P3KB 1P3GB 1BLPA 3A6NA 1KDWA 5GT0A 3A6NB 5E43A 1P3PD 4KGCD 1MWRA 2ZQ9A 1U35B 3LZ1A 3V3SA 4WEKA 3L25A 1ES4A 4H9PB 3O62D 2C5WB 5CPKC 5B0YA 3WRZA 3EQUA 4HEFA 3P5JB 4IJEA 3LZ0B 1T3UA 4IJFA 2Y2HA 4Y0TA 3MZEA 5B1MB 5B2JA 2JSSA 4H8RA 4ZTKA 3SH7A 4J8UD 2ZC4B 5CPKA 5AV9B 2Y2LA 5AV5C 4Y0OA 5B2IB 2HP5A 4H9OA 4NE6A 4IVKA 4JF4A 5B2IC 4KZ5A 3PTEA 3S22A 4S2OA 3ISGA 2IO5C 5CGXA 4J8VC 3DWKA 1BTLA 4E3OA 3AZEB 3AV2C 4OH0A 1P3AC 4FD8A 3RELA 3B0CT 5B40A 1MKIA 4MEZA 1P3GA 3LJAB 1YLYA 3UT9A 4KUDC 4NYYA 5B33D 1ONHA 5B31A 4G92C 3C1BC 3L28A 1AOIB 3AV1D 4E3KA 3IHBA 1YLZA 3MGSB 1P3KA 1KDSA 1ZLAC 4OOYA 5KMWA 5CTNA 3C7UA 3MGSA 1TZYB 3X1TB 1PWCA 3WA9D 3O86A 2H5SA 3C1CA 3MGSC 1FOFA 4S2NC 3UE3A 1P3OA 4OVDA 3ZHHA 4K91A 4OJ6A 3W4PA 1P3OB 1P3GC 1G68A 4FSFA 5FAPA 5E2FA 1EQZD 1BFMA 2F8ND 3Q81A 5F99C 3PBSA 1L0FA 1M18A 2DCFA 4Z66A 1HTZA 3ZG9B 1P3MA 3IXDA 3Q7ZA 3CG5A 4UPKA 4N1HA 3AZJA 1K38A 3HLDA 5CGSA 4B4ZA 3W99D 1L0EA 5CTMA 4KZ4A 4GZBA 3AZLA 4U0XA 3WWXA 3B0DC 5AY8D 2JCHA 4OQHA 3KXBC 4H9QB 3V39A 3LZ1B 2PU4A 5B0YD 5B32G 5B2IA 3VP3A 2EX9A 4KZ9A 3ZG0A 5EE8A 1B67A 5AV9C 4RX2A 1HQ3C 3TU4C 5DF7A 3AZHD 5AV9D 1F66A 1IEMA 2Z2MB 4S2KA 4PMAA 3UO9A 3NQJA 3H0LC 1S32A 5CEBA 2J8PA 4X69A 3AZND 1M19B 5B0ZB 3FV7A 3MXSA 4R4RA 5AV6B 3W98B 1JTGA 1XGIA 2P74A 1N4OA 4E6WA 3QNBA 4DE1A 3CZDA 4XUJD 1U35D 5CPKB 3RELD 3X1VB 5A91A 3LZ0C 4K0WA 1YLWA 1ERMA 4JF5A 5M1AA 3MZFA 3X1VA 4OONA 1KX4D 3W8KA 5F82A 4XZQA 1MXOA 3HUNA 5L2FA 5B31D 1E3UD 4WMCD 4ID4A 3WKJD 1W8YA 5HFOA 3B6GA 5AV5B 3TG9A 1IELA 4LD9C 4J8UB 1TAFB 4M6BA 5GT0B 3MGSD 4BENA 3BRMA 2XF3A 4DF6A 5B40B 1ULYA 1YMSA 3ZVTA 5I94A 5DVAA 3R45B 1KE3A 4XXRA 4X23C 2ZY5A 5AVCB 4OJOA 3V5MA 3C1BD 2P9VB 2CWEA 4YM6C 5BO0B 3AZGB 3FWLA 3REHD 3AZLB 2PYOB 4YS3D 4EUZA 4GHAA 4WNNA 2NZDD 4J8VA 4H9QA 1YT4A 5JRGD 2X02A 5KDMA 3AV2D 4OQIA 3REKC 5DNNB 4QD4A 3VP2A 3WS2A 5FAOA 3FDDA 3LY3A 5B1MA 3AZLC 4ZDXA 4OPRA 5A90A 2BYMB 2RL3A 3LZ1D 3EPKA 4QJGA 3HUMA 5GLAA 1K54C 3V3RA 5FUGA 1L0GA 3MBZA 3A3EA 2NQBC 3ITAA 2Y2MA 3PBOA 1YLJA 5AVBB 5B0YC 3LELC 3AZNB 3W97B 3V9RB 3WTPD 1F66D 1LL5A 1PI5A 2V2FF 3QNCA 2P9VA 5CRFA 4WM9A 2J7VA 3X1SB 2G2WA 5CPKD 3BYDA 3HLFA 3N8RA 3WS5A 3UT9B 3W99B 4E44A 4XUJA 1KVLA 5GSUB 4J8UA 2RCXA 2EXAA 4WEJA 1P34A 5JA4B 4Z5TC 4S2MA 5AY8B 3ITBA 3BLSA 4X68A 3A3DA 2OLUA 2I72A 3N6IA 4LD9B 4PM7A 1MPLA 1WE4A 5B40D 2EXBA 2HIOC 4WZ5C 4Z5TA 3Q7VA 5B0ZD 3VH6T 2AROB 3ZDJA 5CERA 5B33C 4NZ5A 4CPKA 1K56A 3B0DB 5DTKA 3UPNA 2ZM5A 4IBJA 3E2KA 2A49A 2XLNA 5JRGA 3A3FA 5GXQC 2YFWB 3QHYA 4E6XA 3UY6A 4NK3A 3BFCA 4S2JA 1TDLA 1KE4A 2OSUA 2ZD8A 1Q2QA 1H8YA 3EQVA 4BD0A 3LJAA 1SKFA 1BH9B 4BD1A 4X6TA 2YFVA 4A5RA 1SHVA 3O62C 4N9LA 1CEGA 2HUEB 5JRGC 1IYOA 5AV5D 1NXYA 5U47A 2AROA 5C3IB 3W99A 1JFIB 3FZCA 2NQBD 3KUYB 4OPZA 1XPBA 1JWPA 4Z66D 1AOIC 4GN2A 3MGPD 1GCEA 1KX3D 4E3NA 1BLCA 4X23D 3C1BB 4RX3A 3TOIA 3AZLD 4ZJ2A 1P3MB 4B88A 4LENA 1Y54A 2PYOD 3UTAD 1YU1A 2HIOA 5FUGB 5C3IC 1P3KD 3NI9A 1P3LC 5GXQA 1U60A 3W96A 3AV2B 5AQ7A 2IWCA 4YS3C 3REJD 4KG5A 3VSKA 3A3JA 3UTBC 1YMXA 1NZUA 3NIAA 2XH9A 2ZM2A 2ZMAA 3VH5A 2H0TA 1P34D 3X1UD 3LZ0D 3WS0A 3KXBB 1SDEA 1CEFA 1TVFA 4S2IA 2Y2KA 1YU4A 5B0ZA 3UNWA 1HD8A 3OCLA 4D2OA 3B6GD 4GOGA 3MVDA 2Y2JA 4JPMA 1Z2CB 1F66B 4JBFA 1RGZA 2DF4C 5B31C 1P3PB 4KGCB 3WS1A 4Z9QA 3BFFA 4UA9A 3GR2A 4JXGA 1PZOA 1W7FA 3MGRD 1TDGA 4ZBJC 4JKTA 5CPIB 1A7WA 5B2JC 3PBNA 3G34A 3RELC 2CC1A 3MGQD 1Z6FA 2HP6A 1P3IC 4PM8A 3VFHA 5CEDA 3UPPA 3Q7VB 5JYOA 4BQMA 2WGWB 3LELD 3AZFA 2ZC3B 1ES2A 1JWVA 3AZNC 3JYIA 3M6BA 4KQQA 3IHAA 2NZDC 4DE2A 4DRTA 4J8XA 4KZ3A 3KUYC 5B33B 1JVJA 3KUYD 1M1AC 2AROC 5FI7A 1HQ3A 1R4VA 5B1MD 5GHXA 1P3IA 4XZQD 1HZOA 4X23A 1L0DA 3HBRA 4QU3A 4X55A 3S4XA 4MBHA 2JC7A 4C6YA 5GSUA 4DQYB 1P3AB 4WMCA 1LI9A 1FR1A 4J8VB 4YFMA 4DKIA 5AVCC 1ZLAD 1WWSA 3MNNB 2WGVA 1FCNA 3ZVWA 3VOYA 1GHMA 1BZAA 3EPHA 3VH6W 4H9RB 3DWZA 3L27A 2Q9NA 3WAAD 5B33A 5FI6A 4KZ8A 4X53A 1KX4C 2HDSA 4OJ5A 5GLBA 4CAYA 1DY6A 5M19A 3IWOA 1P3LD 4WJ3C 4NZ3A 2F8NH 4OLGA 4UA6A 3X1UB 4HBUA 3IQAA 4E3JA 1S0WA 5GT3A 4N9KA 3AV1B 2LY8A 3BFDA 4AWLB 4Z66B 1EROA 3Q07A 4KZAA 5B32A 4GDNA 3WAAC 1P3BB 1FQGA 3LO7A 4X23B 2HDRA 3IWQA 5AVBA 3REJC 1M18D 3BLMA 2EX8A 5TGFA 4IBCA 1SDNA 3O3VA 5FI2A 1M1AA 3MVDD 1EQZB 4PM5A 3PBRA 5HX9A 5BT1D 3IF5A 1FCMA 4MBFA 5FA7A 3REKA 2JBFA 1AOIA 3REJB 3LCEA 3D4FA 1KX5D 3VH5W 1K56D 5A92A 5JA4A 3HONA 4BL3A 3UDIA 1HTAA 4KHAA 3W97C 4LCLA 1P34B 1HQ3D 2HDQA 5AV8C 4IBIA 3AN2D 4WBGA 3REIC 3AZHB 5F99D 5AV9A 3NBLA 1G6AA 1E4DA 3AZJB 3AFAB 2WAEA 4DRAA 1K57A 5B0ZC 1XA7A 1ID3C 3W97A 3IP4C 5E2EA 1P3ID 3B6FD 4ZBEA 5CHJA 3MGRB 3WX7A 5JYPA 3MNND 3IH8A 3HLWA 1NYMA 5CHLB 4OOLA 1N9BA 4WU8C 2W8SA 2XGNA 1JWZA 4EBLA 4R8PC 5BO0A 3AZGA 1ZLAA 5GLDA 2RVQC 4UUZA 2CV5B 4BLMA 2VQRA 2NZDB 4WNNB 1KX4B 3AZMA 3DTMA 2WKIA 4OUIA 4OPQA 4DE0A 4RVAA 3MGPA 3BFEA 4YM6A 1NYYA 3HLGA 3PAEA 4FH2A 1P3LA 3UE0A 1M6KA 4JXSA 2Z2LB 4WU9D 5GT0D 3SH8A 3OCNA 5EECA 4WYYA 4J8WA 1DJAA 3NQJB 1RCJA 3A1KA 5B1LB 1O07A 3P09A 1ZKJA 2WZZA 2ZY2A 3REKB 5AVCD 1ZLAB 1ZC2A 5JRGB 4QY5A 4K0XA 4QHCA 4R4SA 4J8XB 4B4XA 1BLHA 3X1SD 3NC8A 1ZG6A 2ZJ9A 2ZQCA 2XD5A 4BJPA 1F66C 2A3UA 5EOOA 2ZQ7A 4ZJ1A 3A1IA 5EVID 4LV3A 1BH8A 3CMZA 5AV8B 3UTAA 1KX5A 3OPLA 5AQBA 3REID 3HUOA 4ZUXC 4MBKA 4OP5A 5BNVB 3AFAC 3BEBA 3SOIA 5FDHA 2DNSA 3W97D 1EI5A 3LZ1C 4MLLA 5GHYA 5CXWA 3WTPA 4E3IA 3SH9A 1F1EA 2XDMA 3MGRC 1YU3A 5FQJA 2ZY3A 4JXVA 3MVDB 1H3OB 4QLCA 2QPNA 4IBBA 2WYXA 3GMWA 1P3PC 4KGCC 4WELA 3W96B 4Y7PA 4DE3A 4IBRA 4UAAA 3C1CC 4S2NA 1PI4A 5HARA 1LLBA 2HIOB 1PWGA 2EX6A 2X71A 4IBKA 1N1JA 3AN2B 5GT3B 1U35C 4R8PB 3OC2A 1ALQA 2WGWA 2PBYA 3OPPA 1EQZA 3MGQA 5F1GA 2HPBA 3IF6A 1YUEA 3WKJC 3G2ZA 1TZYD 3X1TD 1K57C 2IWDA 4RA7A 3TU4D 3IXBA 4DDYA 4IVIA 3FKEA 3MGPB 1LHYA 5HL1A 1BT5A 5FSRA 4DRBA 1P3FC 3KUYA 2HDUA 4OJLA 2VGJA 2FFYA 1P3MD 1H3OA 3KFUG 3WTPE 1P3PA 5DNNC 4KGCA 3WTPC 1DJCA 1RP5A 3O62B 4LV2A 4R0QA 3NDEA 4CSRB 2G5IC 5AV5A 5B24C 3VH6A 1S32D 4EV4A 2J8YA 2UWXA 3AZNA 5DNMA 4OQ0A 2XEPA 4LCMA 2XFTA 5BOHA 4QNLA 4G92B 3C4OA 3AYWC 4FCFA 4OOMA 3UDFA 5FQQA 1XX2A 1ONGA 3WA9B 5E5AB 3REKD 5BT1C 3H0RC 5B2JD 4E3LA 4Q8IA 5BNVA 1M18C 2QMIA 1W79A 1U35A 4GD6A 1I2WA 3PBQA 3GTCA 3H0MC 3REHC 1GHPA 3AGFA 4XUJB 4G91B 3RELB 3X1VD 4LD9A 4NZ4A 4QLCD 2BLSA 3B6FA 1BLSA 3X1SC 1MWUA 4ZUXB 3NDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC7 A;  4C6Y A;  4WMC A;  4E3M A;  4QY6 A;  4U0X A;  1LI9 A;  3C4P A;  3WWX A;  2JCH A;  1FR1 A;  4OQH A;  1PWD A;  4YFM A;  4OLD A;  2JE5 A;  4DKI A;  2WAD A;  3V39 A;  3SS5 A;  5M18 A;  2PU4 A;  3VP3 A;  2EX9 A;  2WGV A;  4KZ9 A;  1NY0 A;  4UA7 A;  3ZG0 A;  2Y2O A;  1XXM A;  4JXW A;  1FCN A;  4U0T A;  5EE8 A;  5DTT A;  3ZVW A;  3WS4 A;  3RXX A;  3VOY A;  2ZQ8 A;  1NZO A;  4F94 A;  4RX2 A;  1GHM A;  1PIO A;  1PW1 A;  4KQO A;  1BZA A;  5DF7 A;  2WUQ A;  1IEM A;  2Z2M