2Y2MA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e08)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 163
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2mA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2mA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2mA02
4QJGA 4GDBA 3C7UA 1M40A 1GHIA 4E3JA 4O7DA 2X01A 3Q1FA 1ERQA 5F1FA 4WMCD 2QZ6A 2DCFA 3BYDA 5E2GA 4IEDA 5FAPA 1PYYA 5DTKA 4JF4A 4N1HA 1W7FA 2IWCA 3IXDA 2ZMAA 3NY4A 3BM6A 1FR6A 3NIAA 3OPLA 4NETA 1YLYA 3UDXA 1KVMA 1JTGA 1ZG6A 1PW1A 2A3UA 3G34A 4OPZA 4DE0A 4M3KA 4ZDXA 3S22A 4XXRA 1K54A 5JYOA 1SDNA 1VQQA 1IYSA 1L0GA 5FDHA 4OONA 3Q82A 1RCJA 5A93A 1SHVA 3P09A 4OLGA 1L2SA 2QMIA 2V2FF 2XFTA 2ZJ9A 5U47A 3BLMA 2J9PA 4JPMA 4N92A 4FD8A 1FSYA 4OQHA 3ITBA 1NYYA 1MWSA 4OH0A 2FFFB 3WS1A 1BLPA 3ZG8B 1KDSA 4JF6A 4WMCA 2X71A 4GB7A 3P98A 5GHZA 1ES4A 3GRJA 4R4RA 4S2LA 3Q7VA 2BLSA 5CRFA 1ESUA 1PI4A 4E6WA 4DXCA 1MWTA 1YLTA 1PW8A 3AGFA 5CHUA 3SOIA 1FCNA 1WE4A 4GD8A 4DKIA 4OPQA 4S2KA 2ZQ7A 2HP6A 4DE1A 3ZCZA 3UDFA 4WZ4A 4OOMA 3GSGA 1Z6FA 4DDYA 3MBZA 4U0XA 4EWFA 4E3KA 1RGZA 5CEBA 4GOGA 2P9VA 3OCNA 1ONGA 5L2FA 3UO9A 4HBUA 1TDGA 1I5QA 4P85A 3O88A 3M6BA 3HUOA 1PZOA 2ZQAA 2Y2IA 3HUMA 3FKWA 5KZHA 3PAGA 2XDMA 3HL9A 1IELA 4OQIA 2V1ZA 5CXWA 5FATA 4DRTA 5FI6A 3OZHA 3ZNTA 2XFSA 4KG5A 4H8RA 4PMAA 5CHMA 2OV5A 4JXVA 4ZAMA 1BLCA 1ZG4A 4S2OA 3IWQA 4B4XA 4KZ3A 3WS2A 3M2JA 3HREA 3Q07A 5FAQA 3SH8A 3W4QA 4F94A 2EX2A 2Q9MA 1W8YA 5GHYA 4U3TA 2Y2LA 2ZQ9A 5M19A 3BFFA 1XX2A 2Q9NA 5CGXA 4XUXA 3IXBA 5GHXA 1ES3A 3OPHA 2Y4AA 5JYPA 1PI5A 1DJBA 1RGYA 1K6RA 4ZTKA 4ZJ2A 3FKVA 4XUZA 3JYIA 3EQVA 3C5AA 3G31A 1CEFA 4JXWA 4UA7A 4OVDA 2Y2OA 2J8YA 1K57A 2XH9A 3WS0A 2XLNA 2JBFA 1MXOA 4RX2A 5G18A 1MWRA 4BD1A 4DE3A 2Y2QA 3LY4A 3Q7VB 3VSKA 2WKHA 4P6BA 4EQIA 3BFEA 3IWIA 5DVAA 1XGIA 4GKUA 4WEKA 3CG5A 1YT4A 4R3JA 1ZC2A 1BLSA 5FQQA 1YMSA 1K4EA 4OPYA 3N8SA 2J9OA 4PM9A 1QMFA 1MKIA 3DTMA 1PWCA 4HEFA 4C6YA 4U0TA 5HL1A 4YFMA 3HLFA 4LENA 4MLLA 3IF6C 1N4OA 3MXSA 4CJNA 1ONHA 2ZC7A 4LV2A 5DF9A 2HDQA 5EOOA 1LL5A 1SCWA 3TSGA 3WS5A 4GZBA 2DNSA 3Q81A 4PM6A 4DDSA 3IH9A 3BRMA 3N6IA 1DJCA 4E3OA 1YLJA 4HESA 4X6TA 5CHJA 4BLMA 4EBPA 2Y2MA 4RYEA 4S2NA 5AQAA 3UPOA 4MNRA 3VSLA 4E3MA 1C3BA 2HPBA 4Y0OA 3VOZA 4JBFA 2Y55A 2ZD8A 4QU3A 5IHVA 5HAQA 3IXGA 4X56A 3LO7A 3E2KA 1CI9A 4BJPA 4BL3A 4CPKA 1K56A 1KE3A 3FV7A 3Q7ZA 1BTLA 5I94A 2X02A 3W4OA 4X69A 1DY6A 4ZBEA 3OPPA 1MWUA 4R0QA 3UPNA 1Y54A 3IHBA 2ZQDA 4GDNA 3MFDA 4X68A 4KZ8A 3CMZA 4NK3A 4D2OA 4A5RA 1O7EA 5CTNA 2EXAA 1HVBA 4BL2A 3BECA 4OQGA 5FI2A 2ZC3B 3ZHHA 2XD5A 3D4FA 3G35A 2WADA 2WAEA 1S6RA 3IXHA 3LY3A 3OPRA 3V50A 3WRTA 3N8LA 4X53A 2XEPA 2IWDA 4KQRA 2J7VA 3IWOA 4OQ0A 1L0FA 2HP5A 5TGFA 1I2WA 1G68A 2ZC6B 1AXBA 4N9KA 1WYCA 5HX9A 2EX8A 1PWDA 2V20A 1GCEA 3GQZA 3HBRA 5AQBA 3DW0A 5FI7A 1YLZA 3NC8A 3ZGAB 1E3UD 4QY5A 2WKEA 1NZUA 4YINA 4X55A 3SS5A 2PBYA 1NZOA 2BG1A 3VOYA 2Y2KA 4S2MA 2XQZA 1H8YA 5DF8A 4OP5A 4OOYA 2R9XA 4EV4A 3A3FA 3MZDA 5HW3A 2EX9A 4Q8IA 3BEBA 5EVID 2JC7A 3DWZA 2C5WB 4GN2A 4KQOA 4KZ5A 4PM7A 5TR7A 3A3IA 5CECA 3C4OA 4S2PA 3PTEA 4N1XA 3A3DA 3VP3A 1E25A 2VGJA 4R23A 1SKFA 1VM1A 4Y0UA 3GV9A 3I7JA 1S0WA 1LL9A 1NY0A 4R4SA 3O3VA 5EVIC 1L0EA 3G2YA 4C3QA 1KGGA 4OP8A 5TFQA 1BULA 1IYOA 1DJAA 1O07A 3PAEA 4DXBA 2E8IA 3MZFA 1XA1A 3WWXA 3IQAA 1LHYA 1HTZA 5GLCA 5D3OA 1XXMA 3NCKA 4DF6A 4OPRA 1I2SA 5M18A 2WGVA 5FQIA 3UNWA 5EE8A 3FZCA 5E2EA 5EPHA 4IBXA 3DWKA 1XA7A 5EVIA 2Y2PA 2FFYA 2UWXA 2ZM8A 5CGWA 5HARA 2QPNA 3ZG7B 3ITAA 1KVLA 1NYMA 1JWVA 1XPBA 3O87A 1KGEA 5F83A 3MKEA 4KZBA 4P87A 1KE0A 2VGKA 1K4FA 2WGWA 1EROA 3C7VA 3G30A 5HFOA 4WM9A 5GLDA 3TOIA 3FYZA 1H8ZA 1YLWA 1GA9A 1LI9A 3G32A 3VP0A 3IH8A 3PBNA 1FOFA 5EVLA 3AGDA 4Y0TA 1ES2A 3NDEA 3IT9A 3AGEA 2ZLYA 2OLUA 2Y2HA 3EQUA 4WZ5C 5CERA 5KSCA 4WYYA 1TDLA 1PWGA 2I72A 4EUZA 3BLSA 4LV0A 3PBSA 1E4DA 2XD1A 3WS4A 2WZZA 4EBNA 1K25A 3WRZA 4JXGA 4RVAA 3ISGA 2C6WB 4QD4A 5KMWA 2H0TA 5CGSA 5BOHA 1FCMA 4ZJ1A 1U60A 2ZC5B 2Z2LB 4K0XA 2JCHA 4KG2A 2ZM0A 4L0LA 3W4PA 4RA7A 3RXWA 2H10A 3UDIA 2DRWA 4K0WA 5FAOA 2Y2JA 3SH7A 3CZDA 3NBLA 2WKIA 3TG9A 3IF6A 4WEJA 4MBFA 4R1GA 2G2UA 4N9LA 3V5MA 1PIOA 3UN7A 2PU4A 3N4IA 1M6KA 3W8KA 5FSRA 5CEDA 