B;  3DWZ A;  1EWZ A;  1K55 A;  3GSG A;  3MXR A;  1QME A;  1RGY A;  3G32 A;  4KQR A;  4PMA A;  2Q9N A;  4S2K A;  5GL9 A;  3UO9 A;  3ZG8 B;  1YLP A;  2Q9M A;  5FI6 A;  4KZ8 A;  4KEN B;  5AQA A;  5CEB A;  4X53 A;  4X69 A;  1WYC A;  5KSH A;  2HDS A;  5GLB A;  3E2L A;  1DY6 A;  5M19 A;  3FV7 A;  3IWO A;  3MXS A;  4R4R A;  1XGI A;  1JTG A;  2P74 A;  4GDB A;  2EX2 A;  1N4O A;  4E6W A;  4P87 A;  3QNB A;  5TR7 A;  4OLG A;  1KE0 A;  4PM9 A;  1GA9 A;  4UA6 A;  2Y4A A;  4HBU A;  4DE1 A;  3CZD A;  3GV9 A;  1XKZ A;  2WKE A;  3VFF A;  4JF6 A;  1E25 A;  3IQA A;  2J9P A;  4E3J A;  1ESI A;  4GKU A;  5A91 A;  4K0W A;  3S1Y A;  2WK0 A;  1YLW A;  1ERM A;  1XA1 A;  4JF5 A;  1S0W A;  5M1A A;  4N9K A;  3C7V A;  3MZF A;  3BFD A;  4OON A;  3V50 A;  2VGK A;  3W8K A;  1ERO A;  3Q07 A;  1WYB A;  5F82 A;  5FQI A;  3ZG5 A;  1BUE A;  4KZA A;  1OME A;  1MXO A;  4GDN A;  3I7J A;  3HUN A;  4BL2 A;  5L2F A;  3P98 A;  3MZD A;  1FQG A;  3LO7 A;  2V1Z A;  5CGW A;  1TEM A;  2HDR A;  5FQ9 A;  1E3U D;  3IWQ A;  3N8L A;  4KZ7 A;  5F83 A;  4WMC D;  5IHV A;  3BLM A;  4ID4 A;  1CK3 A;  1ESU A;  1W8Y A;  2EX8 A;  5CHM A;  5TGF A;  5HFO A;  1SDN A;  3O3V A;  4EBP A;  5FI2 A;  2ZC6 B;  3ZGA B;  3TG9 A;  4PM5 A;  2HP9 A;  3UPO A;  1IEL A;  3PBR A;  5HX9 A;  4LV0 A;  3GVB A;  5AQ9 A;  4WZ4 A;  4N1X A;  3IF5 A;  2V20 A;  3G35 A;  3UDX A;  2Y2I A;  1FCM A;  1VM1 A;  2XF3 A;  3BRM A;  4BEN A;  4QB8 A;  4DF6 A;  4MBF A;  1YMS A;  2XFS A;  5FA7 A;  3ZVT A;  5I94 A;  4C3Q A;  3MKF A;  1KGE A;  2JBF A;  4P0M A;  5DVA A;  5TFQ A;  1XGJ A;  3DW0 A;  3LCE A;  3D4F A;  1K56 D;  1KE3 A;  3HLE A;  3SS4 A;  4XXR A;  5A92 A;  4BL3 A;  1GHI A;  2XK1 A;  3UDI A;  4XUX A;  1MWT A;  3VP1 A;  3V5M A;  2P9V B;  1IYQ A;  3B3X A;  3IWI A;  3BEC A;  1K25 A;  4LCL A;  2J9O A;  2HDQ A;  3FWL A;  3VP0 A;  3WRT A;  4WBG A;  4EUZ A;  4R3B A;  4R1G A;  5G18 A;  4GB7 A;  4KG6 A;  3NBL A;  4O7D A;  1G6A A;  3IF6 C;  1E4D A;  2WAE A;  1YT4 A;  2X02 A;  2WKH A;  1W5D A;  1FR6 A;  3GRJ A;  4OQI A;  1K57 A;  4WZ5 A;  4YIN A;  1XA7 A;  4QD4 A;  3VP2 A;  3WS2 A;  1H5X A;  5FAO A;  2ZQA A;  3LY3 A;  5E2E A;  4RYE A;  1MY8 A;  5FAQ A;  3G4P A;  3W4O A;  4ZDX A;  2EFX A;  1IKI A;  4OPR A;  4Y0U A;  1MWS A;  5CHJ A;  4ZBE A;  5A90 A;  4OQG A;  1W8Q A;  2RL3 A;  4NET A;  5JYP A;  4OP8 A;  1K54 A;  4QJG A;  3UE1 A;  3IH8 A;  3HUM A;  3FYZ A;  5GLA A;  1K54 C;  3HLW A;  3V3R A;  4EBN A;  1NYM A;  4OOL A;  1L0G A;  1N9B A;  3BM6 A;  1ZG4 A;  2XGN A;  3MBZ A;  1JWZ A;  3A3E A;  4EBL A;  3ITA A;  2Y2M A;  1K6S A;  2R9W A;  1YLJ A;  2ZLY A;  3PBO A;  5GLD A;  4BLM A;  1ES5 A;  5GLC A;  1E3U A;  1S6R A;  4KZ6 A;  3HVF A;  1VQQ A;  5EVL A;  2ZC5 B;  5EVI A;  3DTM A;  2WKI A;  3AGE A;  4EWF A;  4EQI A;  2OV5 A;  5KZH A;  4HBT A;  4OPQ A;  5HAP A;  1LL5 A;  4JLF A;  4DE0 A;  1PI5 A;  2BG1 A;  3HRE A;  4RVA A;  2V2F F;  5KSC A;  3QNC A;  2B5R A;  2P9V A;  5CRF A;  3M2J A;  2Y55 A;  3BFE A;  4WM9 A;  2J7V A;  1KGF A;  1NYY A;  3HLG A;  3CJM A;  3O87 A;  2G2W A;  4LV1 A;  3M6H A;  3PAE A;  3VP4 A;  4FH2 A;  4N92 A;  2Y2G A;  4KG2 A;  2XR0 A;  1I2S A;  1FSY A;  1HVB A;  1M6K A;  3BYD A;  3GQZ A;  2Y59 A;  3HLF A;  2Z2L B;  4IBX A;  4JXS A;  3N8R A;  4OPY A;  3WS5 A;  2R9X A;  5GHZ A;  2C6W B;  3S4X A;  1I5Q A;  4GD8 A;  4S2P A;  3O88 A;  3SH8 A;  1KVL A;  3OCN A;  5EEC A;  2RCX A;  4WYY A;  1DJA A;  3NCK A;  1RCJ A;  2EXA A;  4WEJ A;  1O07 A;  3P09 A;  1ZKJ A;  4CJN A;  4GNU A;  4S2M A;  1AXB A;  2WZZ A;  2X01 A;  3ITB A;  3BLS A;  5EVI C;  3MFD A;  3M2K A;  4X68 A;  3A3D A;  3ZCZ A;  2OLU A;  3W4Q A;  2I72 A;  3G31 A;  3IF6 B;  3N6I A;  1K4F A;  1ZC2 A;  3OZH A;  3IH9 A;  4R23 A;  3RJU A;  4PM7 A;  1M40 A;  4QY5 A;  1MPL A;  2XQZ A;  4K0X A;  2XD1 A;  4QHC A;  1WE4 A;  3IXH A;  1FSW A;  2EXB A;  1LL9 A;  4R4S A;  4B4X A;  3UE0 A;  5HAI A;  3NY4 A;  1BLH A;  2Y91 A;  1PW8 A;  4WZ5 C;  5FAT A;  3NC8 A;  4L0L A;  1KGG A;  4X56 A;  4U3T A;  2ZQD A;  1ZG6 A;  2ZJ9 A;  2ZQC A;  3N4I A;  2XD5 A;  4BJP A;  5DF9 A;  3ZNT A;  2A3U A;  2ZM0 A;  3Q7V A;  1SCW A;  5EOO A;  3ZDJ A;  2ZM8 A;  5CER A;  3ZFZ A;  2ZQ7 A;  1IYS A;  3MKE A;  4ZJ1 A;  5EVI D;  1NJ4 A;  3HLC A;  4KZB A;  4LV3 A;  3CMZ A;  3VOZ A;  4CPK A;  3A3I A;  3IT9 A;  1K56 A;  3OPL A;  3Q82 A;  5AQB A;  5DTK A;  3HUO A;  3OPH A;  4MNR A;  3AGD A;  3E2K A;  3FKV A;  3UPN A;  5FAS A;  2A49 A;  2XLN A;  3ZNY A;  3A3F A;  4MBK A;  4OP5 A;  2H10 A;  3BEB A;  3QHY A;  2Y2P A;  3SOI A;  5FDH A;  1K4E A;  4E6X A;  3UY6 A;  3BFC A;  2DNS A;  4NK3 A;  2G2U A;  1BUL A;  1EI5 A;  1O7E A;  1QMF A;  1TDL A;  4S2J A;  5E2H A;  1KE4 A;  2OSU A;  4MLL A;  2ZD8 A;  5GHY A;  1Q2Q A;  5CXW A;  4E3I A;  1H8Y A;  3EQV A;  1IKG A;  1FCO A;  3VMA A;  3SH9 A;  3UN7 A;  4BD0 A;  1JTD A;  1SKF A;  4HES A;  2XDM A;  4BD1 A;  4X6T A;  4A5R A;  1SHV A;  1ERQ A;  4FH4 A;  4N9L A;  5FQJ A;  1CEG A;  4C75 A;  1CI8 A;  4JXV A;  1BLP A;  2H0Y A;  2Y2N A;  4R3J A;  1IYO A;  1KDW A;  1NXY A;  2QPN A;  5EVI B;  5U47 A;  3LY4 A;  2WYX A;  3GMW A;  5E43 A;  5FQM A;  3FZC A;  1MWR A;  2ZQ9 A;  4WEL A;  1BSG A;  4OPZ A;  1XPB A;  3V3S A;  2QZ6 A;  4Y7P A;  4DE3 A;  4IBR A;  4UAA A;  1JWP A;  4S2N A;  1PI4 A;  4WEK A;  5HAR A;  1YLT A;  1ES4 A;  5D3O A;  3HLB A;  3Q1F A;  2C5W B;  1LLB A;  2DRW A;  1PWG A;  2EX6 A;  4GN2 A;  1CI9 A;  2IWB A;  2X71 A;  3WRZ A;  1GCE A;  4E3N A;  1BLC A;  3EQU A;  4HEF A;  1YQS A;  4M3K A;  4XUZ A;  3LEZ A;  4RX3 A;  3TOI A;  2EFU A;  4ZJ2 A;  4B88 A;  4LEN A;  3PAG A;  1Y54 A;  3OC2 A;  1ALQ A;  2Y2H A;  2WGW A;  1XP4 A;  4Y0T A;  3MZE A;  2PBY A;  3OPP A;  5J8X A;  1IYP A;  4ZJ3 A;  4DXC A;  4H8R A;  3NI9 A;  2Y2Q A;  5F1G A;  1U60 A;  3N8S A;  2HPB A;  4ZTK A;  3SH7 A;  3IF6 A;  3IXG A;  2GDN A;  3G2Z A;  5AQ7 A;  2ZC4 B;  2IWC A;  5EUA A;  1PZP A;  1K57 C;  4KG5 A;  2Y2L A;  4Y0O A;  2IWD A;  4UHU A;  2HP5 A;  4RA7 A;  3VSK A;  3A3J A;  1YM1 A;  1PYY A;  4IVK A;  3IXB A;  4DDY A;  1YMX A;  4IVI A;  1NZU A;  1LHY A;  3NIA A;  4JF4 A;  5HL1 A;  1BT5 A;  2XH9 A;  4KZ5 A;  2ZM2 A;  3G2Y A;  5FSR A;  2H0T A;  2FFF B;  2ZMA A;  3PTE A;  3S22 A;  4S2O A;  1LI0 A;  2HDU A;  3ISG A;  3HL9 A;  2VGJ A;  3WS0 A;  2FFY A;  3SS3 A;  5CGX A;  3DWK A;  1SDE A;  1CEF A;  1MBL A;  1BTL A;  5HAQ A;  1TVF A;  4S2I A;  4E3O A;  5DF8 A;  1K55 C;  3RXW A;  2E8I A;  2WAF A;  2Y2K A;  1DJC A;  4OH0 A;  3UNW A;  1HD8 A;  1RP5 A;  4FD8 A;  3OCL A;  4LV2 A;  4R0Q A;  3PBT A;  1MKI A;  4MEZ A;  1DJB A;  4D2O A;  5HW3 A;  1C3B A;  1GA0 A;  4GOG A;  3NDE A;  1YLY A;  2Y2J A;  4DDS A;  4JPM A;  4JBF A;  4PM6 A;  1K6R A;  1RGZ A;  5FQK A;  4EV4 A;  2J8Y A;  3BFG A;  3N7W A;  3OPR A;  1ONH A;  3WS1 A;  4Z9Q A;  2UWX A;  3BFF A;  4UA9 A;  3GR2 A;  4JXG A;  4PPR A;  1ES3 A;  1L2S A;  1PZO A;  1W7F A;  1TDG A;  4OQ0 A;  2XEP A;  4LCM A;  2XFT A;  4JKT A;  5BOH A;  4E3K A;  5CEC A;  3IHB A;  4DXB A;  3C4O A;  5DTS A;  1YLZ A;  3PBN A;  1KDS A;  1J9M A;  3G34 A;  3TSG A;  4FCF A;  2CC1 A;  4OOY A;  5KMW A;  5E2G A;  4OOM A;  5CTN A;  3C7U A;  5EOE A;  3UDF A;  5F1F A;  1Z6F A;  5FQQ A;  2HP6 A;  1XX2 A;  1PWC A;  4PM8 A;  3O86 A;  1ONG A;  2OLV A;  2H5S A;  3VFH A;  1FOF A;  4S2N C;  3UE3 A;  3ZHH A;  4OVD A;  5CED A;  3UPP A;  2WGI A;  4K91 A;  4OKP A;  3Q7V B;  5JYO A;  5A93 A;  4BQM A;  4IED A;  2WGW B;  3W4P A;  5EPH A;  1NRF A;  3ZG7 B;  1G68 A;  2ZC3 B;  1ES2 A;  4FSF A;  1JWV A;  2WZX A;  3JYI A;  5E2F A;  5FAP A;  3M6B A;  4E3L A;  4ZAM A;  4Q8I A;  4KQQ A;  3IHA A;  3Q81 A;  4DE2 A;  2QMI A;  1W79 A;  2ZC7 A;  3PBS A;  1L0F A;  2PU2 A;  4GD6 A;  1I2W A;  3PBQ A;  3GTC A;  4DRT A;  3G30 A;  4KZ3 A;  3C5A A;  1GHP A;  3AGF A;  5CHU A;  1JVJ A;  1Q2P A;  2DCF A;  4P6B A;  5FI7 A;  1HTZ A;  3ZG9 B;  3IXD A;  5GHX A;  4S2L A;  3VSL A;  3Q7Z A;  1HZO A;  3CG5 A;  2BLS A;  4N1H A;  5CGS A;  1K38 A;  1KVM A;  3HLD A;  1BLS A;  4B4Z A;  3FKW A;  4P85 A;  1L0D A;  1MWU A;  3HBR A;  1L0E A;  4QU3 A;  4X55 A;  5CTM A;  4KZ4 A;  4GZB A;  1H8Z A;  4MBH A;  3NDG A; 
#chains in the Genus database with same CATH topology
 1OTB A;  4E3M A;  4QY6 A;  1S1Y A;  5B31 B;  2L5A A;  2V9A A;  4H9S A;  3KSI A;  1EW0 A;  4OLD A;  2JE5 A;  3UT9 C;  4KUD A;  5B0Y B;  2WAD A;  3SS5 A;  5M18 A;  5CPJ D;  3AL0 C;  3X1U C;  2AVX A;  3KWQ B;  2HF6 A;  5BNX A;  1NY0 A;  2Y2O A;  2RVQ D;  5AV6 C;  4JXW A;  4I38 A;  3MNN A;  1T19 A;  3WS4 A;  3RXX A;  3REH A;  5AV6 A;  1NZO A;  1PIO A;  4WU8 D;  1PW1 A;  2WUQ A;  3GSG A;  3TU4 A;  4L9G A;  1B6W A;  1TS0 A;  3G32 A;  4KQR A;  3S7P A;  3B0B A;  2WKP A;  5GL9 A;  5HPI A;  3QP4 A;  1YLP A;  4KEN B;  3TU4 B;  2FJ7 B;  1M19 D;  2P08 A;  2H28 A;  1P3O D;  3F1O A;  3EWK A;  5KSH A;  2MJ6 A;  3E2L A;  3QP6 A;  1DP8 A;  5L10 A;  3H9W A;  4GDB A;  1N1J B;  3AN2 A;  2XRN A;  4P87 A;  5TR7 A;  4ETX A;  3KXB A;  2Y4A A;  4R38 A;  3GV9 A;  4Z2L A;  1XKZ A;  3VFF A;  3O5Y A;  1E25 A;  3KSH A;  4J8V D;  2J9P A;  3IX3 A;  1ESI A;  3WA9 A;  4GKU A;  2OAQ 1;  5CPI D;  3C7V A;  4XZQ C;  1WYB A;  5FQI A;  3LEL A;  3AZF D;  1BUE A;  1OME A;  3X1V C;  3U2A A;  3I7J A;  3C1C B;  5EV0 A;  1TEM A;  1MKM A;  5FQ9 A;  1S32 C;  3W2Z A;  1G28 A;  4KZ7 A;  4J8W D;  5IHV A;  3VE3 A;  3AZF C;  1CK3 A;  1ESU A;  3AZI A;  5CHM A;  4J8X C;  3F1N A;  2G5H C;  3WKJ B;  3ZGA B;  3LR3 A;  4HI4 A;  5AVC A;  4XZQ B;  2HP9 A;  1P3L B;  4LV0 A;  4ESP A;  3GVB A;  5AQ9 A;  4WZ4 A;  4N1X A;  2V20 A;  1VM1 A;  4AFI A;  2QHK A;  5CP6 D;  4C3Q A;  3MKF A;  4P0M A;  4JJN A;  5TFQ A;  1XGJ A;  3T4L A;  1P3F D;  3AZM D;  1S66 L;  3EPL A;  4GS9 B;  1GHI A;  5HD3 A;  4XUX A;  4J8W C;  4MB5 A;  1TD5 A;  4E45 A;  3VP1 A;  2R78 A;  3WTP B;  3A0V A;  3B3X A;  2Z6D A;  4YM6 D;  3UB9 A;  5BPV A;  3FPW A;  1P3B D;  3REH B;  2J9O A;  3VP0 A;  5B24 D;  4R3B A;  4R1G A;  5DNM B;  4HMD A;  1KS0 A;  5G18 A;  2YKF A;  4FOF A;  1XJ6 A;  1PRQ A;  2PR6 A;  5EVE A;  1AIW A;  2ZOI A;  3NQU A;  5GXQ B;  2GX5 A;  2WKH A;  1FR6 A;  3KSY A;  5DNN D;  1P3A A;  4WZ5 A;  4YIN A;  4NY2 A;  1H5X A;  1VET A;  2YKH A;  4ZRR A;  4NZ1 A;  4RYE A;  5FAQ A;  2ZL1 A;  2E8J A;  2F8N G;  1OPX A;  3MVD C;  4BBT A;  2KX6 A;  1KX5 B;  4DJ3 A;  1IKI A;  4Y0U A;  1MWS A;  3ZQ5 A;  2D01 A;  3MJQ A;  4OP8 A;  3N3F A;  3AV1 C;  3T12 B;  3FYZ A;  4EBN A;  4WU8 A;  3S7O A;  3BM6 A;  3R7W A;  4R8P A;  2W1R A;  1Y28 A;  1ZG4 A;  3L2A A;  4KUD D;  1K6S A;  2R9W A;  5CPJ A;  1E6Z A;  4Z5T D;  1ES5 A;  5F99 B;  3NDG A;  1E3U A;  5AVB D;  1G6O A;  1M18 B;  5E5A D;  4KZ6 A;  4KHA B;  3B0C W;  1VQQ A;  2YFV B;  5EVI A;  4G3W A;  4H9P A;  2VV8 A;  4EWF A;  4EQI A;  2OV5 A;  4EEU A;  3NQU B;  4JLF A;  2BG1 A;  3A0S A;  4MMN A;  3C1B A;  4K08 A;  4GW9 A;  3M2J A;  1NRJ A;  2Y55 A;  1KGF A;  1KX3 C;  4IBE A;  4LV1 A;  3B42 A;  4KUK A;  4N92 A;  2Y2G A;  4QLC C;  2XR0 A;  1I2S A;  1HVB A;  3GQZ A;  3MQ0 A;  2Y59 A;  3NHQ A;  1D1J A;  2R9X A;  3AZH C;  5GHZ A;  2C6W B;  4ZUX D;  2YFW A;  4S2P A;  4GD8 A;  3O88 A;  1KOU A;  4BBV A;  4EO5 B;  2V5O A;  3CAX A;  3NCK A;  4GNU A;  1AXB A;  4IUH A;  5HDS A;  4NE5 A;  5B32 B;  5CPJ B;  3A6N C;  2NZD A;  4Z2K A;  3G31 A;  3IF6 B;  5HSQ A;  3UB8 A;  1TAF A;  3IH9 A;  5AY8 C;  3RJU A;  4JGP A;  2XQZ A;  2XD1 A;  1OTE A;  1YKD A;  3IXH A;  1FSW A;  1LL9 A;  3H82 A;  1ID3 B;  1OT6 A;  3NY4 A;  4GCZ A;  2Y91 A;  5FAT A;  1PW8 A;  1W63 M;  1KGG A;  4L0L A;  4U3T A;  1ID3 A;  1CJF A;  3N4I A;  5CX7 A;  3LJA C;  4MN5 A;  3V9R A;  5B1M C;  3P7N A;  5B31 G;  3AFA D;  2EA9 A;  5DF9 A;  1OJ5 A;  3T4J A;  3ZNT A;  4ARZ A;  4WU9 B;  3CPT B;  3ZYT A;  1SCW A;  2ZM8 A;  5CP6 A;  3ZFZ A;  1IYS A;  1NJ4 A;  4KZB A;  4IBD A;  1P3I B;  3A3I A;  1P3F A;  3RH8 B;  2HUE C;  3OPH A;  4MNR A;  3FKV A;  3AZE D;  5KDM B;  2B95 A;  4WU9 C;  2Y2P A;  2RIQ A;  4NFT A;  3KWQ C;  3KS8 A;  3WA9 C;  3LI9 A;  1O7E A;  5E2H A;  1QMF A;  3AZF B;  4CAY B;  1GPF A;  1IKG A;  1FCO A;  3VMA A;  1JTD A;  4O8G A;  3KYE A;  3T50 A;  1ERQ A;  3F6T A;  4G3V A;  4C75 A;  1CI8 A;  4LD9 D;  2H0Y A;  2Y2N A;  4R3J A;  5HPF A;  3AZE C;  5EVI B;  3LY4 A;  5FL3 A;  1CQA A;  4MN6 A;  2NQB B;  5FQM A;  4KUD B;  1BSG A;  3S7N A;  4HNB A;  2QZ6 A;  5B1L D;  3CHW P;  2BYK A;  3AZK A;  1P3B C;  1YLT A;  3AZG C;  5D3O A;  3AZM B;  3HLB A;  3Q1F A;  2DRW A;  2VA0 A;  2PYO C;  1CI9 A;  2IWB A;  4Y15 A;  3HJK A;  5BS7 C;  1YQS A;  4M3K A;  4XUZ A;  3LEZ A;  3AZM C;  1P34 C;  5TBM B;  5B24 B;  2EFU A;  5DNM D;  3PAG A;  3MGP C;  1OJG A;  1XP4 A;  4LRY C;  1YU2 A;  5J8X A;  1IYP A;  4ZJ3 A;  4DXC A;  2Y2Q A;  3N8S A;  1H0G A;  3IXG A;  3BW6 A;  2GDN A;  4J8X D;  4KUO A;  1PZP A;  5AV8 D;  4HGA B;  2EWW A;  5HWW A;  4UHU A;  4JGR A;  3EG5 B;  1YM1 A;  1PYY A;  3IS2 B;  2BYM A;  2VLG A;  2BYK B;  4TX8 A;  3DBA A;  3G2Y A;  2FFF B;  3UTB B;  1KX5 C;  1LI0 A;  2V0U A;  3HL9 A;  3SS3 A;  4EO5 C;  1ID3 D;  2F2A C;  4WUJ A;  3E4Q A;  1MBL A;  3KXB D;  5HAQ A;  5DF8 A;  1K55 C;  3RXW A;  2E8I A;  2WAF A;  2NQB A;  4L9F A;  3JPU A;  4ZBJ B;  2FN2 A;  2W3F A;  3CLO A;  3C30 A;  3PBT A;  4WN5 A;  1DJB A;  5HW3 A;  1Z09 A;  5E5A C;  1C3B A;  1GA0 A;  1KX3 B;  5AVB C;  1H3Q A;  3O62 A;  3WD0 A;  2A2L A;  3B6G B;  3LYX A;  3AN2 C;  4DDS A;  4PM6 A;  1K6R A;  5FQK A;  3TW8 A;  3BFG A;  3AZE A;  3N7W A;  3OPR A;  5DKL A;  5EFW A;  5GT0 C;  4PPR A;  1ES3 A;  1L2S A;  1TS8 A;  5AV6 D;  3W98 D;  5CEC A;  1W63 