1ALQA 4P0MA 2XK1A 1BZAA 2WZXA 3NDGA 3V39A 2EFXA 1XP4A 1K54C 4KZ6A 2HDUA 4KENB 1YMXA 5A90A 4KZ7A 1IEMA 3NI9A 3UY6A 1LLBA 1FR1A 1K6SA 1JTDA 5DTTA 2A49A 2HDSA 1W5DA 1NRFA 3ZG5A 1IYPA 3HUNA 3O86A 4IBRA 5EVIB 4ZJ3A 4MBHA 1K38A 4EBLA 1CK3A 1CI8A 2HP9A 5GLBA 3UE0A 1BT5A 1TEMA 4FCFA 4E3NA 1IYQA 3HLGA 1JVJA 3BFCA 4Y7PA 2P74A 2G2WA 2WGWB 2H0YA 4S2IA 3FWLA 5KSHA 5J8XA 3V3RA 4IVKA 3ZNYA 1Q2PA 4R3BA 2ZM2A 2GDNA 5FQ9A 4LCLA 1OMEA 3HLDA 3LCEA 3VFHA 2XF3A 1J9MA 1XGJA 4E3LA 3PBRA 5AQ7A 3VP2A 4C75A 4PM8A 4PPRA 3IF5A 2R9WA 2XGNA 1G6AA 4UHUA 4QY6A 1BSGA 5CTMA 4LV1A 1QMEA 1JWPA 4KG6A 1GHMA 5E2HA 2XR0A 2JE5A 3VFFA 3N8RA 5HAPA 1MY8A 4IVIA 3VP1A 2ZQCA 5FQKA 4OOLA 5FQJA 3BFGA 4HBTA 3C4PA 1MPLA 3PBQA 4KZAA 2Z2MB 3OCLA 2IWBA 1TVFA 3PBOA 4RX3A 5HAIA 3A3EA 1KGFA 2WAFA 3HLCA 2OLVA 1L0DA 3IF6B 5GL9A 1KDWA 1IKIA 3ZG0A 5A91A 3ZFZA 3QNBA 1HD8A 2B5RA 5F82A 1E3UA 3A3JA 1ES5A 3ZVTA 2Y2GA 4ID4A 3HLEA 4DE2A 1YM1A 5E2FA 1MBLA 2CC1A 2WGIA 4WELA 5A92A 1FSWA 5EOEA 5F1GA 5E43A 1WYBA 3SH9A 2Y59A 1GHPA 1NXYA 2RCXA 2WYXA 4FH2A 3S4XA 1YQSA 3V3SA 5GLAA 4UAAA 3ZVWA 3S1YA 3BFDA 1EWZA 2H5SA 4JXSA 1ESIA 4PM5A 4GD6A 1N9BA 3SS3A 1K57C 3VMAA 4S2JA 1LI0A 1NJ4A 4JKTA 5DTSA 5FA7A 1W79A 1JWZA 3B3XA 4KZ9A 1FCOA 3G2ZA 5AQ9A 4UA6A 2EX6A 3GTCA 4K91A 1HZOA 3PBTA 3N7WA 3QHYA 3SS4A 3OC2A 4BQMA 3ZG9B 4Z9QA 3HLWA 1FQGA 4LCMA 5DF7A 1BLHA 4FH4A 4OKPA 1ERMA 3GMWA 1IKGA 1RP5A 4JF5A 4LV3A 4E6XA 3HLBA 1H5XA 1EI5A 1CEGA 3UE3A 2ZC4B 3LEZA 1KE4A 3QNCA 3IHAA 1K55C 4QHCA 1XKZA 3E2LA 4KQQA 4UA9A 4MBKA 5EUAA 3CJMA 1GA0A 4BENA 4JLFA 5FQMA 3UE1A 2EXBA 1K56D 1BUEA 1SDEA 2OSUA 2RL3A 3MZEA 5FASA 1ZKJA 2WUQA 2EFUA 3GR2A 2ZQ8A 4KZ4A 3ZDJA 5M1AA 1W8QA 4S2NC 3UPPA 4WZ5A 3VP4A 4B4ZA 4OLDA 4E3IA 5EECA 3M2KA 3RJUA 1YLPA 4MEZA 4GNUA 2Y91A 3GVBA 2PU2A 3HVFA 4B88A 2Y2NA 3MKFA 4QB8A 4WBGA 4FSFA 3M6HA 3MXRA 1K55A 3RXXA 4BD0A 1PZPA 2P9VB 2HDRA 3G4PA 1Q2QA 2WK0A
chains in the Genus database with same CATH superfamily
3C7UA 2D49A 2X01A 3Q1FA 5F1FA 4WMCD 4WU8D 2QZ6A 2DCFA 3BYDA 5FAPA 1ZTUA 3A1KA 1P3LC 3REKA 3QP5A 1S32B 3BM6A 1FR6A 1HQ3A 3NIAA 2BTFP 3LIFA 1ZG6A 1KVMA 3R45A 3C1BC 1PW1A 4M3KA 5C5KA 2JHEA 3W96D 3WAAA 1IYSA 5FDHA 3KUYD 3F1OA 1RCJA 1KX5B 5A93A 3AN2B 3AZIB 1L2SA 2QMIA 4OLGA 3AZKB 2PHYA 1TZYC 2ZOIA 3BLMA 1A7WA 1KX3A 3AV1B 2FFFB 1PNEA 4KHAA 3UB8A 1EQZA 5C3IB 5AVFA 3AZGB 4GB7A 2HIOB 4IBKA 5GHZA 1ES4A 3GRJA 4HJ4A 1E6PA 3LZ0A 1OTIA 1VEUB 2BLSA 3CUEA 1YLTA 5CHUA 3SOIA 1WE4A 3MS6A 1BH8A 4DKIA 3VV4A 4S2KA 4ETXA 4YS3B 4MB3A 2HP6A 2O99A 4DE1A 1AOIC 4OOMA 4QNLA 3MBZA 4U0XA 1RGZA 1ONGA 1TDGA 4P85A 3O88A 3RELC 1UR9A 3M7PA 3L26A 3HL9A 5B33C 4LD9D 4OQIA 4XUJA 4DRTA 5GT3C 5FI6A 5B40A 4H8RA 2ZL1B 2OV5A 4JXVA 1BLCA 2I9VA 4B4XA 5AY8D 3M2JA 3HREA 5B0ZC 5GXQA 5FAQA 4F94A 1W8YA 4EQ1A 4JGQA 2Y2LA 3TU4C 4XUXA 3IXBA 5JRGA 5GHXA 3OPHA 2Y4AA 3CWFA 1P3LB 4EU0A 5JYPA 3CAXA 3LZ1B 1DJBA 1RGYA 1K6RA 2XA7M 4GHLA 3EQVA 1UWNX 3C5AA 2FJ7C 3KXBA 4FUWA 4RX2A 5G4ZA 3UT9C 2F8ND 5GSUC 3NECA 3MGRB 3MNNC 3B6FD 3Q7VB 3LR0A 2XSSA 4EQIA 5DVAA 3IWIA 4GKUA 4R3JA 3AYWD 1YU0A 1BLSA 1YMSA 4OPYA 1TZYB 3KSFA 2J9OA 4PM9A 1QMFA 3DTMA 1Y28A 1PWCA 2LY8A 4LGWA 5HL1A 3HLFA 2AROC 4LENA 1N4OA 1IOUA 1J7MA 3TSGA 4CJNA 4Z2KA 5DF9A 2HDQA 5K5BA 1KX4A 3LYXA 5DNND 3C38A 3C1BD 2QHKA 5AQAA 3VSLA 4E3MA 1C3BA 3FKEA 1P3MB 3IX3A 3VOZA 2ZD8A 1AOIB 1L6JA 3LO7A 1CI9A 4MN5A 4Z66B 1BYWA 1K56A 1KE3A 3FV7A 1BTLA 4UEYA 4X1MA 5B24B 3LIEA 3IHBA 3X1SB 4X68A 4KZ8A 3C30A 2F2AC 5BT1C 4BWIA 1HVBA 5F68A 3AZFD 4OQGA 3IS2A 3LY3A 1GSVA 1SKOA 4HHDA 4KQRA 1L3LA 3T4OA 3AZLD 4GJ4A 1H8PA 5B0ZB 1F98A 3AZHD 3LIAA 5B31B 1G68A 1ACFA 1WYCA 4Z2IA 2EX8A 1PWDA 3WA9A 3DW0A 5FI7A 1YLZA 2O9BA 4MN7A 1OTAA 2WKEA 1NZUA 1P3FD 3W97A 1MKMA 5CP6B 5B32A 4X55A 3SS5A 1P34C 4YM6C 5DF8A 4X23D 3AV2A 4J8XD 4EV4A 4OJ6A 3UT9B 3MGSB 4DRAA 1YSQA 3MZDA 5HW3A 1EW0A 5EVID 1M1AC 4H9QB 4KQOA 2J3TC 4J8VA 3C4OA 2A24B 1P3GD 3LJAC 5EM1A 2CV5C 3VP3A 4NY2A 1Q9CA 1SKFA 3GV9A 3TU4D 1P3IC 2AROB 1P9WA 5AV9C 2HUEC 1L0EA 2O9CA 5B2IC 1M18B 5TFQA 3WKJC 1BULA 2OAQ1 3PAEA 2YKFA 3S7PA 2FJ7D 4DXBA 2GNXA 1XA1A 3MZFA 5DKKA 3B6GC 1HTZA 1P3OD 5D3OA 5B1MC 4DF6A 1M19A 1ID3B 2G5IC 5GSUD 3MNND 5FQIA 2PT7A 5AVCB 1FIKA 4IBXA 