Q;  2HV1 A;  4DXB A;  2IA2 A;  1EQZ C;  5DTS A;  2HIO D;  2XA7 M;  1J9M A;  3TSG A;  5CPJ C;  3LIE A;  5B32 C;  5E2G A;  5F1F A;  5EOE A;  4QPR A;  3MGQ B;  5GT3 C;  3W96 D;  1TS6 A;  2OLV A;  3UME A;  3AZK C;  1P3B A;  1M19 A;  4GH9 A;  5GT3 D;  2WGI A;  4OKP A;  3CPT A;  3OBF A;  4IBF A;  3REJ A;  5A93 A;  4IED A;  2PYO A;  5EPH A;  5B32 D;  1NRF A;  2FJ7 C;  3ZG7 B;  3LEL B;  2WZX A;  4ZAM A;  2M7U A;  2ZC7 A;  2PU2 A;  4UQI S;  1ACF A;  1S32 B;  1GSW A;  3G30 A;  4Q0H A;  4GHL A;  3C5A A;  1P9R A;  5CHU A;  1Q2P A;  3X1U A;  4P6B A;  4HY8 A;  2PHY A;  4S2L A;  3VSL A;  4H9R A;  3MNN C;  1KVM A;  1JFI A;  3FKW A;  4P85 A;  5HL6 A;  1CXW A;  3TJZ C;  3B6F C;  5BNX B;  4BMW A;  1H8Z A;  2FJ7 A;  5KIZ A;  5B40 C;  2J3T D;  3MSH A;  1P3A D;  3C4P A;  5GSU C;  3AZK D;  3AZI D;  5CP6 C;  3KS4 A;  1PWD A;  3EPJ A;  4LG2 A;  4CLC C;  4NYU A;  3AYW D;  2I9V A;  3MQO A;  1D06 A;  4UA7 A;  4EER A;  1XXM A;  4U0T A;  5DTT A;  1M1A B;  5AVE A;  4JJN D;  4WV4 B;  4H9N A;  3BQ8 A;  4H6J B;  2ZQ8 A;  1PDC A;  3G6O A;  4YS3 B;  4F94 A;  3VH5 T;  4KQO A;  2F8N K;  1EWZ A;  1K55 A;  3MXR A;  4EQ1 A;  1QME A;  3WAA B;  1RGY A;  4WZS B;  3OOV A;  3ZG8 B;  1E15 A;  2Q9M A;  1CF0 A;  5AQA A;  2QJ5 A;  1WYC A;  5E5A A;  1VHM A;  3MGR A;  1W1Y A;  5B24 A;  2EX2 A;  5AV8 A;  1KE0 A;  1BH9 A;  1GA9 A;  4PM9 A;  4ZUX A;  3L26 A;  2WKE A;  4JF6 A;  5DNM C;  3W99 C;  3S1Y A;  2WK0 A;  3IX4 A;  1XA1 A;  1BH8 B;  3V50 A;  2OWH A;  1P3O C;  2VGK A;  1GSX A;  3ZG5 A;  1W2E A;  1NLZ A;  4BL2 A;  3P98 A;  3MZD A;  3AZG D;  2V1Z A;  5CGW A;  3UE6 A;  3N8L A;  5B1L C;  5F83 A;  5AY8 A;  1E6P A;  1N9N A;  1PZR A;  4CSR A;  5CPI C;  1P3G D;  2ZC6 B;  4LFU A;  4EBP A;  5B2J B;  4AWL C;  3UPO A;  4NE3 A;  4Z2M G;  3RTY A;  4IBG A;  4CLC D;  3UT9 D;  3G35 A;  3UDX A;  2Y2I A;  5IS1 A;  4QB8 A;  2XFS A;  3MGQ C;  1KGE A;  5GSU D;  4JGQ A;  2CV5 D;  3D9Y A;  3DW0 A;  2KLI A;  1LSW A;  3HLE A;  3AZH A;  3SS4 A;  4QLC B;  2JKG A;  3AZJ C;  4EEP A;  1OGB A;  4H9O B;  1M19 C;  4F3L A;  2XK1 A;  3WAA A;  1MWT A;  2Y8H A;  3WD2 A;  3L29 A;  1WA9 A;  3KWQ D;  3UTB D;  1IYQ A;  3IWI A;  1S4R A;  3BEC A;  1K25 A;  4H9S C;  3C1C D;  5MC7 A;  4H9N B;  1YU0 A;  3WRT A;  1HQ3 B;  3R45 A;  1L3L A;  3MQQ A;  3B6G C;  4GB7 A;  4WU9 A;  4KG6 A;  3AZJ D;  4O7D A;  3IF6 C;  2PDR A;  1KU5 A;  4Z2M H;  2CV5 C;  2FJ7 D;  3WD3 A;  4XUJ C;  1W5D A;  3CWF A;  3GRJ A;  3KSF A;  3NUL A;  4WU8 B;  1KX4 A;  3X1S A;  2ZQA A;  5CP6 B;  1MY8 A;  5J3W A;  2O9B A;  3G4P A;  3W4O A;  2EFX A;  3LID A;  1P3F B;  5B2I D;  2JKT I;  4OQG A;  1WWI A;  4OJP A;  1W8Q A;  4NET A;  4G3K A;  4PKY G;  1K54 A;  3UE1 A;  3CUE A;  3F1P A;  1UR8 A;  5CPI A;  3MS6 A;  4HJ6 A;  1M1A D;  4Z2I A;  3A6N D;  3REI A;  3DTE A;  2ZLY A;  3AYW A;  3AFA A;  4J8U C;  2DMW A;  5GLC A;  4NXF A;  4GHI B;  1S6R A;  3HVF A;  3SW1 A;  5B1L A;  5EVL A;  3LR0 A;  2ZC5 B;  1P9W A;  3AGE A;  2O9C A;  1X0O A;  3UTA C;  4HBT A;  5J4E A;  5KZH A;  5HAP A;  3HRE A;  3LJA D;  3T1R A;  3HSH A;  5KSC A;  2B5R A;  3VV4 A;  4J8W B;  1ODV A;  1VET B;  3CJM A;  3O87 A;  3E98 A;  3M6H A;  3A0R A;  3VP4 A;  4KG2 A;  3LIB A;  1AOI D;  1FSY A;  4IBX A;  4Z66 C;  4OPY A;  3B47 A;  2ARO D;  3D3O A;  4EUV A;  5G49 B;  1T1C A;  1I5Q A;  4JJN C;  4YM6 B;  3SZT A;  4EW7 A;  4CJN A;  3AZK B;  3AZI B;  2X01 A;  5EM1 A;  3B6F B;  5EVI C;  3MFD A;  3M2K A;  3UTA B;  1SKO B;  3AYW B;  3ZCZ A;  2K7S A;  5F99 A;  3W4Q A;  1KX3 A;  3T1Q B;  1K4F A;  3OZH A;  3AZI C;  4R23 A;  1M40 A;  2F8N B;  4R70 A;  1ZTU A;  3LIC A;  4M4X A;  4UUZ B;  2CV5 A;  5DNN A;  4JJN B;  1P3M C;  1UGU A;  1Q9C A;  2IO5 B;  3WKJ A;  5HAI A;  4DN0 A;  4X56 A;  3DAV A;  1F2K A;  2ZQD A;  4MB4 A;  2PYR A;  1S67 L;  5GXQ D;  2ZM0 A;  3UTB A;  5BS7 A;  4DJ2 A;  2ZY4 A;  4G91 C;  2JKF A;  1E6N A;  3MKE A;  1TZY A;  3X1T A;  3HLC A;  3W98 A;  3AV1 A;  2EWV A;  3VOZ A;  1TZY C;  3X1T C;  4HGA C;  5G49 A;  3IT9 A;  3REI B;  3Q82 A;  4R8P D;  2NUP C;  1XFQ A;  3AGD A;  5DKK A;  4EET B;  5FAS A;  3ZNY A;  4I39 A;  4Q0J A;  3KWQ A;  3AV2 A;  1P3K C;  2H10 A;  2ZOH A;  1GXD A;  3W96 C;  2UV0 E;  1K4E A;  5EUA A;  3H7W B;  3LZ0 A;  2G2U A;  1BUL A;  2IOU A;  4YS3 A;  2DQN C;  2F8N A;  5K5B A;  3UN7 A;  4Z5T B;  3W98 C;  4HES A;  2KDK A;  4FH4 A;  1NWZ A;  3C2W A;  3OLO A;  1P3K B;  3R4K A;  1P3G B;  1BLP A;  3A6N A;  1KDW A;  3LIA A;  3BWL A;  2A24 B;  3B33 A;  5GT0 A;  3A6N B;  5E43 A;  1P3P D;  4KGC D;  2Q0O A;  1MWR A;  2ZQ9 A;  1U35 B;  3T4T A;  3LZ1 A;  3V3S A;  1T18 A;  5IT5 A;  4WEK A;  3L25 A;  5FDS A;  5L07 A;  1ES4 A;  4H9P B;  5TJJ A;  3O62 D;  3R7W B;  2C5W B;  5CPK C;  5B0Y A;  3WRZ A;  5F69 A;  2W3E A;  3EQU A;  4HEF A;  3P5J B;  4IJE A;  3LZ0 B;  3K3D A;  3KYQ A;  1T3U A;  4IJF A;  2Y2H A;  4Y0T A;  3MZE A;  5B1M B;  5B2J A;  2JSS A;  4H8R A;  1STZ A;  2O0Y A;  2GZA A;  4ZTK A;  3SH7 A;  4J8U D;  2V8F A;  2ZC4 B;  5CPK A;  5AV9 B;  2PD8 A;  1OTA A;  3V67 A;  2Y2L A;  5AV5 C;  4Y0O A;  4HP4 A;  5B2I B;  2HP5 A;  4H9O A;  4NE6 A;  2VKS A;  4IVK A;  5F68 A;  4I3I A;  4JF4 A;  5B2I C;  4KZ5 A;  3PTE A;  3S22 A;  4B93 A;  3H82 B;  4S2O A;  3EEA A;  3ISG A;  2IO5 C;  5CGX A;  4J8V C;  3DWK A;  1BTL A;  4E3O A;  3AZE B;  3AV2 C;  4WF0 A;  4OH0 A;  1P3A C;  3QP1 A;  2K2N A;  4FD8 A;  3REL A;  3PYP A;  1IOU A;  3B0C T;  5B40 A;  2VX8 A;  1MKI A;  4MEZ A;  3KX0 X;  1P3G A;  3LJA B;  1YLY A;  3UT9 A;  4KUD C;  4NYY A;  5B33 D;  1ONH A;  5B31 A;  4G92 C;  3C1B C;  4NXG A;  3L28 A;  1AOI B;  3AV1 D;  4E3K A;  3IHB A;  1YLZ A;  3MGS B;  1P3K A;  1KDS A;  1ZLA C;  4OOY A;  5KMW A;  5CTN A;  3C7U A;  3MGS A;  1TZY B;  3X1T B;  1PWC A;  3WA9 D;  3O86 A;  2H5S A;  3C1C A;  3MGS C;  1FOF A;  4S2N C;  3UE3 A;  1P3O A;  4OVD A;  3ZHH A;  4K91 A;  2QWS A;  4OJ6 A;  5L8M A;  2QJ7 A;  3W4P A;  5F5Y A;  1P3O B;  1P3G C;  1G68 A;  4FSF A;  5FAP A;  5E2F A;  4HH2 A;  1EQZ D;  1BFM A;  2F8N D;  3Q81 A;  3BQA A;  1TF1 A;  5F99 C;  3S7Q A;  3PBS A;  1L0F A;  1M18 A;  4I5S A;  4EXO A;  4HME A;  2DCF A;  4Z66 A;  1HTZ A;  3ZG9 B;  1P3M A;  1VEU A;  2PAV P;  3IXD A;  2G7U A;  3Q7Z A;  3CG5 A;  2VZW A;  4UPK A;  4N1H A;  3AZJ A;  1K38 A;  3HLD A;  5CGS A;  4B4Z A;  3EGX C;  5DJU A;  3U4L P;  3W99 D;  1L0E A;  5CTM A;  4KZ4 A;  4GZB A;  3AZL A;  4U0X A;  3WWX A;  1O6I A;  3B0D C;  5AY8 D;  2JCH A;  1W1P A;  3LIF A;  4OQH A;  3KXB C;  2ZL1 B;  4H9Q B;  5HWV A;  3V39 A;  3LZ1 B;  2PU4 A;  5B0Y D;  5B32 G;  3EOI A;  2B02 A;  4CLC A;  5B2I A;  3VP3 A;  2EX9 A;  4KZ9 A;  3ZG0 A;  5EE8 A;  2FZ0 A;  1B67 A;  5AV9 C;  4RX2 A;  1HQ3 C;  3TU4 C;  5DF7 A;  3AZH D;  5AV9 D;  1F66 A;  1IEM A;  2Z2M B;  3M7P