3NOTC 1XA7A 3NJAA 4OJPA 2L4RA 1XJ2A 5HARA 4X25A 1KVLA 2W8SA 1JWVA 1F1EA 3WTPD 4KZBA 4P87A 2HV1A 2KX6A 2VGKA 1K4FA 5B1LA 2CMNA 3OLOA 2WGWA 2WKQA 4WM9A 5GLDA 3TOIA 3O62B 5DJUA 5BNXB 3LELD 4Y0TA 3NDEA 3IT9A 4J8WC 4J8UB 2OLUA 3B47A 5KSCA 4CSRB 4NE6A 3X1TB 3VH6W 1PWGA 5B31G 3X1VC 3AFAB 1JNUA 2V1AA 1GOIA 1K25A 4JXGA 4LRYC 5L8MA 3ISGA 1HQ3D 2C6WB 3A0VA 1FCMA 1TAFB 4ZJ1A 1PZRA 2ZC5B 3A0SA 1NWZA 4L0LA 1MZUA 4RA7A 3RXWA 3UDIA 4Z2GA 3H82A 3WAAD 5FAOA 2Y2JA 2NQBD 3NBLA 2WKIA 3TG9A 5BT1D 4R8PA 4L9EA 4N9LA 3KSIA 1P3PB 1PIOA 3UN7A 3LIBA 3QP8A 2RIQA 1M6KA 5CEDA 1F66C 2XK1A 4WU9C 3REJC 4KZ6A 2KOIA 4KENB 1EQZD 2CV5B 1CXWA 4KZ7A 3NI9A 1P3AB 3UY6A 1JTDA 4KQDA 5AV5B 2EA9A 1P3IB 4IBIA 2HDSA 4NKPA 4E45A 1NRFA 1IYPA 2YKHA 3E4PA 3O86A 4IBRA 1CF0A 4WF0A 4EBLA 5CPIC 3X1UB 3V3RA 4KGCA 4R3BA 2H28A 3C8CA 1M1AD 3VFHA 3MGQB 4E3LA 1P0ZA 4C75A 5B2JC 3LJAD 4UHUA 5FL3A 1BSGA 4LV1A 4NE3A 1GHMA 3HJKA 3AZNB 3WD2A 2XR0A 3VFFA 1PFLA 3MXQA 2JKRI 5B0YA 2ZQCA 3P5JB 4G91B 2QWSA 3BFGA 3WKJD 4KZAA 5F6AA 3B6GD 2NZDC 2L1MA 1KGFA 5B1MD 3UTAA 4QLCA 3IF6B 5JRGD 5HDCA 1KDWA 1S1ZA 5A91A 3ZFZA 2E8JA 1E3UA 3L27A 1ES5A 3ZVTA 5GT0A 4G3WA 4DE2A 2CC1A 1LL8A 5A92A 5EOEA 3SH9A 1NRJA 5F99C 5GLAA 3DTIA 3BFDA 3UE6A 4P6ZM 4PM5A 3UTBD 1S32A 1N9BA 2W3FA 3SS3A 2M7VA 2KLIA 2VV7A 1W79A 3B3XA 1J3WA 1E15A 1DP8A 2W1TB 3X1VD 4XZQB 1HZOA 3PBTA 1HTAA 3N7WA 3QHYA 4FTXA 4IBJA 3SS4A 1KX4D 1KX5A 1FQGA 2ZMVA 3AN2A 3AZIA 3AZKA 1ERMA 3GMWA 3KWQB 1O6IA 1DRMA 3AV1A 2ZC4B 3T4LA 4JJNA 3H0RC 3AZGA 3BJNA 4QHCA 2HIOA 3E2LA 4MBKA 3CJMA 4BENA 1VEUA 5FQMA 2W0NA 2EXBA 3A6NB 1K56D 1BUEA 4CQHA 1R4VA 2YFVB 5E5AB 3AZEC 4KZ4A 3REIC 1W8QA 3UPPA 1F66D 4WU9D 4E3IA 2V0UA 3MMHA 1JFIB 1YLPA 4MEZA 2PD8A 3P01A 2Y91A 4YS3A 1OTBA 2PU2A 4B88A 2Y2NA 3RXXA 5CPKC 4BD0A 2HDRA 4B93A 4QJGA 4GDBA 1GHIA 1YU1A 3T50A 5E2GA 1ZLAB 4IEDA 5F5YA 3AZJC 1W7FA 2IWCA 3EPHA 1E6RA 4NETA 2ZL1A 2J3WA 1YUEA 3G34A 2Q0OA 4Z2MG 4WU8C 4PAUA 5B2JD 2EWVA 3S22A 3KYQA 5G49B 4CAYB 1K54A 1SDNA 4E44A 4LPZA 3SZTA 1L0GA 2EWWA 4HNBA 4OONA 5AV6C 3P09A 3LZ1A 2J9PA 4JPMA 4FD8A 4J8VD 3ITBA 4WNNB 1LSXA 3HCYA 3W96C 3WS1A 3ZG8B 1TS7A 3VH5A 1ULYA 3KUYC 5HPIA 3MGPC 4R4RA 3AZMC 1P3BC 4CLCB 3MGRA 3Q7VA 4F3LA 1ESUA 4E6WA 4EUVA 3NOUC 2QYBA 5B32G 1FCNA 4OPQA 3REHB 3VH5T 5EFWA 5KIZA 3LI8A 4UUZB 1M19D 5IS1A 3BQ8A 4Z5TB 4E3KA 3CI6A 4NE5A 4HBUA 3UO9A 1YKDA 3M6BA 1PZOA 3HUMA 5KZHA 3V67A 2XDMA 5B1LD 1IELA 3L9KA 1U35B 5KDMA 1P3MA 3ZNTA 2XFSA 4KG5A 4PMAA 3G6OA 3IWQA 4Z66A 3WS2A 3Q07A 2INWA 3SH8A 2L5AA 1OJGA 3KS4A 2Q9MA 3B0DB 5B24A 4LD9C 2ZQ9A 2JKFA 3X1SA 1XX2A 2HGVA 1ES3A 1B67A 4ZTKA 4XUZA 3G31A 4OVDA 2Y2OA 3AZED 1OGBA 1K57A 3REID 3WS0A 1W63Q 4WU8B 1MXOA 5G18A 5B31A 4DJ3A 4BMWA 2Y2QA 4R8PD 1OT9A 4H9RB 2XA7S 1XGIA 5CPKD 1ZC2A 1VHMA 1K4EA 3N8SA 1UGUA 5CP6A 4ME4A 4HEFA 4C6YA 4YFMA 5IU1A 3B6FC 3W99A 3KUYB 2ZC7A 5EOOA 4OJOA 1LL5A 3Q81A 3IX4A 3MGSA 1H0GA 4DDSA 4QPRA 3N6IA 1DJCA 4E3OA 1YSPA 4HESA 2A24A 5CPJD 3PXPA 3E0YA 4HY8A 3UPOA 1F5MA 2HPBA 2Z6DA 4Y0OA 4QU3A 3QP4A 5DNNC 4X56A 5AV6D 4JGOA 3W4OA 3W98C 4X69A 1M18A 3MQOA 1W1PA 1P3KB 1QO6A 1Y54A 4GDNA 2GZAA 3CMZA 4NK3A 1TS0A 4A5RA 1O7EA 2PDRA 2EXAA 1ODVA 1ID3A 3MGPD 3BECA 3AZMD 1P3BD 2ZC3B 3NQUA 2XD5A 1T1CA 3D4FA 2WADA 3IXHA 5AVCA 2PR5A 5DFXA 4NZ1A 2J7VA 3IWOA 4K08A 4LFUA 4II7A 3E4QA 1AXBA 3NULA 4N9KA 3VE4A 5HX9A 4LD9B 1P97A 3AZFC 3UTAD 4QLCD 3MFXA 2ZOHA 4X1LA 3H7WB 1T1BA 1GCEA 3O62A 1E88A 5AQBA 3NC8A 1E3UD 5AY8B 5GT0D 4H6JA 3AZLC 4YINA 4J8UA 3AZHC 3T4QA 1NZOA 3VOYA 1G6OA 4CSRA 2XQZA 1H0MA 5A8BA 3BWLA 3X1TA 5HWTA 4DN0A 1XFQA 2O0YA 2R9XA 3AFAA 3MVDB 2Y79A 3LR4A 4Q8IA 1P3FC 3IX8A 4PM7A 5CECA 5G4YA 3KX0X 1CJFA 1D1JA 3PTEA 1TAFA 4X23C 2BYMB 2VGJA 4J8XC 1VM1A 4Y0UA 2HZ5A 2F8NB 5DNMD 3B6FB 1D7EA 1NY0A 5FUGB 4G92C 5EVIC 3C1CC 1KGGA 3AYWB 1P3GC 1P3PA 1O07A 3KO6A 1WA9A 3WWXA 3MQLA 3IQAA 4JJND 2QJ7A 5M18A 3AZGD 1P3AA 2V8FA 2J80A 3WD1A 2HIOD 5BS7A 5AV5A 3LR3A 3IBJA 5EPHA 1P3IA 2F8NH 4Z1WA 3DWKA 5HWWA 3LIDA 3EPKA 4LLOB 3C1BB 3ITAA 1P3OC 1NYMA 4IJGA 3O87A 1DP9A 4Y2FA 3X1UA 2IA2A 3W2ZA 4YS3D 5HFOA 4GCZA 3H9WA 3FYZA 1H8ZA 2JKTI 3IH8A 5EVLA 4WLAA 4ZRRA 4WZ5C 5CERA 3WTPC 3MGQA 2I72A 4EUZA 4LV0A 5DKLA 2WZZA 3AZNA 3LELC 3AZFB 3WRZA 4EEPA 1Y4OA 4QD4A 2H0TA 4M4XA 3W98D 3AZLB 2H10A 2DRWA 5BO0B 3REKC 3IF6A 1HQ3C 3V5MA 3T1RA 3B0CW 5FSRA 5HDDA 4Z2HA 3NDGA 3V39A 4EO5C 4I5SA 3WAAC 1YMXA 3RELB 2NQBC 5AVEA 5J4EA 5B33B 4KUKA 5DTTA 1UR8A 4J8XB 5GT3B 4MMNA 2A49A 1S67L 4G92B 5EVIB 1K38A 1KX3C 3S7QA 2VKSA 2HP9A 1EQZC 3HLGA 1JVJA 2V1BA 2P74A 3KS8A 1TD5A 2H0YA 3FWLA 5J8XA 3DTKA 3ZNYA 3TU4B 2W1TA 3LZ0C 4XZQA 1AIWA 2GJ3A 2W3DA 2ZM2A 4HP9A 5FEFA 5FQ9A 4ETZA 5AV8A 3HSHA 4Y5FA 5CHLB 1LT0A 1J9MA 3KWQA 2FJ7B 3KYZA 3PBRA 2HJ9C 2R9WA 1G6AA 1P3OB 5CTMA 1QMEA 4KG6A 2JE5A 5GSUB 1P3MD 3N8RA 3MNNB 2YFWA 3C1CD 4Z66D 4ZUXA 2VZWA 3A6NA 4HBTA 5L07A 3C4PA 1MPLA 4EESA 5E5AA 3OCLA 4NXFA 2IWBA 1K0KA 3LI9A 1TVFA 3PBOA 5B24D 4RX3A 1JFIA 4EXOA 3X1SD 2V0WA 2WAFA 3HLCA 1L0DA 2KDKA 5B40C 5GL9A 3ZG0A 1HD8A 3EPJA 2WKPA 5GXQC 3S7OA 2JN7A 4ID4A 3HLEA 1YM1A 4PKYA 4IBBA 5B31D 5JRGC 5AVBD 1WYBA 2Y59A 1GHPA 1ZLAA 1NXYA 2RCXA 3S4XA 1PRQA 4UAAA 4WUJA 4GD6A 2PYOA 3KXBC 4NXBA 2JKTM 3VMAA 3KYEA 4JKTA 5J3WA 2ZY3A 1X0OA 4DMZA 3WAAB 5G49A 4O0PA 3W99D 4UA6A 1LSWA 2NQBB 3EWKA 4Q0JA 4P6ZS 3OC2A 4BQMA 3ZG9B 3UTBC 3HLWA 4LCMA 3MGSD 1BLHA 2P08A 4H9SA 1VETB 1RP5A 4JF5A 4LV3A 2QKPA 4WNNA 1CEGA 4HI4A 3F1PB 3QNCA 1KX4C 3REKD 5HD5A 1D06A 1G28A 4UA9A 4CLCA 4JLFA 2DF4C 2HJEA 4CLCE 2OSUA 1ZKJA 2WUQA 3UMDA 4FOFA 2ZQ8A 4D60A 5M1AA 4EW7A 4OLDA 4RQ9A 1P34B 4IBDA 4YM6B 1CQAA 1OT6A 3REHA 3M2KA 4I3AA 3RJUA 2M7UA 1ID3D 1KS0A 3MKFA 4QB8A 2M1CA 3RFBA 3MXRA 4Z5TA 1M1AB 3FZCA 4MLLA 3IP4C 2WK0A 3QP2A 1KX3D 3QP6A 3LJAB 2WKRA 2MJ6A 1KOUA 4WN5A 5DTKA 4JF4A 4N1HA 3LZ0D 1U35A 4R38A 3IXDA 2PYPA 4JGPA 5AV9B 1OPXA 2HUEB 5B2IB 1YLYA 4HGAC 3WKJB 4OJ5A 4J8UD 2A3UA 4OPZA 4DE0A 4ZDXA 1HLUP 3B6GB 3X1TD 1VQQA 5B1MB 5JRGB 3Q82A 3AFAD 4G3VA 1SHVA 4NXGA 2V2FF 2XFTA 2ZJ9A 2QJ5A 3W97C 4MCWA 3R7WB 1E8BA 3T12B 2G7UA 1BLPA 1KDSA 2PD7A 4JF6A 4WMCA 4WU8A 3PYPA 2DQNC 4XUJD 2X71A 3P98A 5B40D 4S2LA 3H0LC 1MWTA 3UTBB 4J8VC 1P3PD 1PW8A 5GXQD 4J8WB 4NZ5A 4GD8A 4KUDA 4I38A 3X1VB 3ZCZA 1P3AD 3KUYA 3UB5P 3CITA 1Z6FA 3GSGA 4ARZB 1S4SA 2XROA 4DDYA 5AV5D 4EEUA 4EWFA 2CWEA 1GSXA 1YU4A 2P9VA 3OCNA 3SW1A 3KXBD 1OTDA 2OOLA 4Y3IA 3HUOA 4Y15A 3X1UD 2LB9A 3PAGA 1M19C 2RVQD 2OWJA 2V1ZA 3E98A 3OZHA 5CHMA 4KZ3A 1VB6A 1F66B 4LRXC 5GHYA 4WU9B 3REJB 5B1LC 1P3KA 2ACGA 3BFFA 3CPTB 2Q9NA 2IOUA 5CGXA 4NZ3A 1E6NA 3AZND 2W3EA 3IS2B 4ZJ2A 2W1RA 3D72A 5CPIB 3NQJB 2JBFA 4TX8A 4BD1A 1NLZA 3FPWA 4Z2MH 3LY4A 3GDIA 3KSHA 2WKHA 3H7WA 4WEKA 4H9PB 5FQQA 5AY8A 1PDCA 5B2JB 4U0TA 3MXSA 4R8PC 1SCWA 3MVDA 2DNSA 3L25A 4PHTA 1H3QA 3IH9A 4WV4B 1TF1A 4HOIA 1YLJA 4BLMA 4NXEA 2Y2MA 4GLQA 4RYEA 4S2NA 2NZDB 5EVEA 3EPLA 4JBFA 2Y55A 3WA9D 3IXGA 3EEAA 3B6FA 3E2KA 3ULFA 1AWIA 5FUGA 5AV8D 4IBFA 4BL3A 4CPKA 2OAP1 5I94A 3W97D 2X02A 3AYWA 5CPJC 5B32D 1DY6A 4L9FA 1MWUA 4R0QA 3MQ0A 1E6ZA 3UB9A 3MFDA 3AV2D 4KGCC 3DBAA 4D2OA 3JVVA 5CTNA 2VV8A 4BL2A 5F99B 5TBMB 5FI2A 3ZHHA 1P3LA 3G35A 2WAEA 3V50A 1V9ZA 4ZUXD 1ZHHB 4X53A 3A6ND 2IWDA 5EM0A 1L0FA 2HP5A 5TGFA 3C1BA 1N9NA 3LFVA 3ZQ5A 3EG5B 5B0YC 4M6BA 3GQZA 2B95A 3LEQA 3HONA 2D01A 3ZGAB 4QWOA 4QY5A 1TZYA 3B42A 5IT5A 2BG1A 2RTSA 2Y2KA 1S1YA 4S2MA 1H8YA 3UTAC 4QLCC 3WD0A 4XT2B 1F9IA 1ZLAD 4GHIB 3A3FA 3JPUA 3AZFA 5GT0C 1GXDA 2JC7A 3D3OA 2C5WB 2PYOD 4NFTA 4S2PA 3AZEB 3REIB 3A3DA 1E25A 4I3JA 3KSGA 3D9YA 3H82B 3I7JA 5BO0A 4H9OB 1S0WA 1AOIA 1LL9A 4R4SA 1S32C 5CPKB 4OP8A 1N1JB 3TE8A 1IYOA 4PKYG 2ZY2A 1LHYA 3BW6A 3MQQA 5GLCA 5DNMC 1XXMA 3RELA 3NCKA 1I2SA 5B33A 2JKGA 4J8XA 3AZJB 1KX5C 3AZIC 5EE8A 5GT3A 3AZKC 3QP1A 1CK7A 2Z6CA 1DP6A 3U4LP 5EVIA 2Y2PA 2FFYA 2UWXA 4BBTA 4GH9A 3AV1C 2J8PA 5CPJB 5F83A 5B0ZA 1KGEA 3MKEA 5BNVB 4JJNC 5C3IC 3LR5A 1KE0A 3RTYA 3AZGC 3G30A 1EROA 3C7VA 3MJQA 2HIOC 3TU4A 3OBFA 1YLWA 1LI9A 5AV6B 3G32A 3VP0A 3BY9A 4E04A 4Z5TD 1ES2A 2ZLYA 2Y2HA 2FJ7A 3W96B 4YS3C 1P3OA 1F2KA 3UB6A 3BLSA 5HDSA 3PBSA 2XD1A 3WS4A 2NUPC 1U35D 4EBNA 3MGPB 3UT9A 4IBGA 1H3OB 5GSUA 3AZMB 1P3BB 3MNNA 3BQAA 4H9QA 4WJ3C 5CGSA 5BOHA 1U60A 2Z2LB 4KG2A 2JCHA 5DFYA 2ZM0A 4K0WA 3MSHA 3SH7A 4KGCD 3WTPE 3CZDA 3UTAB 2AROA 4MBFA 1Z09A 5CX7A 1BFMA 4DRBA 2PU4A 4NYUA 3N4IA 3VE3A 2XRNA 1K54C 4HIAA 3V9RB 2PR6A 1FR1A 1K6SA 4EERA 1OJ5A 5B0YD 3P7NA 1W5DA 3LZ1C 