A;  3LFV A;  4PMA A;  4S2K A;  3UO9 A;  3NQJ A;  3H0L C;  1S32 A;  5A8B A;  3PR6 A;  5CEB A;  2J8P A;  4X69 A;  1P0Z A;  3AZN D;  1M19 B;  3T4K A;  5B0Z B;  3FV7 A;  3MXS A;  4R4R A;  1A0K A;  5AV6 B;  3W98 B;  1JTG A;  1XGI A;  2P74 A;  1N4O A;  4E6W A;  3QNB A;  4DE1 A;  3CZD A;  4XUJ D;  3EEH A;  3TRC A;  3VOL A;  2PR5 A;  1U35 D;  5CPK B;  3REL D;  3X1V B;  5A91 A;  3LZ0 C;  4K0W A;  4O0P A;  1YLW A;  1ERM A;  4JF5 A;  5M1A A;  3MZF A;  3X1V A;  4OON A;  1KX4 D;  3W8K A;  2PRF A;  5F82 A;  1H0M A;  4XZQ A;  1MXO A;  1S4S A;  4JGO A;  3HUN A;  5L2F A;  1AWI A;  3VE4 A;  4I3J A;  5B31 D;  1E3U D;  4WMC D;  4ID4 A;  5LBR A;  3WKJ D;  1W8Y A;  5HFO A;  3B6G A;  5AV5 B;  3TG9 A;  4GS9 A;  1IEL A;  4LD9 C;  4J8U B;  1TAF B;  4M6B A;  5GT0 B;  3MGS D;  4BEN A;  3BRM A;  2XF3 A;  4DF6 A;  5B40 B;  1ULY A;  1YMS A;  2M7V A;  3ZVT A;  5J7E A;  5I94 A;  5DVA A;  2JKT M;  3R45 B;  1KE3 A;  4XXR A;  4X23 C;  2ZY5 A;  5AVC B;  4OJO A;  3DTI A;  3NEC A;  1OTI A;  1SKO A;  3V5M A;  3C1B D;  2P9V B;  2CWE A;  1OT9 A;  4YM6 C;  5BO0 B;  3AZG B;  2XRO A;  3BJN A;  1TS7 A;  3FWL A;  3REH D;  3AZL B;  2W1T B;  2PYO B;  4YS3 D;  4EUZ A;  4GHA A;  4WNN A;  2NZD D;  2L0W A;  1QO6 A;  4J8V A;  1V9Z A;  4H9Q A;  1YT4 A;  5JRG D;  5AJG A;  2X02 A;  5KDM A;  4Z1W A;  3AV2 D;  4XT2 A;  4OQI A;  1HLU P;  3REK C;  5DNN B;  4QD4 A;  3VP2 A;  3WS2 A;  5FAO A;  3FDD A;  2GNX A;  3LY3 A;  5B1M A;  2VEA A;  3AZL C;  4ZDX A;  4BWI A;  4OPR A;  4ME4 A;  5A90 A;  1D7E A;  2BYM B;  3ICY A;  2RL3 A;  3LZ1 D;  1ED7 A;  3EPK A;  4QJG A;  1GOI A;  3HUM A;  5GLA A;  1K54 C;  3V3R A;  4R3A A;  4LGW A;  5FUG A;  2D02 A;  1L0G A;  2P7J A;  3MBZ A;  3A3E A;  2NQB C;  3ITA A;  2Y2M A;  3PBO A;  1YLJ A;  4LLO B;  1DP6 A;  5AVB B;  5HD5 A;  5B0Y C;  1UWN X;  4EU0 A;  3DTK A;  3LEL C;  3HJI A;  3AZN B;  3W97 B;  4UEY A;  4FUW A;  3MR0 A;  3V9R B;  2ZMV A;  3WTP D;  1F66 D;  1LL5 A;  1PI5 A;  5IU1 A;  1YSQ A;  2V2F F;  3CUE C;  1T1A A;  2P9V A;  3QNC A;  4LRX C;  5CRF A;  4WM9 A;  2J7V A;  3X1S B;  3FPV A;  2G2W A;  5CPK D;  3P01 A;  2M1C A;  4UQI M;  3BY9 A;  3BYD A;  4P6Z S;  3HLF A;  3N8R A;  3WS5 A;  3UT9 B;  2ZBB A;  2L4R A;  3W99 B;  4HOI A;  4E44 A;  4XUJ A;  1KVL A;  2L1M A;  4YWZ A;  2RCX A;  5GSU B;  4J8U A;  1UR9 A;  2EXA A;  4WEJ A;  1P34 A;  5JA4 B;  4Z5T C;  4S2M A;  5AY8 B;  3CI6 A;  3ITB A;  3BLS A;  4X68 A;  3A3D A;  1W1V A;  3FG8 A;  2OLU A;  2I72 A;  1FIK A;  3N6I A;  4LD9 B;  1PFL A;  4PM7 A;  1MPL A;  1WE4 A;  5B40 D;  2EXB A;  2HIO C;  4WZ5 C;  3MMH A;  3K2N A;  4I3A A;  4YOF A;  4Z5T A;  3Q7V A;  5B0Z D;  3VH6 T;  2PT7 A;  2ARO B;  3ZDJ A;  5CER A;  5B33 C;  4NKP A;  4NZ5 A;  3L7H A;  4IUK A;  4CPK A;  1K56 A;  3B0D B;  5DTK A;  3UPN A;  2ZM5 A;  1V9Y A;  4IBJ A;  3E2K A;  2A49 A;  2XLN A;  5JRG A;  3A3F A;  5GXQ C;  2YFW B;  3QHY A;  4E6X A;  3UY6 A;  3BFC A;  4NK3 A;  4S2J A;  1TDL A;  1KE4 A;  1F98 A;  2OSU A;  4HMC A;  3C38 A;  2ZD8 A;  4L9E A;  1Q2Q A;  1DRM A;  1H8Y A;  3EQV A;  4BD0 A;  3LJA A;  1SKF A;  1BH9 B;  4II7 A;  4BD1 A;  4CLC E;  4X6T A;  2YFV A;  4A5R A;  1SHV A;  1P97 A;  3O62 C;  2O9A A;  4N9L A;  2PYP A;  1CEG A;  3GDI A;  4HQA A;  2HUE B;  5JRG C;  1IYO A;  5AV5 D;  1NXY A;  5U47 A;  2ARO A;  5C3I B;  2Z6C A;  3W99 A;  1JFI B;  3FZC A;  5DJT A;  2NQB D;  3KUY B;  4OPZ A;  1XPB A;  1JWP A;  2J3W A;  4Z66 D;  1AOI C;  4GN2 A;  3MXQ A;  4D60 A;  3MGP D;  5HZH A;  3F1N B;  1GCE A;  1KX3 D;  4E3N A;  1L6J A;  1BLC A;  1LL8 A;  5AVF A;  4X23 D;  4Y13 A;  3C1B B;  1BYW A;  4RX3 A;  3TOI A;  3JVV A;  3AZL D;  1XFN A;  4ZJ2 A;  1P3M B;  1VEU B;  4B88 A;  4LEN A;  1Y54 A;  5FEG A;  2PYO D;  3UTA D;  2HGV A;  1PNE A;  1YU1 A;  2HIO A;  5FUG B;  5C3I C;  1P3K D;  1VB6 A;  1ZHH B;  3NI9 A;  1P3L C;  5GXQ A;  1U60 A;  3W96 A;  3AV2 B;  1G5U A;  5AQ7 A;  4H6J A;  2IWC A;  4YS3 C;  3REJ D;  4KG5 A;  4ARZ B;  4MN7 A;  3VSK A;  3A3J A;  3UTB C;  4BBU A;  1YMX A;  2V0W A;  1NZU A;  3NIA A;  3E0Y A;  1H8M A;  2VGL M;  2XH9 A;  3T4O A;  2ZM2 A;  3VH5 A;  2H0T A;  2ZMA A;  1P34 D;  3LEQ A;  5F6A A;  3X1U D;  3LZ0 D;  3WS0 A;  1E8B A;  3KXB B;  1SDE A;  1CEF A;  2A24 A;  2INW A;  1TVF A;  4S2I A;  4Y2F A;  2Y2K A;  1YU4 A;  4HJ4 A;  4KQD A;  5B0Z A;  3UNW A;  1HD8 A;  3OCL A;  2W0N A;  3TE8 A;  4D2O A;  3B6G D;  4HJ3 A;  4GOG A;  3MVD A;  2Y2J A;  4JPM A;  1Z2C B;  1F66 B;  4JBF A;  1RGZ A;  2DF4 C;  2VV7 A;  5B31 C;  1P3P B;  4KGC B;  3NOT C;  3WS1 A;  4Z9Q A;  3BFF A;  4UA9 A;  3GR2 A;  4JXG A;  4X1M A;  1Y4O A;  1PZO A;  1W7F A;  3MGR D;  1TDG A;  4ZBJ C;  4JKT A;  5CPI B;  1A7W A;  3PHY A;  2HZ5 A;  5B2J C;  4NXE A;  3E4O A;  3PBN A;  3G34 A;  3REL C;  2CC1 A;  4HIA A;  3MGQ D;  1Z6F A;  2HP6 A;  1P3I C;  4PM8 A;  3VFH A;  4E04 A;  3T1X A;  5I5L A;  5CED A;  3UPP A;  3Q7V B;  5JYO A;  4BQM A;  2WGW B;  3LEL D;  3AZF A;  3T4Q A;  2ZC3 B;  1ES2 A;  1JWV A;  3AZN C;  3JYI A;  4PHT A;  3M6B A;  4KQQ A;  3IHA A;  2NZD C;  4DE2 A;  4DRT A;  3WD1 A;  1SZV A;  4J8X A;  4KZ3 A;  3KUY C;  5B33 B;  1JVJ A;  3KUY D;  1M1A C;  2ARO C;  5FI7 A;  1HQ3 A;  1R4V A;  4Y17 A;  3LI8 A;  5B1M D;  5GHX A;  1P3I A;  1MZU A;  4XZQ D;  1HZO A;  4EES A;  4X23 A;  2JKR I;  1L0D A;  3HBR A;  4QU3 A;  4X55 A;  3S4X A;  4MBH A;  2JC7 A;  2OOL A;  5GSU A;  4DQY B;  1P3A B;  4C6Y A;  4WMC A;  1LI9 A;  1FR1 A;  4J8V B;  2CMN A;  4P6Z M;  4YFM A;  4DKI A;  4Z2J A;  5AVC C;  4MB3 A;  1ZLA D;  1WWS A;  3MNN B;  4MCW A;  2WGV A;  2J80 A;  4Q0I A;  5EM0 A;  2Y79 A;  1FCN A;  3ZVW A;  4CLC B;  3VOY A;  2O99 A;  1GHM A;  1BZA A;  3EPH A;  3VH6 W;  4H9R B;  3DWZ A;  3L27 A;  2Q9N A;  3WAA D;  5B33 A;  5FI6 A;  4KZ8 A;  3UB6 A;  4X53 A;  1KX4 C;  2HDS A;  4OJ5 A;  5GLB A;  2W3H A;  4CAY A;  1DY6 A;  2JHE A;  3IWO A;  5M19 A;  1P3L D;  4X1L A;  4WJ3 C;  4NZ3 A;  2F8N H;  2GJ3 A;  4OLG A;  4UA6 A;  3X1U B;  3L9K A;  1W1T A;  4HBU A;  3MQL A;  1MC0 A;  3IQA A;  4E3J A;  4GJ4 A;  1S0W A;  5GT3 A;  4N9K A;  3AV1 B;  2LY8 A;  1E88 A;  4AWL B;  3BFD A;  4Z66 B;  1ERO A;  3Q07 A;  4KZA A;  5B32 A;  4GDN A;  3WAA C;  1P3B B;  1FQG A;  3LO7 A;  4X23 B;  2HDR A;  3IWQ A;  5AVB A;  3REJ C;  1M18 D;  3LGO A;  3BLM A;  2EX8 A;  5TGF A;  4IBC A;  1SDN A;  3O3V A;  5FI2 A;  1M1A A;  3MVD D;  3UB5 P;  1EQZ B;  4PM5 A;  3PBR A;  5HX9 A;  4CQH A;  5BT1 D;  3IF5 A;  1FCM A;  4MBF A;  5FA7 A;  3REK A;  2JBF A;  2WKR A;  4FTX A;  2RTS A;  1AOI A;  3REJ B;  3LCE A;  3D4F A;  3QP2 A;  1KX5 D;  3VH5 W;  4Z2H A;  1K56 D;  5A92 A;  3JVU A;  5JA4 A;  3HON A;  4BL3 A;  3NJA A;  3UDI A;  1HTA A;  5L09 A;  4KHA A;  3W97 C;  2ACG A;  2ZMF A;  1XJ2 A;  2HJE A;  2VJW A;  4LCL A;  1P34 B;  1HQ3 D;  2HDQ A;  5AV8 C;  4IBI A;  3AN2 D;  5DFY A;  4WBG A;  3REI C;  3AZH B;  5F99 D;  5AV9 A;  1IFQ A;  5C5K A;  3NBL A;  3WD4 A;  1G6A A;  2V1B A;  1E4D A;  3AZJ B;  3AFA B;  2WAE A;  4DRA A;  2V1A A;  3IS2 A;  1K57 A;  5B0Z C;  3FC7 A;  1XA7 A;  1ID3 C;  3W97 A;  3IP4 C;  5E2E A;  1P3I D;  2W3G A;  5HWT A;  3B6F D;  4ZBE A;  5CHJ A;  1F5M A;  3MGR B;  3WX7 A;  5JYP A;  4ETZ A;  3MNN D;  2P04 A;  3IH8 A;  2PBD P;  3HLW A;  1NYM A;  5CHL B;  5HDC A;  4OOL A;  2JKR M;  1N9B A;  4WU8 C;  2W8S A;  1T1B A;  2KOI A;  2XGN A;  1JWZ A;  4EBL A;  4R8P C;  5BO0 A;  3AZG A;  1ZLA A;  5GLD A;  2RVQ C;  4UUZ A;  2CV5 B;  4BLM A;  2VQR A;  2NZD B;  2W3D A;  2D49 A;  4WNN B;  4IHQ A;  4QWO A;  1KX4 B;  3AZM A;  3DTM A;  4NXB A;  2WKI A;  4OUI A;  2BTF P;  3IX8 A;  4OPQ A;  4DE0 A;  4RVA A;  3MGP A;  4PAU A;  2NUT C;  3BFE A;  4YM6 A;  1NYY A;  3HLG A;  3PAE A;  1N9O A;  4FH2 A;  1P3L A;  2W1T A;  3UE0 A;  1M6K A;  4JXS A;  1GSV A;  2Z2L B;  4WU9 D;  3MFX A;  1YPR A;  5GT0 D;  1YAX A;  3SH8 A;  3OCN A;  5EEC A;  4WYY A;  4J8W A;  1DJA A;  3NQJ B;  1RCJ A;  1UWP X;  3A1K A;  3KO6 A;  5B1L B;  1O07 A;  3P09 A;  1ZKJ A;  4Y3I A;  2WZZ A;  2ZY2 A;  4R6L A;  3REK B;  1F9I A;  4HP9 A;  5AVC D;  2OWJ A;  1ZLA B;  3EGD C;  1ZC2 A;  5JRG B;  4QY5 A;  4NG2 A;  4K0X A;  4QHC A;  3UB7 A;  4R4S A;  4J8X B;  4B4X A;  3QP8 A;  3NOP C;  4LRZ E;  1BLH A;  3X1S D;  3NC8 A;  1ZG6 A;  2ZJ9 A;  2ZQC A;  3D72 A;  2XD5 A;  4BJP A;  1F66 C;  2A3U A;  5EOO A;  2ZQ7 A;  3NOU C;  4ZJ1 A;  3A1I A;  5EVI D;  4LV3 A;  1BH8 A;  2V8C A;  3CMZ A;  5AV8 B;  3UTA A;  1KX5 A;  3IBR A;  3OPL A;  5AQB A;  3REI D;  3BY8 A;  3HUO A;  4MDZ A;  4ZUX C;  4MBK A;  2QKP A;  4OP5 A;  4X25 A;  5BNV B;  3AFA C;  4XT2 B;  3BEB A;  3SOI A;  5FDH A;  3HCY A;  2DNS A;  3W97 D;  1EI5 A;  4DMZ A;  3LZ1 C;  4MLL A;  5GHY A;  5CXW A;  3WTP A;  4E3I A;  3SH9 A;  1F1E A;  3E4P A;  2B18 A;  2XDM A;  4Y5F A;  2LB9 A;  3MGR C;  3GEC A;  1YU3 A;  1JNU A;  5FQJ A;  2ZY3 A;  4JXV A;  2VK3 A;  3MVD B;  1H3O B;  4QLC A;  2QPN A;  3LR5 A;  4IBB A;  2WYX A;  3GMW A;  1P3P C;  4KGC C;  4WEL A;  3W96 B;  4Y7P A;  4DE3 A;  1LT0 A;  3H7W A;  4WLA A;  4IBR A;  4UAA A;  3C1C C;  4S2N A;  1PI4 A;  5HAR A;  4WL9 A;  4NEE D;  1LLB A;  2HIO B;  1PWG A;  2EX6 A;  2X71 A;  1E6R A;  4IBK A;  1CK7 A;  1N1J A;  3AN2 B;  1J7M A;  1YSP A;  4GLQ A;  1H8P A;  5GT3 B;  1U35 C;  4R8P B;  1EAK A;  3OC2 A;  1ALQ A;  3F1O B;  2WGW A;  1H0I A;  2PBY A;  3OPP A;  1EQZ A;  5G4Z A;  4Z2G A;  3MGQ A;  5F1G A;  2HPB A;  3IF6 A;  3KSG A;  1YUE A;  3WKJ C;  3G2Z A;  1TZY D;  3X1T D;  4HHD A;  1K57 C;  4HH3 A;  2IWD A;  3T4S A;  4RA7 A;  3KYZ A;  1FIL A;  3TU4 D;  3LR4 A;  1OGG A;  3IXB A;  4DDY A;  2FH5 A;  4IVI A;  3FKE A;  3MGP B;  1LHY A;  5HL1 A;  1BT5 A;  5FSR A;  4B9O A;  4DRB A;  3ULF A;  1P3F C;  3KUY A;  2HDU A;  4YNR A;  4OJL A;  2VGJ A;  2HJ9 C;  2LB5 A;  2FFY A;  1P3M D;  1H3O A;  3KFU G;  3WTP E;  2OAP 1;  1P3P A;  5DNN C;  4KGC A;  4PKY A;  3WTP C;  1DJC A;  2BAS A;  1XJ3 A;  3C8C A;  2JN7 A;  1RP5 A;  3IBJ A;  1S1Z A;  3PXP A;  3O62 B;  3UMD A;  4LV2 A;  4R0Q A;  2QYB A;  4F3L B;  3NDE A;  4CSR B;  2G5I C;  1LSX A;  3F1P B;  5HDD A;  5AV5 A;  5B24 C;  1K0K A;  4O01 A;  3VH6 A;  1S32 D;  4EV4 A;  2J8Y A;  5FEF A;  2PD7 A;  2UWX A;  3QP5 A;  2VV6 A;  2K31 A;  3AZN A;  1NLY A;  1OTD A;  5DFX A;  5DNM A;  4OQ0 A;  2XEP A;  1LSV A;  4LCM A;  2XFT A;  1DP9 A;  5BOH A;  4QNL A;  4GHI A;  4G92 B;  3C4O A;  3MF0 A;  3AYW C;  4FCF A;  4OOM A;  4IJG A;  3UDF A;  5FQQ A;  1XX2 A;  1ONG A;  3CIT A;  3WA9 B;  5E5A B;  3K3C A;  3REK D;  5BT1 C;  2WKQ A;  2J3T C;  2W27 A;  3LUQ A;  3H0R C;  4RQ9 A;  5G4Y A;  5B2J D;  4E3L A;  4Q8I A;  5TBM A;  5BNV A;  1M18 C;  4LPZ A;  2QMI A;  1W79 A;  1U35 A;  4GD6 A;  1I2W A;  3PBQ A;  3GTC A;  3H0M C;  3T1S A;  3REH C;  1GHP A;  3AGF A;  1J3W A;  4XUJ B;  2VGL S;  4G91 B;  3REL B;  3X1V D;  4LD9 A;  4NZ4 A;  4QLC D;  2BLS A;  1N9L A;  3B6F A;  2XSS A;  1BLS A;  3X1S C;  2XA7 S;  1MWU A;  3RFB A;  4ZUX B;  1XJ4 A; 
#chains in the Genus database with same CATH homology
 4E3M A;  4QY6 A;  5B31 B;  2L5A A;  4H9S A;  4OLD A;  2JE5 A;  3UT9 C;  4KUD A;  5B0Y B;  2WAD A;  3SS5 A;  5M18 A;  5CPJ D;  3AL0 C;  3X1U C;  3KWQ B;  5BNX A;  1NY0 A;  2Y2O A;  2RVQ D;  5AV6 C;  4JXW A;  3MNN A;  3WS4 A;  3RXX A;  3REH A;  5AV6 A;  1NZO A;  1PIO A;  4WU8 D;  1PW1 A;  2WUQ A;  3GSG A;  3TU4 A;  1B6W A;  3G32 A;  4KQR A;  3B0B A;  5GL9 A;  1YLP A;  4KEN B;  3TU4 B;  2FJ7 B;  1M19 D;  1P3O D;  5KSH A;  3E2L A;  4GDB A;  1N1J B;  3AN2 A;  4P87 A;  5TR7 A;  3KXB A;  2Y4A A;  3GV9 A;  1XKZ A;  3VFF A;  1E25 A;  4J8V D;  2J9P A;  1ESI A;  3WA9 A;  4GKU A;  5CPI D;  3C7V A;  4XZQ C;  1WYB A;  5FQI A;  3LEL A;  3AZF D;  1BUE A;  1OME A;  3X1V C;  3I7J A;  3C1C B;  1TEM A;  5FQ9 A;  1S32 C;  4KZ7 A;  4J8W D;  5IHV A;  3AZF C;  1CK3 A;  1ESU A;  3AZI A;  5CHM A;  4J8X C;  2G5H C;  3WKJ B;  3ZGA B;  5AVC A;  4XZQ B;  2HP9 A;  1P3L B;  4LV0 A;  3GVB A;  5AQ9 A;  4WZ4 A;  4N1X A;  2V20 A;  1VM1 A;  5CP6 D;  4C3Q A;  3MKF A;  4P0M A;  4JJN A;  5TFQ A;  1XGJ A;  1P3F D;  3AZM D;  3EPL A;  1GHI A;  4XUX A;  4J8W C;  3VP1 A;  4E45 A;  3WTP B;  3B3X A;  4YM6 D;  5BPV A;  1P3B D;  3REH B;  2J9O A;  3VP0 A;  5B24 D;  4R3B A;  4R1G A;  5DNM B;  5G18 A;  3NQU A;  5GXQ B;  2WKH A;  1FR6 A;  3KSY A;  5DNN D;  1P3A A;  4WZ5 A;  4YIN A;  4NY2 A;  1H5X A;  4NZ1 A;  4RYE A;  5FAQ A;  2F8N G;  3MVD C;  1KX5 B;  1IKI A;  4Y0U A;  1MWS A;  4OP8 A;  3N3F A;  3AV1 C;  3FYZ A;  4EBN A;  4WU8 A;  3BM6 A;  4R8P A;  1ZG4 A;  3L2A A;  4KUD D;  1K6S A;  2R9W A;  5CPJ A;  4Z5T D;  1ES5 A;  5F99 B;  1E3U A;  5AVB D;  1M18 B;  5E5A D;  4KZ6 A;  4KHA B;  3B0C W;  1VQQ A;  2YFV B;  5EVI A;  4H9P A;  4EWF A;  4EQI A;  2OV5 A;  3NQU B;  4JLF A;  2BG1 A;  3C1B A;  3M2J A;  2Y55 A;  1KGF A;  1KX3 C;  4IBE A;  4LV1 A;  4N92 A;  2Y2G A;  4QLC C;  2XR0 A;  1I2S A;  1HVB A;  3GQZ A;  2Y59 A;  2R9X A;  3AZH C;  5GHZ A;  2C6W B;  4ZUX D;  2YFW A;  4S2P A;  4GD8 A;  3O88 A;  4EO5 B;  3NCK A;  4GNU A;  1AXB A;  4NE5 A;  5B32 B;  5CPJ B;  3A6N C;  2NZD A;  3G31 A;  3IF6 B;  1TAF A;  3IH9 A;  5AY8 C;  3RJU A;  2XQZ A;  2XD1 A;  3IXH A;  1FSW A;  1LL9 A;  1ID3 B;  3NY4 A;  2Y91 A;  5FAT A;  1PW8 A;  4L0L A;  1KGG A;  4U3T A;  1ID3 A;  3N4I A;  3LJA C;  3V9R A;  5B1M C;  5B31 G;  3AFA D;  5DF9 A;  3ZNT A;  4WU9 B;  1SCW A;  2ZM8 A;  5CP6 A;  3ZFZ A;  1IYS A;  1NJ4 A;  4KZB A;  4IBD A;  1P3I B;  3A3I A;  1P3F A;  2HUE C;  3OPH A;  4MNR A;  3FKV A;  3AZE D;  5KDM B;  4WU9 C;  2Y2P A;  2RIQ A;  4NFT A;  3KWQ C;  3KS8 A;  3WA9 C;  1O7E A;  5E2H