3ZG5A 3U2AA 4MBHA 3K3CA 4BBUA 1H0IA 4KUOA 1CI8A 3L7HA 2HF6A 1TEMA 4GW9A 3BFCA 4HJ3A 4KUDD 2G2WA 5AJGA 2PBDP 3MGRC 5DNMB 2NQBA 1GPFA 3FDDA 2GDNA 3T1XA 5BNXA 4LCLA 1OMEA 3HLDA 4R6LA 3MR0A 1VETA 4MDZA 3VP2A 5AQ7A 3IF5A 1T3UA 4QY6A 3F1PA 4JJNB 5E2HA 1N9OA 4EETB 3N3FA 5HAPA 3GECA 3DTEA 1S32D 3VP1A 5FQKA 4H9NB 4L9GA 3B0BA 3TRCA 4HJ6A 3PBQA 2VV6A 1P3KD 1P34A 5HAIA 4YM6A 2BYKB 3A3EA 1P3MC 3O5YA 2OLVA 4UQIM 2VQRA 1KX5D 3VH6A 1IKIA 3AN2D 3AZID 4Z66C 3AZKD 2VEAA 5F82A 1M1AA 3EGDC 5E2FA 1MBLA 3AV1D 5B24C 4OUIA 1H8MA 3RH8B 1FSWA 4ZBJC 3LJAA 3X1SC 2CV5A 5F1GA 5E43A 5JA4B 2VGLM 5J7EA 3VH6T 5DNNB 2A2LA 2H5SA 5DJTA 5AV9A 3VH5W 5B2IA 3W98B 1K57C 5FA7A 3WKJA 1NJ4A 5DTSA 5EV0A 5FEGA 1JWZA 5B31C 5AVBC 4JGRA 1MC0A 3B6GA 3G2ZA 2PRFA 4MB4A 2EX6A 4K91A 5B1MA 4OJLA 3MVDD 3HJIA 2D02A 4IUHA 4IBCA 4FH4A 4LG2A 1IKGA 3R7WA 5CP6C 2IO5C 5L10A 3T1SA 3W99C 3UE3A 3LEZA 1KE4A 3WX7A 1K55C 1XKZA 3MGSC 4KQQA 5EUAA 1GA0A 3UE1A 1SDEA 1XJ4A 3MZEA 3UTBA 5FASA 3GR2A 4J8WA 3AZHB 3ZDJA 3VP4A 4AWLC 5EECA 2P04A 4GNUA 2ZBBA 3X1VA 4DJ2A 2P7JA 1P3LD 1BH9B 3M6HA 4ARZA 2VJWA 3LZ1D 1PZPA 1P3FB 1M18C 1Q2QA 4G3KA 1M40A 4E3JA 4O7DA 1ERQA 4X23B 1GSWA 1ID3C 2F8NG 1PYYA 3EGXC 5KDMB 3MGRD 2ZMAA 5AVCC 3NY4A 3C1CB 3OPLA 3UDXA 1P3GB 1TZYD 1OGGA 1JTGA 1W1VA 1UWPX 4HMCA 1F66A 4XXRA 4WU9A 3REJA 4O01A 4IJEA 5JYOA 4ZBJB 3B33A 3CPTA 3O62C 5HWVA 3CUEC 4HMEA 5U47A 3NOPC 1G5UA 4J8UC 4GS9B 1S4RA 4N92A 1FSYA 4OQHA 3UB7A 1NYYA 1MWSA 1S66L 4OH0A 5CPIA 3X1TC 3NQJA 5AVBB 3AFAC 1AOID 5TJJA 5CRFA 1PI4A 4DXCA 3AGFA 4H9PA 2YFVA 3F1NB 2VK3A 3WTPB 3BY8A 3T4SA 2IO5B 5B2JA 4XUJC 2ZQ7A 3RELD 3W99B 2JSSA 3UDFA 1ED7A 4WZ4A 5B33D 3LELB 5GT3D 1P3PC 4F3LB 4HMDA 5CEBA 4GOGA 5L2FA 3R4KA 1I5QA 2B18A 2ZMFA 3DAVA 5B0ZD 2ZQAA 2Y2IA 3FKWA 1P3AC 2NZDA 4AWLB 5BS7C 3REKB 5CXWA 5AV5C 5FATA 4R3AA 1HQ3B 1YPRA 4NG2A 4ZAMA 3PR6A 5HD3A 1ZG4A 4S2OA 3R45B 3FC7A 5CP6D 3W4QA 4YOFA 2EX2A 3X1UC 4EO5B 2RVQC 3WD4A 4CAYA 4U3TA 5M19A 2OWHA 3F1OB 3UT9D 1TS8A 5F99A 5TBMA 3NQUB 1PI5A 3JYIA 1KX3B 4GHAA 1CEFA 3MGQC 4JXWA 4UA7A 2ZM5A 4KHAB 2J8YA 2XH9A 2AVXA 1EQZB 2XLNA 1MWRA 4DE3A 3AZNC 1XFNA 3AL0C 3LZ0B 2AROD 2PAVP 3VSKA 4G91C 4P6BA 3BFEA 3CG5A 1YT4A 1M18D 4H6JB 1BH8B 1MKIA 2W3GA 2V9AA 3TJZC 4NZ4A 3IF6C 4XT2A 4UUZA 1ONHA 4LV2A 4GHIA 1XJ6A 3WS5A 4Z2JA 4GZBA 4PM6A 5AVCD 1TS6A 2Y8HA 3BRMA 5CHJA 4X6TA 4EBPA 4MN6A 3AZEA 3REIA 4MNRA 4XUJB 3CHWP 5IHVA 5B40B 3O62D 5HAQA 4H9OA 2G5HC 3EEHA 1T1AA 4BJPA 3Q7ZA 5CPKA 5GXQB 1N1JA 4ZBEA 4Y17A 3OPPA 1T19A 2GX5A 3UPNA 5HPFA 2ZQDA 4XZQC 2K2NA 4IUKA 3WA9C 4NYYA 5AV8C 3AZJA 3OPRA 1S6RA 5B32C 3WRTA 3EOIA 3N8LA 3KWQC 4Q0IA 2XEPA 3KXBB 4HH3A 4OQ0A 2DMWA 1I2WA 5CPJA 3AV2C 2ZC6B 2VX8A 5BNVA 1P34D 4YM6D 1LSVA 2V20A 3HBRA 4H9RA 4ZUXC 5AV6A 3A6NC 1NLYA 2FH5A 4AFIA 5E5AC 4Y13A 2J3TD 2PBYA 1W1YA 3W96A 2CV5D 4OP5A 4OOYA 5HZHA 1KX4B 3MGPA 1P3ID 1H3OA 3AZMA 1P3BA 2EX9A 3BEBA 5AV9D 3DWZA 4GN2A 4KZ5A 5TR7A 3A3IA 5B2ID 4N1XA 3A0RA 5BPVA 4R23A 3T1QB 1ZLAC 5I5LA 3O3VA 2PYOC 1EAKA 3G2YA 4C3QA 1OTEA 1W2EA 2F8NK 2ZY4A 1DJAA 3MGQD 2E8IA 3V9RA 4OPRA 2WGVA 3UNWA 4R70A 5E2EA 4IJFA 3NHQA 4H9SC 1SKOB 5MC7A 2ZM8A 4YNRA 5CGWA 3ZG7B 4HGAB 2QPNA 4J8WD 1XPBA 2FN2A 3OOVA 4LD9A 4CLCC 4O8GA 3WA9B 5DNMA 1GA9A 5F69A 3PBNA 5AV8B 1FOFA 3AGDA 1IFQA 3W97B 3AGEA 5B32B 3EQUA 5HSQA 4WYYA 3REHC 3MF0A 1TDLA 1FILA 4IBEA 3ICYA 3AV2B 1E4DA 4Z5TC 2YFWB 4RVAA 2FZ0A 1SZVA 5KMWA 4ZUXB 4J8VB 4I39A 4H9NA 3FG8A 4K0XA 2BYMA 4Z2LA 3W4PA 1YU3A 3REJD 1U35C 4XZQD 2LB5A 2F8NA 2BYKA 2V5OA 4WEJA 4R1GA 4DQYB 2G2UA 4UPKA 1N9LA 3W8KA 3KWQD 1ALQA 4P0MA 2NUTC 2R78A 3B0DC 1BZAA 2WZXA 2EFXA 1XP4A 5CPID 3T4KA 2HDUA 5A90A 1T18A 3H0MC 3ZYTA 1IEMA 1M19B 1LLBA 5JA4A 1A0KA 3S7NA 2L0WA 5DNNA 3HUNA 4ZJ3A 2PYOB 1CK3A 1W1TA 5GLBA 3UE0A 1BT5A 5E5AD 3K3DA 1Z2CB 4FCFA 3W98A 1IYQA 4E3NA 3C2WA 4Y7PA 5B1LB 2WGWB 4S2IA 5KSHA 4IVKA 1Q2PA 5HL6A 3T4JA 3JVUA 2UV0E 3LCEA 1WWIA 3LGOA 2XF3A 3K2NA 2JKRM 1XGJA 4KUDC 4MB5A 2VLGA 2BASA 4PM8A 4PPRA 2XGNA 3VOLA 1JWPA 3TW8A 2NZDD 2O9AA 2VA0A 3UMEA 2W3HA 2ZY5A 1MY8A 4IVIA 2W27A 4WL9A 4OOLA 5FQJA 2V8CA 3AZLA 2Z2MB 3AZHA 4HQAA 2B02A 3A1IA 4I3IA 4R8PB 5L09A 5F99D 1V9YA 3QNBA 2B5RA 5FDSA 3A3JA 1BH9A 2Y2GA 1XJ3A 1P3FA 2WGIA 4WELA 1P3KC 4WZSB 4HP4A 4X23A 4IHQA 3V3SA 4FH2A 2WYXA 1YQSA 3AN2C 4UQIS 4CLCD 3ZVWA 3S1YA 1WWSA 1EWZA 4JXSA 2PYRA 3CLOA 1ESIA 3C1CA 3F6TA 5LBRA 1P3GA 4S2JA 1LI0A 4KZ9A 3REHD 1FCOA 3LICA 3IBRA 4HH2A 2VGLS 5AQ9A 4KGCB 3GTCA 4BBVA 1W63M 4Z9QA 5DF7A 1P9RA 4OKPA 5AY8C 2K7SA 4YWZA 3L28A 4GS9A 4E6XA 3HLBA 1H5XA 1EI5A 3B0CT 1B6WA 1KU5A 3PHYA 5AVBA 3IHAA 3MVDC 3FPVA 5B0YB 3KSYA 3L2AA 4B9OA 4LRZE 2RL3A 2K31A 2EFUA 4NEED 3F1NA 3T4TA 3KFUG 4S2NC 4WZ5A 3WD3A 3WTPA 1STZA 4B4ZA 4KUDB 3LUQA 4Q0HA 1YU2A 4QLCB 3GVBA 3HVFA 4ESPA 4WBGA 3AZJD 4FSFA 3LELA 1K55A 3L29A 5GT0B 3AYWC 2P9VB 3E4OA 3G4PA 1YAXA 3FKVA