A;  1QMF A;  3AZF B;  4CAY B;  1IKG A;  1FCO A;  3VMA A;  1JTD A;  1ERQ A;  3F6T A;  4C75 A;  1CI8 A;  4LD9 D;  2H0Y A;  2Y2N A;  4R3J A;  3AZE C;  5EVI B;  3LY4 A;  2NQB B;  5FQM A;  4KUD B;  1BSG A;  2QZ6 A;  5B1L D;  2BYK A;  3AZK A;  1P3B C;  1YLT A;  3AZG C;  5D3O A;  3AZM B;  3HLB A;  3Q1F A;  2DRW A;  2PYO C;  1CI9 A;  2IWB A;  5BS7 C;  1YQS A;  4M3K A;  4XUZ A;  3LEZ A;  3AZM C;  1P34 C;  5B24 B;  2EFU A;  5DNM D;  3PAG A;  3MGP C;  1XP4 A;  1YU2 A;  5J8X A;  1IYP A;  4ZJ3 A;  4DXC A;  2Y2Q A;  3N8S A;  3IXG A;  2GDN A;  4J8X D;  1PZP A;  5AV8 D;  4HGA B;  4UHU A;  3EG5 B;  1YM1 A;  1PYY A;  2BYM A;  2BYK B;  3G2Y A;  2FFF B;  3UTB B;  1KX5 C;  1LI0 A;  3HL9 A;  3SS3 A;  4EO5 C;  1ID3 D;  2F2A C;  1MBL A;  3KXB D;  5HAQ A;  5DF8 A;  1K55 C;  3RXW A;  2E8I A;  2WAF A;  2NQB A;  4ZBJ B;  3PBT A;  1DJB A;  5HW3 A;  5E5A C;  1C3B A;  1GA0 A;  1KX3 B;  5AVB C;  3O62 A;  3B6G B;  3AN2 C;  4DDS A;  4PM6 A;  1K6R A;  5FQK A;  3BFG A;  3AZE A;  3N7W A;  3OPR A;  5GT0 C;  4PPR A;  1ES3 A;  1L2S A;  5AV6 D;  3W98 D;  5CEC A;  4DXB A;  1EQZ C;  5DTS A;  2HIO D;  1J9M A;  3TSG A;  5CPJ C;  5B32 C;  5E2G A;  5F1F A;  5EOE A;  3MGQ B;  5GT3 C;  3W96 D;  2OLV A;  3AZK C;  1P3B A;  1M19 A;  4GH9 A;  5GT3 D;  2WGI A;  4OKP A;  4IBF A;  3REJ A;  5A93 A;  4IED A;  2PYO A;  5EPH A;  5B32 D;  1NRF A;  2FJ7 C;  3ZG7 B;  3LEL B;  2WZX A;  4ZAM A;  2ZC7 A;  2PU2 A;  1S32 B;  3G30 A;  4GHL A;  3C5A A;  5CHU A;  1Q2P A;  3X1U A;  4P6B A;  4S2L A;  3VSL A;  4H9R A;  3MNN C;  1KVM A;  1JFI A;  3FKW A;  4P85 A;  3B6F C;  5BNX B;  1H8Z A;  2FJ7 A;  5B40 C;  1P3A D;  3C4P A;  5GSU C;  3AZK D;  3AZI D;  5CP6 C;  3KS4 A;  1PWD A;  3EPJ A;  4LG2 A;  4NYU A;  3AYW D;  4UA7 A;  1XXM A;  4U0T A;  5DTT A;  1M1A B;  4JJN D;  4WV4 B;  4H9N A;  2ZQ8 A;  4F94 A;  4YS3 B;  3VH5 T;  4KQO A;  2F8N K;  1EWZ A;  1K55 A;  3MXR A;  1QME A;  3WAA B;  1RGY A;  4WZS B;  3ZG8 B;  2Q9M A;  5AQA A;  1WYC A;  5E5A A;  3MGR A;  5B24 A;  2EX2 A;  5AV8 A;  1KE0 A;  1BH9 A;  1GA9 A;  4PM9 A;  4ZUX A;  3L26 A;  2WKE A;  4JF6 A;  5DNM C;  3W99 C;  3S1Y A;  2WK0 A;  1XA1 A;  1BH8 B;  3V50 A;  1P3O C;  2VGK A;  3ZG5 A;  1W2E A;  4BL2 A;  3P98 A;  3MZD A;  3AZG D;  2V1Z A;  5CGW A;  3N8L A;  5B1L C;  5F83 A;  5AY8 A;  1PZR A;  4CSR A;  5CPI C;  1P3G D;  2ZC6 B;  4EBP A;  5B2J B;  4AWL C;  3UPO A;  4NE3 A;  4Z2M G;  4IBG A;  3UT9 D;  3G35 A;  3UDX A;  2Y2I A;  4QB8 A;  2XFS A;  3MGQ C;  1KGE A;  5GSU D;  2CV5 D;  3DW0 A;  3HLE A;  3AZH A;  3SS4 A;  4QLC B;  3AZJ C;  4H9O B;  1M19 C;  2XK1 A;  3WAA A;  1MWT A;  3L29 A;  3KWQ D;  3UTB D;  1IYQ A;  3IWI A;  3BEC A;  1K25 A;  4H9S C;  3C1C D;  4H9N B;  1YU0 A;  3WRT A;  1HQ3 B;  3R45 A;  3B6G C;  4GB7 A;  4WU9 A;  4KG6 A;  3AZJ D;  4O7D A;  3IF6 C;  1KU5 A;  4Z2M H;  2CV5 C;  2FJ7 D;  4XUJ C;  1W5D A;  3GRJ A;  4WU8 B;  1KX4 A;  3X1S A;  2ZQA A;  5CP6 B;  1MY8 A;  3G4P A;  3W4O A;  2EFX A;  1P3F B;  5B2I D;  4OQG A;  1WWI A;  4OJP A;  1W8Q A;  4NET A;  1K54 A;  3UE1 A;  5CPI A;  1M1A D;  3A6N D;  3REI A;  2ZLY A;  3AYW A;  3AFA A;  4J8U C;  5GLC A;  1S6R A;  3HVF A;  5B1L A;  5EVL A;  2ZC5 B;  3AGE A;  3UTA C;  4HBT A;  5KZH A;  5HAP A;  3HRE A;  3LJA D;  3HSH A;  5KSC A;  2B5R A;  4J8W B;  3CJM A;  3O87 A;  3M6H A;  3VP4 A;  4KG2 A;  1AOI D;  1FSY A;  4IBX A;  4Z66 C;  4OPY A;  2ARO D;  5G49 B;  1I5Q A;  4JJN C;  4YM6 B;  4CJN A;  3AZK B;  3AZI B;  2X01 A;  3B6F B;  5EVI C;  3MFD A;  3M2K A;  3UTA B;  3ZCZ A;  3AYW B;  5F99 A;  3W4Q A;  1KX3 A;  1K4F A;  3OZH A;  3AZI C;  4R23 A;  1M40 A;  2F8N B;  4UUZ B;  2CV5 A;  5DNN A;  4JJN B;  1P3M C;  1Q9C A;  2IO5 B;  3WKJ A;  5HAI A;  4X56 A;  2ZQD A;  5GXQ D;  2ZM0 A;  3UTB A;  5BS7 A;  2ZY4 A;  4G91 C;  3MKE A;  1TZY A;  3X1T A;  3HLC A;  3W98 A;  3AV1 A;  3VOZ A;  1TZY C;  3X1T C;  4HGA C;  5G49 A;  3IT9 A;  3REI B;  3Q82 A;  4R8P D;  3AGD A;  5FAS A;  3ZNY A;  3KWQ A;  3AV2 A;  1P3K C;  2H10 A;  3W96 C;  1K4E A;  5EUA A;  3LZ0 A;  2G2U A;  1BUL A;  2IOU A;  4YS3 A;  2DQN C;  2F8N A;  3UN7 A;  4Z5T B;  3W98 C;  4HES A;  4FH4 A;  1P3K B;  1P3G B;  1BLP A;  3A6N A;  1KDW A;  5GT0 A;  3A6N B;  5E43 A;  1P3P D;  4KGC D;  1MWR A;  2ZQ9 A;  1U35 B;  3LZ1 A;  3V3S A;  4WEK A;  3L25 A;  1ES4 A;  4H9P B;  3O62 D;  2C5W B;  5CPK C;  5B0Y A;  3WRZ A;  3EQU A;  4HEF A;  3P5J B;  4IJE A;  3LZ0 B;  1T3U A;  4IJF A;  2Y2H A;  4Y0T A;  3MZE A;  5B1M B;  5B2J A;  2JSS A;  4H8R A;  4ZTK A;  3SH7 A;  4J8U D;  2ZC4 B;  5CPK A;  5AV9 B;  2Y2L A;  5AV5 C;  4Y0O A;  5B2I B;  2HP5 A;  4H9O A;  4NE6 A;  4IVK A;  4JF4 A;  5B2I C;  4KZ5 A;  3PTE A;  3S22 A;  4S2O A;  3ISG A;  2IO5 C;  5CGX A;  4J8V C;  3DWK A;  1BTL A;  4E3O A;  3AZE B;  3AV2 C;  4OH0 A;  1P3A C;  4FD8 A;  3REL A;  3B0C T;  5B40 A;  1MKI A;  4MEZ A;  1P3G A;  3LJA B;  1YLY A;  3UT9 A;  4KUD C;  4NYY A;  5B33 D;  1ONH A;  5B31 A;  4G92 C;  3C1B C;  3L28 A;  1AOI B;  3AV1 D;  4E3K A;  3IHB A;  1YLZ A;  3MGS B;  1P3K A;  1KDS A;  1ZLA C;  4OOY A;  5KMW A;  5CTN A;  3C7U A;  3MGS A;  1TZY B;  3X1T B;  1PWC A;  3WA9 D;  3O86 A;  2H5S A;  3C1C A;  3MGS C;  1FOF A;  4S2N C;  3UE3 A;  1P3O A;  4OVD A;  3ZHH A;  4K91 A;  4OJ6 A;  3W4P A;  1P3O B;  1P3G C;  1G68 A;  4FSF A;  5FAP A;  5E2F A;  1EQZ D;  1BFM A;  2F8N D;  3Q81 A;  5F99 C;  3PBS A;  1L0F A;  1M18 A;  2DCF A;  4Z66 A;  1HTZ A;  3ZG9 B;  1P3M A;  3IXD A;  3Q7Z A;  3CG5 A;  4UPK A;  4N1H A;  3AZJ A;  1K38 A;  3HLD A;  5CGS A;  4B4Z A;  3W99 D;  1L0E A;  5CTM A;  4KZ4 A;  4GZB A;  3AZL A;  4U0X A;  3WWX A;  3B0D C;  5AY8 D;  2JCH A;  4OQH A;  3KXB C;  4H9Q B;  3V39 A;  3LZ1 B;  2PU4 A;  5B0Y D;  5B32 G;  5B2I A;  3VP3 A;  2EX9 A;  4KZ9 A;  3ZG0 A;  5EE8 A;  1B67 A;  5AV9 C;  4RX2 A;  1HQ3 C;  3TU4 C;  5DF7 A;  3AZH D;  5AV9 D;  1F66 A;  1IEM A;  2Z2M B;  4S2K A;  4PMA A;  3UO9 A;  3NQJ A;  3H0L C;  1S32 A;  5CEB A;  2J8P A;  4X69 A;  3AZN D;  1M19 B;  5B0Z B;  3FV7 A;  3MXS A;  4R4R A;  5AV6 B;  3W98 B;  1JTG A;  1XGI A;  2P74 A;  1N4O A;  4E6W A;  3QNB A;  4DE1 A;  3CZD A;  4XUJ D;  1U35 D;  5CPK B;  3REL D;  3X1V B;  5A91 A;  3LZ0 C;  4K0W A;  1YLW A;  1ERM A;  4JF5 A;  5M1A A;  3MZF A;  3X1V A;  4OON A;  1KX4 D;  3W8K A;  5F82 A;  4XZQ A;  1MXO A;  3HUN A;  5L2F A;  5B31 D;  1E3U D;  4WMC D;  4ID4 A;  3WKJ D;  1W8Y A;  5HFO A;  3B6G A;  5AV5 B;  3TG9 A;  1IEL A;  4LD9 C;  4J8U B;  1TAF B;  4M6B A;  5GT0 B;  3MGS D;  4BEN A;  3BRM A;  2XF3 A;  4DF6 A;  5B40 B;  1ULY A;  1YMS A;  3ZVT A;  5I94 A;  5DVA A;  3R45 B;  1KE3 A;  4XXR A;  4X23 C;  2ZY5 A;  5AVC B;  4OJO A;  3V5M A;  3C1B D;  2P9V B;  2CWE A;  4YM6 C;  5BO0 B;  3AZG B;  3FWL A;  3REH D;  3AZL B;  2PYO B;  