chains in the Genus database with same CATH topology
3C7UA 2X01A 3Q1FA 5F1FA 4WMCD 4WU8D 2QZ6A 2DCFA 3BYDA 5FAPA 3A1KA 1P3LC 3REKA 1S32B 3BM6A 1FR6A 1HQ3A 3NIAA 1KVMA 1ZG6A 3R45A 3C1BC 1PW1A 4M3KA 3W96D 3WAAA 1IYSA 5FDHA 3KUYD 1RCJA 1KX5B 5A93A 3AN2B 3AZIB 1L2SA 2QMIA 4OLGA 3AZKB 1TZYC 3BLMA 1A7WA 1KX3A 3AV1B 2FFFB 4KHAA 1EQZA 5C3IB 3AZGB 4GB7A 2HIOB 4IBKA 5GHZA 1ES4A 3GRJA 3LZ0A 2BLSA 1YLTA 5CHUA 3SOIA 1WE4A 1BH8A 4DKIA 4S2KA 4YS3B 2HP6A 4DE1A 1AOIC 4OOMA 4QNLA 3MBZA 4U0XA 1RGZA 1ONGA 1TDGA 4P85A 3O88A 3RELC 3L26A 3HL9A 5B33C 4LD9D 4OQIA 4XUJA 4DRTA 5GT3C 5FI6A 5B40A 4H8RA 2OV5A 4JXVA 1BLCA 4B4XA 5AY8D 3M2JA 3HREA 5B0ZC 5GXQA 5FAQA 4F94A 1W8YA 2Y2LA 3TU4C 4XUXA 3IXBA 5JRGA 5GHXA 3OPHA 2Y4AA 1P3LB 5JYPA 3LZ1B 1DJBA 1RGYA 1K6RA 4GHLA 3EQVA 3C5AA 2FJ7C 3KXBA 4RX2A 3UT9C 2F8ND 5GSUC 3MGRB 3MNNC 3B6FD 3Q7VB 4EQIA 5DVAA 3IWIA 4GKUA 4R3JA 3AYWD 1YU0A 1BLSA 1YMSA 4OPYA 1TZYB 2J9OA 4PM9A 1QMFA 3DTMA 1PWCA 2LY8A 5HL1A 3HLFA 2AROC 4LENA 1N4OA 4CJNA 3TSGA 5DF9A 2HDQA 1KX4A 5DNND 3C1BD 5AQAA 3VSLA 4E3MA 1C3BA 3FKEA 1P3MB 3VOZA 2ZD8A 1AOIB 3LO7A 1CI9A 4Z66B 1K56A 1KE3A 3FV7A 1BTLA 5B24B 3IHBA 3X1SB 4X68A 4KZ8A 2F2AC 5BT1C 1HVBA 3AZFD 4OQGA 3LY3A 4KQRA 3AZLD 5B0ZB 3AZHD 5B31B 1G68A 1WYCA 2EX8A 1PWDA 3WA9A 3DW0A 5FI7A 1YLZA 2WKEA 1NZUA 1P3FD 3W97A 5CP6B 5B32A 4X55A 3SS5A 1P34C 4YM6C 5DF8A 4X23D 3AV2A 4J8XD 4EV4A 4OJ6A 3UT9B 3MGSB 4DRAA 3MZDA 5HW3A 5EVID 1M1AC 4H9QB 4KQOA 4J8VA 3C4OA 1P3GD 3LJAC 2CV5C 3VP3A 4NY2A 1Q9CA 1SKFA 3GV9A 3TU4D 1P3IC 2AROB 5AV9C 2HUEC 1L0EA 5B2IC 1M18B 5TFQA 3WKJC 1BULA 3PAEA 4DXBA 2FJ7D 3MZFA 1XA1A 3B6GC 1HTZA 1P3OD 5D3OA 5B1MC 4DF6A 1M19A 1ID3B 2G5IC 5GSUD 3MNND 5FQIA 5AVCB 4IBXA 1XA7A 4OJPA 5HARA 1KVLA 2W8SA 1JWVA 1F1EA 3WTPD 4KZBA 4P87A 2VGKA 1K4FA 5B1LA 2WGWA 4WM9A 5GLDA 3TOIA 3O62B 5BNXB 3LELD 4Y0TA 3NDEA 3IT9A 4J8WC 4J8UB 2OLUA 5KSCA 4CSRB 4NE6A 3X1TB 3VH6W 1PWGA 5B31G 3X1VC 3AFAB 1K25A 4JXGA 3ISGA 1HQ3D 2C6WB 1FCMA 1TAFB 4ZJ1A 1PZRA 2ZC5B 4L0LA 4RA7A 3RXWA 3UDIA 3WAAD 5FAOA 2Y2JA 2NQBD 3NBLA 2WKIA 3TG9A 5BT1D 4R8PA 4N9LA 1P3PB 1PIOA 3UN7A 2RIQA 1M6KA 5CEDA 1F66C 2XK1A 4WU9C 3REJC 4KZ6A 4KENB 1EQZD 2CV5B 4KZ7A 3NI9A 1P3AB 3UY6A 1JTDA 5AV5B 1P3IB 4IBIA 2HDSA 4E45A 1NRFA 1IYPA 3O86A 4IBRA 4EBLA 5CPIC 3X1UB 3V3RA 4KGCA 4R3BA 1M1AD 3VFHA 3MGQB 4E3LA 4C75A 5B2JC 3LJAD 4UHUA 1BSGA 4LV1A 4NE3A 1GHMA 3AZNB 2XR0A 3VFFA 5B0YA 2ZQCA 3P5JB 4G91B 3BFGA 3WKJD 4KZAA 3B6GD 2NZDC 1KGFA 5B1MD 3UTAA 4QLCA 3IF6B 5JRGD 1KDWA 5A91A 3ZFZA 1E3UA 3L27A 1ES5A 3ZVTA 5GT0A 4DE2A 2CC1A 5A92A 5EOEA 3SH9A 5F99C 5GLAA 3BFDA 4PM5A 3UTBD 1S32A 1N9BA 3SS3A 1W79A 3B3XA 3X1VD 4XZQB 1HZOA 3PBTA 1HTAA 3N7WA 3QHYA 4IBJA 3SS4A 1KX4D 1KX5A 1FQGA 3AN2A 3AZIA 3AZKA 1ERMA 3GMWA 3KWQB 3AV1A 2ZC4B 4JJNA 3H0RC 3AZGA 4QHCA 2HIOA 3E2LA 4MBKA 3CJMA 4BENA 5FQMA 2EXBA 3A6NB 1K56D 1BUEA 1R4VA 2YFVB 5E5AB 3AZEC 4KZ4A 3REIC 1W8QA 3UPPA 1F66D 4WU9D 4E3IA 1JFIB 1YLPA 4MEZA 2Y91A 4YS3A 2PU2A 4B88A 2Y2NA 3RXXA 5CPKC 4BD0A 2HDRA 4QJGA 4GDBA 1GHIA 1YU1A 5E2GA 1ZLAB 4IEDA 3AZJC 1W7FA 2IWCA 3EPHA 4NETA 1YUEA 3G34A 4Z2MG 4WU8C 5B2JD 3S22A 5G49B 4CAYB 1K54A 1SDNA 4E44A 1L0GA 4OONA 5AV6C 3P09A 3LZ1A 2J9PA 4JPMA 4FD8A 4J8VD 3ITBA 4WNNB 3W96C 3WS1A 3ZG8B 3VH5A 1ULYA 3KUYC 3MGPC 4R4RA 3AZMC 1P3BC 3MGRA 3Q7VA 1ESUA 4E6WA 5B32G 1FCNA 4OPQA 3REHB 3VH5T 4UUZB 1M19D 4Z5TB 4E3KA 4NE5A 4HBUA 3UO9A 3M6BA 1PZOA 3HUMA 5KZHA 2XDMA 5B1LD 1IELA 1U35B 5KDMA 1P3MA 3ZNTA 2XFSA 4KG5A 4PMAA 3IWQA 4Z66A 3WS2A 3Q07A 3SH8A 2L5AA 3KS4A 2Q9MA 3B0DB 5B24A 4LD9C 2ZQ9A 3X1SA 1XX2A 1ES3A 1B67A 4ZTKA 4XUZA 3G31A 4OVDA 2Y2OA 3AZED 1K57A 3REID 3WS0A 4WU8B 1MXOA 5G18A 5B31A 2Y2QA 4R8PD 4H9RB 1XGIA 5CPKD 1ZC2A 1K4EA 3N8SA 5CP6A 4HEFA 4C6YA 4YFMA 3B6FC 3W99A 3KUYB 2ZC7A 5EOOA 4OJOA 1LL5A 3Q81A 3MGSA 4DDSA 3N6IA 1DJCA 4E3OA 4HESA 5CPJD 3UPOA 2HPBA 4Y0OA 4QU3A 5DNNC 4X56A 5AV6D 3W4OA 3W98C 4X69A 1M18A 1P3KB 1Y54A 4GDNA 3CMZA 4NK3A 4A5RA 1O7EA 2EXAA 1ID3A 3MGPD 3BECA 3AZMD 1P3BD 2ZC3B 3NQUA 2XD5A 3D4FA 2WADA 3IXHA 5AVCA 4NZ1A 2J7VA 3IWOA 1AXBA 4N9KA 5HX9A 4LD9B 3AZFC 3UTAD 4QLCD 1GCEA 3O62A 5AQBA 3NC8A 1E3UD 5AY8B 5GT0D 3AZLC 4YINA 4J8UA 3AZHC 1NZOA 3VOYA 4CSRA 2XQZA 3X1TA 2R9XA 3AFAA 3MVDB 4Q8IA 1P3FC 4PM7A 5CECA 3PTEA 1TAFA 4X23C 2BYMB 2VGJA 4J8XC 1VM1A 4Y0UA 2F8NB 5DNMD 3B6FB 1NY0A 5FUGB 4G92C 5EVIC 3C1CC 1KGGA 3AYWB 1P3GC 1P3PA 1O07A 3WWXA 3IQAA 4JJND 5M18A 3AZGD 1P3AA 2HIOD 5BS7A 5AV5A 5EPHA 1P3IA 2F8NH 3DWKA 3EPKA 3C1BB 3ITAA 1P3OC 1NYMA 3O87A 3X1UA 4YS3D 5HFOA 3FYZA 1H8ZA 3IH8A 5EVLA 5CERA 4WZ5C 3WTPC 3MGQA 2I72A 4EUZA 4LV0A 2WZZA 3AZNA 3LELC 3AZFB 3WRZA 4QD4A 2H0TA 3W98D 3AZLB 2H10A 2DRWA 5BO0B 3REKC 3IF6A 1HQ3C 3V5MA 3B0CW 5FSRA 3NDGA 3V39A 4EO5C 3WAAC 1YMXA 3RELB 2NQBC 5B33B 5DTTA 4J8XB 5GT3B 2A49A 4G92B 5EVIB 1K38A 1KX3C 2HP9A 1EQZC 3HLGA 1JVJA 2P74A 3KS8A 2H0YA 3FWLA 5J8XA 3ZNYA 3TU4B 3LZ0C 4XZQA 2ZM2A 5FQ9A 5AV8A 3HSHA 5CHLB 1J9MA 3KWQA 2FJ7B 3PBRA 2R9WA 1G6AA 1P3OB 5CTMA 1QMEA 4KG6A 2JE5A 5GSUB 1P3MD 3N8RA 3MNNB 2YFWA 3C1CD 4Z66D 4ZUXA 3A6NA 4HBTA 3C4PA 1MPLA 5E5AA 3OCLA 2IWBA 1TVFA 3PBOA 5B24D 4RX3A 1JFIA 3X1SD 2WAFA 3HLCA 1L0DA 5B40C 5GL9A 3ZG0A 1HD8A 3EPJA 5GXQC 4ID4A 3HLEA 1YM1A 4IBBA 5B31D 5JRGC 5AVBD 1WYBA 2Y59A 1GHPA 1ZLAA 1NXYA 2RCXA 3S4XA 4UAAA 4GD6A 2PYOA 3KXBC 3VMAA 4JKTA 2ZY3A 3WAAB 5G49A 4UA6A 3W99D 2NQBB 3OC2A 4BQMA 3ZG9B 3UTBC 3HLWA 4LCMA 3MGSD 1BLHA 4H9SA 1RP5A 4JF5A 4LV3A 4WNNA 1CEGA 3QNCA 1KX4C 3REKD 4UA9A 4JLFA 2DF4C 2OSUA 1ZKJA 2WUQA 2ZQ8A 5M1AA 4OLDA 1P34B 4IBDA 4YM6B 3M2KA 3RJUA 3REHA 1ID3D 3MKFA 4QB8A 3MXRA 4Z5TA 3FZCA 1M1AB 4MLLA 2WK0A 3IP4C 1KX3D 3LJAB 5DTKA 4JF4A 4N1HA 3LZ0D 1U35A 3IXDA 5AV9B 2HUEB 5B2IB 1YLYA 4HGAC 3WKJB 4OJ5A 4J8UD 2A3UA 4OPZA 4DE0A 4ZDXA 3B6GB 3X1TD 1VQQA 5B1MB 5JRGB 3Q82A 3AFAD 1SHVA 2V2FF 2XFTA 2ZJ9A 3W97C 1BLPA 1KDSA 4JF6A 4WMCA 4WU8A 2DQNC 4XUJD 2X71A 3P98A 5B40D 4S2LA 3H0LC 1MWTA 3UTBB 4J8VC 1P3PD 1PW8A 5GXQD 4J8WB 4NZ5A 4GD8A 4KUDA 3X1VB 3ZCZA 1P3AD 3KUYA 3GSGA 1Z6FA 4DDYA 5AV5D 4EWFA 2CWEA 1YU4A 2P9VA 3OCNA 3KXBD 3HUOA 3X1UD 3PAGA 1M19C 2RVQD 2V1ZA 3OZHA 5CHMA 4KZ3A 1F66B 5GHYA 4WU9B 3REJB 5B1LC 1P3KA 3BFFA 5CGXA 2Q9NA 2IOUA 4NZ3A 3AZND 4ZJ2A 5CPIB 3NQJB 2JBFA 4BD1A 4Z2MH 3LY4A 2WKHA 4WEKA 4H9PB 5FQQA 5AY8A 5B2JB 4U0TA 3MXSA 4R8PC 1SCWA 3MVDA 2DNSA 3L25A 3IH9A 4WV4B 1YLJA 4BLMA 2Y2MA 4RYEA 4S2NA 2NZDB 3EPLA 4JBFA 2Y55A 3WA9D 3IXGA 3B6FA 3E2KA 5FUGA 5AV8D 4IBFA 4BL3A 4CPKA 5I94A 3W97D 2X02A 3AYWA 5CPJC 5B32D 1DY6A 1MWUA 4R0QA 3MFDA 3AV2D 4KGCC 4D2OA 5CTNA 4BL2A 5F99B 5FI2A 3ZHHA 1P3LA 3G35A 2WAEA 3V50A 4ZUXD 4X53A 3A6ND 2IWDA 1L0FA 2HP5A 5TGFA 3C1BA 3EG5B 5B0YC 4M6BA 3GQZA 3HONA 3ZGAB 4QY5A 1TZYA 2BG1A 2Y2KA 4S2MA 1H8YA 3UTAC 4QLCC 1ZLAD 3A3FA 3AZFA 5GT0C 2JC7A 2C5WB 2PYOD 4NFTA 4S2PA 3AZEB 3REIB 3A3DA 1E25A 3I7JA 5BO0A 4H9OB 1S0WA 1AOIA 1LL9A 4R4SA 1S32C 5CPKB 4OP8A 1N1JB 1IYOA 2ZY2A 1LHYA 5GLCA 5DNMC 1XXMA 3RELA 3NCKA 1I2SA 5B33A 4J8XA 3AZJB 1KX5C 3AZIC 5EE8A 5GT3A 3AZKC 5EVIA 2Y2PA 2FFYA 2UWXA 4GH9A 3AV1C 2J8PA 5CPJB 5F83A 5B0ZA 1KGEA 3MKEA 5BNVB 4JJNC 5C3IC 1KE0A 3AZGC 3G30A 1EROA 3C7VA 2HIOC 3TU4A 1YLWA 1LI9A 5AV6B 3G32A 3VP0A 4Z5TD 1ES2A 2ZLYA 2Y2HA 2FJ7A 3W96B 4YS3C 1P3OA 3BLSA 3PBSA 2XD1A 3WS4A 1U35D 4EBNA 3MGPB 3UT9A 4IBGA 1H3OB 5GSUA 3AZMB 1P3BB 3MNNA 4H9QA 4WJ3C 5CGSA 5BOHA 1U60A 2Z2LB 4KG2A 2JCHA 2ZM0A 4K0WA 3SH7A 4KGCD 3WTPE 3CZDA 3UTAB 2AROA 4MBFA 1BFMA 4DRBA 2PU4A 4NYUA 3N4IA 1K54C 3V9RB 1FR1A 1K6SA 5B0YD 1W5DA 3LZ1C 3ZG5A 4MBHA 1CI8A 1TEMA 3BFCA 4KUDD 2G2WA 3MGRC 5DNMB 2NQBA 3FDDA 2GDNA 5BNXA 4LCLA 1OMEA 3HLDA 3VP2A 5AQ7A 3IF5A 1T3UA 4QY6A 4JJNB 5E2HA 3N3FA 5HAPA 3VP1A 1S32D 5FQKA 4H9NB 3B0BA 3PBQA 1P3KD 1P34A 5HAIA 4YM6A 2BYKB 3A3EA 1P3MC 2OLVA 2VQRA 1KX5D 3VH6A 1IKIA 3AN2D 