4YS3 D;  4EUZ A;  4GHA A;  4WNN A;  2NZD D;  4J8V A;  4H9Q A;  1YT4 A;  5JRG D;  2X02 A;  5KDM A;  3AV2 D;  4OQI A;  3REK C;  5DNN B;  4QD4 A;  3VP2 A;  3WS2 A;  5FAO A;  3FDD A;  3LY3 A;  5B1M A;  3AZL C;  4ZDX A;  4OPR A;  5A90 A;  2BYM B;  2RL3 A;  3LZ1 D;  3EPK A;  4QJG A;  3HUM A;  5GLA A;  1K54 C;  3V3R A;  5FUG A;  1L0G A;  3MBZ A;  3A3E A;  2NQB C;  3ITA A;  2Y2M A;  3PBO A;  1YLJ A;  5AVB B;  5B0Y C;  3LEL C;  3AZN B;  3W97 B;  3V9R B;  3WTP D;  1F66 D;  1LL5 A;  1PI5 A;  2V2F F;  3QNC A;  2P9V A;  5CRF A;  4WM9 A;  2J7V A;  3X1S B;  2G2W A;  5CPK D;  3BYD A;  3HLF A;  3N8R A;  3WS5 A;  3UT9 B;  3W99 B;  4E44 A;  4XUJ A;  1KVL A;  5GSU B;  4J8U A;  2RCX A;  2EXA A;  4WEJ A;  1P34 A;  5JA4 B;  4Z5T C;  4S2M A;  5AY8 B;  3ITB A;  3BLS A;  4X68 A;  3A3D A;  2OLU A;  2I72 A;  3N6I A;  4LD9 B;  4PM7 A;  1MPL A;  1WE4 A;  5B40 D;  2EXB A;  2HIO C;  4WZ5 C;  4Z5T A;  3Q7V A;  5B0Z D;  3VH6 T;  2ARO B;  3ZDJ A;  5CER A;  5B33 C;  4NZ5 A;  4CPK A;  1K56 A;  3B0D B;  5DTK A;  3UPN A;  2ZM5 A;  4IBJ A;  3E2K A;  2A49 A;  2XLN A;  5JRG A;  3A3F A;  5GXQ C;  2YFW B;  3QHY A;  4E6X A;  3UY6 A;  4NK3 A;  3BFC A;  4S2J A;  1TDL A;  1KE4 A;  2OSU A;  2ZD8 A;  1Q2Q A;  1H8Y A;  3EQV A;  4BD0 A;  3LJA A;  1SKF A;  1BH9 B;  4BD1 A;  4X6T A;  2YFV A;  4A5R A;  1SHV A;  3O62 C;  4N9L A;  1CEG A;  2HUE B;  5JRG C;  1IYO A;  5AV5 D;  1NXY A;  5U47 A;  2ARO A;  5C3I B;  3W99 A;  1JFI B;  3FZC A;  2NQB D;  3KUY B;  4OPZ A;  1XPB A;  1JWP A;  4Z66 D;  1AOI C;  4GN2 A;  3MGP D;  1GCE A;  1KX3 D;  4E3N A;  1BLC A;  4X23 D;  3C1B B;  4RX3 A;  3TOI A;  3AZL D;  4ZJ2 A;  1P3M B;  4B88 A;  4LEN A;  1Y54 A;  2PYO D;  3UTA D;  1YU1 A;  2HIO A;  5FUG B;  5C3I C;  1P3K D;  3NI9 A;  1P3L C;  5GXQ A;  1U60 A;  3W96 A;  3AV2 B;  5AQ7 A;  2IWC A;  4YS3 C;  3REJ D;  4KG5 A;  3VSK A;  3A3J A;  3UTB C;  1YMX A;  1NZU A;  3NIA A;  2XH9 A;  2ZM2 A;  2ZMA A;  3VH5 A;  2H0T A;  1P34 D;  3X1U D;  3LZ0 D;  3WS0 A;  3KXB B;  1SDE A;  1CEF A;  1TVF A;  4S2I A;  2Y2K A;  1YU4 A;  5B0Z A;  3UNW A;  1HD8 A;  3OCL A;  4D2O A;  3B6G D;  4GOG A;  3MVD A;  2Y2J A;  4JPM A;  1Z2C B;  1F66 B;  4JBF A;  1RGZ A;  2DF4 C;  5B31 C;  1P3P B;  4KGC B;  3WS1 A;  4Z9Q A;  3BFF A;  4UA9 A;  3GR2 A;  4JXG A;  1PZO A;  1W7F A;  3MGR D;  1TDG A;  4ZBJ C;  4JKT A;  5CPI B;  1A7W A;  5B2J C;  3PBN A;  3G34 A;  3REL C;  2CC1 A;  3MGQ D;  1Z6F A;  2HP6 A;  1P3I C;  4PM8 A;  3VFH A;  5CED A;  3UPP A;  3Q7V B;  5JYO A;  4BQM A;  2WGW B;  3LEL D;  3AZF A;  2ZC3 B;  1ES2 A;  1JWV A;  3AZN C;  3JYI A;  3M6B A;  4KQQ A;  3IHA A;  2NZD C;  4DE2 A;  4DRT A;  4J8X A;  4KZ3 A;  3KUY C;  5B33 B;  1JVJ A;  3KUY D;  1M1A C;  2ARO C;  5FI7 A;  1HQ3 A;  1R4V A;  5B1M D;  5GHX A;  1P3I A;  4XZQ D;  1HZO A;  4X23 A;  1L0D A;  3HBR A;  4QU3 A;  4X55 A;  3S4X A;  4MBH A;  2JC7 A;  4C6Y A;  5GSU A;  4DQY B;  1P3A B;  4WMC A;  1LI9 A;  1FR1 A;  4J8V B;  4YFM A;  4DKI A;  5AVC C;  1ZLA D;  1WWS A;  3MNN B;  2WGV A;  1FCN A;  3ZVW A;  3VOY A;  1GHM A;  1BZA A;  3EPH A;  3VH6 W;  4H9R B;  3DWZ A;  3L27 A;  2Q9N A;  3WAA D;  5B33 A;  5FI6 A;  4KZ8 A;  4X53 A;  1KX4 C;  2HDS A;  4OJ5 A;  5GLB A;  4CAY A;  1DY6 A;  5M19 A;  3IWO A;  1P3L D;  4WJ3 C;  4NZ3 A;  2F8N H;  4OLG A;  4UA6 A;  3X1U B;  4HBU A;  3IQA A;  4E3J A;  1S0W A;  5GT3 A;  4N9K A;  3AV1 B;  2LY8 A;  3BFD A;  4AWL B;  4Z66 B;  1ERO A;  3Q07 A;  4KZA A;  5B32 A;  4GDN A;  3WAA C;  1P3B B;  1FQG A;  3LO7 A;  4X23 B;  2HDR A;  3IWQ A;  5AVB A;  3REJ C;  1M18 D;  3BLM A;  2EX8 A;  5TGF A;  4IBC A;  1SDN A;  3O3V A;  5FI2 A;  1M1A A;  3MVD D;  1EQZ B;  4PM5 A;  3PBR A;  5HX9 A;  5BT1 D;  3IF5 A;  1FCM A;  4MBF A;  5FA7 A;  3REK A;  2JBF A;  1AOI A;  3REJ B;  3LCE A;  3D4F A;  1KX5 D;  3VH5 W;  1K56 D;  5A92 A;  5JA4 A;  3HON A;  4BL3 A;  3UDI A;  1HTA A;  4KHA A;  3W97 C;  4LCL A;  1P34 B;  1HQ3 D;  2HDQ A;  5AV8 C;  4IBI A;  3AN2 D;  4WBG A;  3REI C;  3AZH B;  5F99 D;  5AV9 A;  3NBL A;  1G6A A;  1E4D A;  3AZJ B;  3AFA B;  2WAE A;  4DRA A;  1K57 A;  5B0Z C;  1XA7 A;  1ID3 C;  3W97 A;  3IP4 C;  5E2E A;  1P3I D;  3B6F D;  4ZBE A;  5CHJ A;  3MGR B;  3WX7 A;  5JYP A;  3MNN D;  3IH8 A;  3HLW A;  1NYM A;  5CHL B;  4OOL A;  1N9B A;  4WU8 C;  2W8S A;  2XGN A;  1JWZ A;  4EBL A;  4R8P C;  5BO0 A;  3AZG A;  1ZLA A;  5GLD A;  2RVQ C;  4UUZ A;  2CV5 B;  4BLM A;  2VQR A;  2NZD B;  4WNN B;  1KX4 B;  3AZM A;  3DTM A;  2WKI A;  4OUI A;  4OPQ A;  4DE0 A;  4RVA A;  3MGP A;  3BFE A;  4YM6 A;  1NYY A;  3HLG A;  3PAE A;  4FH2 A;  1P3L A;  3UE0 A;  1M6K A;  4JXS A;  2Z2L B;  4WU9 D;  5GT0 D;  3SH8 A;  3OCN A;  5EEC A;  4WYY A;  4J8W A;  1DJA A;  3NQJ B;  1RCJ A;  3A1K A;  5B1L B;  1O07 A;  3P09 A;  1ZKJ A;  2WZZ A;  2ZY2 A;  3REK B;  5AVC D;  1ZLA B;  1ZC2 A;  5JRG B;  4QY5 A;  4K0X A;  4QHC A;  4R4S A;  4J8X B;  4B4X A;  1BLH A;  3X1S D;  3NC8 A;  1ZG6 A;  2ZJ9 A;  2ZQC A;  2XD5 A;  4BJP A;  1F66 C;  2A3U A;  5EOO A;  2ZQ7 A;  4ZJ1 A;  3A1I A;  5EVI D;  4LV3 A;  1BH8 A;  3CMZ A;  5AV8 B;  3UTA A;  1KX5 A;  3OPL A;  5AQB A;  3REI D;  3HUO A;  4ZUX C;  4MBK A;  4OP5 A;  5BNV B;  3AFA C;  3BEB A;  3SOI A;  5FDH A;  2DNS A;  3W97 D;  1EI5 A;  3LZ1 C;  4MLL A;  5GHY A;  5CXW A;  3WTP A;  4E3I A;  3SH9 A;  1F1E A;  2XDM A;  3MGR C;  1YU3 A;  5FQJ A;  2ZY3 A;  4JXV A;  3MVD B;  1H3O B;  4QLC A;  2QPN A;  4IBB A;  2WYX A;  3GMW A;  1P3P C;  4KGC C;  4WEL A;  3W96 B;  4Y7P A;  4DE3 A;  4IBR A;  4UAA A;  3C1C C;  4S2N A;  1PI4 A;  5HAR A;  1LLB A;  2HIO B;  1PWG A;  2EX6 A;  2X71 A;  4IBK A;  1N1J A;  3AN2 B;  5GT3 B;  1U35 C;  4R8P B;  3OC2 A;  1ALQ A;  2WGW A;  2PBY A;  3OPP A;  1EQZ A;  3MGQ A;  5F1G A;  2HPB A;  3IF6 A;  1YUE A;  3WKJ C;  3G2Z A;  1TZY D;  3X1T D;  1K57 C;  2IWD A;  4RA7 A;  3TU4 D;  3IXB A;  4DDY A;  4IVI A;  3FKE A;  3MGP B;  1LHY A;  5HL1 A;  1BT5 A;  5FSR A;  4DRB A;  1P3F C;  3KUY A;  2HDU A;  4OJL A;  2VGJ A;  2FFY A;  1P3M D;  1H3O A;  3KFU G;  3WTP E;  1P3P A;  5DNN C;  4KGC A;  3WTP C;  1DJC A;  1RP5 A;  3O62 B;  4LV2 A;  4R0Q A;  3NDE A;  4CSR B;  2G5I C;  5AV5 A;  5B24 C;  3VH6 A;  1S32 D;  4EV4 A;  2J8Y A;  2UWX A;  3AZN A;  5DNM A;  4OQ0 A;  2XEP A;  4LCM A;  2XFT A;  5BOH A;  4QNL A;  4G92 B;  3C4O A;  3AYW C;  4FCF A;  4OOM A;  3UDF A;  5FQQ A;  1XX2 A;  1ONG A;  3WA9 B;  5E5A B;  3REK D;  5BT1 C;  3H0R C;  5B2J D;  4E3L A;  4Q8I A;  5BNV A;  1M18 C;  2QMI A;  1W79 A;  1U35 A;  4GD6 A;  1I2W A;  3PBQ A;  3GTC A;  3H0M C;  3REH C;  1GHP A;  3AGF A;  4XUJ B;  4G91 B;  3REL B;  3X1V D;  4LD9 A;  4NZ4 A;  4QLC D;  2BLS A;  3B6F A;  1BLS A;  3X1S C;  1MWU A;  4ZUX B;  3NDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...