3AZID 4Z66C 3AZKD 5F82A 1M1AA 5E2FA 1MBLA 3AV1D 5B24C 4OUIA 1FSWA 4ZBJC 3LJAA 3X1SC 2CV5A 5F1GA 5E43A 5JA4B 3VH6T 5DNNB 2H5SA 5AV9A 3VH5W 5B2IA 3W98B 1K57C 5FA7A 3WKJA 1NJ4A 5DTSA 1JWZA 5B31C 5AVBC 3B6GA 3G2ZA 2EX6A 4K91A 5B1MA 4OJLA 3MVDD 4IBCA 4FH4A 4LG2A 1IKGA 5CP6C 2IO5C 3W99C 3UE3A 3LEZA 1KE4A 3WX7A 1K55C 1XKZA 3MGSC 4KQQA 5EUAA 1GA0A 3UE1A 1SDEA 3MZEA 5FASA 3UTBA 3GR2A 4J8WA 3AZHB 3ZDJA 3VP4A 4AWLC 5EECA 4GNUA 3X1VA 1P3LD 1BH9B 3M6HA 3LZ1D 1PZPA 1P3FB 1M18C 1Q2QA 1M40A 4E3JA 4O7DA 1ERQA 4X23B 1ID3C 2F8NG 1PYYA 5KDMB 3MGRD 2ZMAA 5AVCC 3NY4A 3C1CB 3OPLA 3UDXA 1P3GB 1TZYD 1JTGA 1F66A 4XXRA 4WU9A 3REJA 4IJEA 5JYOA 4ZBJB 3O62C 5U47A 4J8UC 4N92A 1FSYA 4OQHA 1NYYA 1MWSA 4OH0A 5CPIA 3X1TC 3NQJA 5AVBB 3AFAC 1AOID 5CRFA 1PI4A 4DXCA 3AGFA 4H9PA 2YFVA 3WTPB 2IO5B 5B2JA 4XUJC 2ZQ7A 3RELD 3W99B 2JSSA 3UDFA 4WZ4A 5B33D 3LELB 5GT3D 1P3PC 5CEBA 4GOGA 5L2FA 1I5QA 5B0ZD 2ZQAA 2Y2IA 3FKWA 1P3AC 2NZDA 4AWLB 5BS7C 3REKB 5CXWA 5AV5C 5FATA 1HQ3B 4ZAMA 1ZG4A 4S2OA 3R45B 5CP6D 3W4QA 2EX2A 3X1UC 4EO5B 2RVQC 4CAYA 4U3TA 5M19A 3UT9D 5F99A 3NQUB 1PI5A 3JYIA 1KX3B 4GHAA 1CEFA 3MGQC 4JXWA 4UA7A 2ZM5A 4KHAB 2J8YA 2XH9A 1EQZB 2XLNA 1MWRA 4DE3A 3AZNC 3AL0C 3LZ0B 2AROD 3VSKA 4G91C 4P6BA 3BFEA 3CG5A 1YT4A 1M18D 1BH8B 1MKIA 4NZ4A 3IF6C 4UUZA 1ONHA 4LV2A 3WS5A 4GZBA 4PM6A 5AVCD 3BRMA 5CHJA 4X6TA 4EBPA 3AZEA 3REIA 4MNRA 4XUJB 5IHVA 5B40B 3O62D 5HAQA 4H9OA 2G5HC 4BJPA 3Q7ZA 5CPKA 5GXQB 1N1JA 4ZBEA 3OPPA 3UPNA 2ZQDA 4XZQC 3WA9C 4NYYA 5AV8C 3AZJA 3OPRA 1S6RA 5B32C 3WRTA 3N8LA 3KWQC 2XEPA 3KXBB 4OQ0A 1I2WA 5CPJA 3AV2C 2ZC6B 5BNVA 1P34D 4YM6D 2V20A 3HBRA 4H9RA 4ZUXC 5AV6A 3A6NC 5E5AC 2PBYA 3W96A 2CV5D 4OP5A 4OOYA 1KX4B 3MGPA 1P3ID 1H3OA 3AZMA 1P3BA 2EX9A 3BEBA 5AV9D 3DWZA 4GN2A 4KZ5A 5TR7A 3A3IA 5B2ID 4N1XA 5BPVA 4R23A 1ZLAC 3O3VA 2PYOC 3G2YA 4C3QA 1W2EA 2F8NK 2ZY4A 1DJAA 3MGQD 2E8IA 3V9RA 4OPRA 2WGVA 3UNWA 5E2EA 4IJFA 4H9SC 2ZM8A 5CGWA 3ZG7B 4HGAB 2QPNA 4J8WD 1XPBA 4LD9A 3WA9B 5DNMA 1GA9A 3PBNA 5AV8B 1FOFA 3AGDA 3W97B 3AGEA 5B32B 3EQUA 4WYYA 3REHC 1TDLA 4IBEA 3AV2B 1E4DA 4Z5TC 2YFWB 4RVAA 5KMWA 4ZUXB 4J8VB 4H9NA 4K0XA 2BYMA 3W4PA 1YU3A 3REJD 1U35C 4XZQD 2F8NA 2BYKA 4WEJA 4R1GA 4DQYB 2G2UA 4UPKA 3W8KA 3KWQD 1ALQA 4P0MA 3B0DC 1BZAA 2WZXA 2EFXA 1XP4A 5CPID 5A90A 2HDUA 3H0MC 1IEMA 1M19B 1LLBA 5JA4A 5DNNA 3HUNA 4ZJ3A 2PYOB 1CK3A 5GLBA 3UE0A 1BT5A 5E5AD 4FCFA 1Z2CB 4E3NA 3W98A 1IYQA 4Y7PA 5B1LB 2WGWB 4S2IA 5KSHA 4IVKA 1Q2PA 3LCEA 1WWIA 2XF3A 1XGJA 4KUDC 4PM8A 4PPRA 2XGNA 1JWPA 2NZDD 2ZY5A 1MY8A 4IVIA 4OOLA 5FQJA 3AZLA 2Z2MB 3AZHA 3A1IA 4R8PB 5F99D 3QNBA 2B5RA 3A3JA 1BH9A 2Y2GA 1P3FA 2WGIA 4WELA 1P3KC 4WZSB 4X23A 3V3SA 4FH2A 2WYXA 1YQSA 3AN2C 3ZVWA 3S1YA 1WWSA 1EWZA 4JXSA 1ESIA 3C1CA 3F6TA 1P3GA 4S2JA 1LI0A 4KZ9A 3REHD 1FCOA 5AQ9A 4KGCB 3GTCA 4Z9QA 5DF7A 4OKPA 5AY8C 3L28A 4E6XA 3HLBA 1H5XA 1EI5A 3B0CT 1B6WA 1KU5A 5AVBA 3IHAA 3MVDC 5B0YB 3KSYA 3L2AA 2RL3A 2EFUA 3KFUG 4S2NC 4WZ5A 4B4ZA 3WTPA 4KUDB 1YU2A 4QLCB 3GVBA 3HVFA 4WBGA 3AZJD 4FSFA 3LELA 1K55A 3L29A 5GT0B 3AYWC 2P9VB 3G4PA 3FKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJG A;  4GDB A;  3C7U A;  1M40 A;  1GHI A;  4E3J A;  4O7D A;  2X01 A;  3Q1F A;  1ERQ A;  5F1F A;  4WMC D;  2QZ6 A;  2DCF A;  3BYD A;  5E2G A;  4IED A;  5FAP A;  1PYY A;  5DTK A;  4JF4 A;  4N1H A;  1W7F A;  2IWC A;  3IXD A;  2ZMA A;  3NY4 A;  3BM6 A;  1FR6 A;  3NIA A;  3OPL A;  4NET A;  1YLY A;  3UDX A;  1KVM A;  1JTG A;  1ZG6 A;  1PW1 A;  2A3U A;  3G34 A;  4OPZ A;  4DE0 A;  4M3K A;  4ZDX A;  3S22 A;  4XXR A;  1K54 A;  5JYO A;  1SDN A;  1VQQ A;  1IYS A;  1L0G A;  5FDH A;  4OON A;  3Q82 A;  1RCJ A;  5A93 A;  1SHV A;  3P09 A;  4OLG A;  1L2S A;  2QMI A;  2V2F F;  2XFT A;  2ZJ9 A;  5U47 A;  3BLM A;  2J9P A;  4JPM A;  4N92 A;  4FD8 A;  1FSY A;  4OQH A;  3ITB A;  1NYY A;  1MWS A;  4OH0 A;  2FFF B;  3WS1 A;  1BLP A;  3ZG8 B;  1KDS A;  4JF6 A;  4WMC A;  2X71 A;  4GB7 A;  3P98 A;  5GHZ A;  1ES4 A;  3GRJ A;  4R4R A;  4S2L A;  3Q7V A;  2BLS A;  5CRF A;  1ESU A;  1PI4 A;  4E6W A;  4DXC A;  1MWT A;  1YLT A;  1PW8 A;  3AGF A;  5CHU A;  3SOI A;  1FCN A;  1WE4 A;  4GD8 A;  4DKI A;  4OPQ A;  4S2K A;  2ZQ7 A;  2HP6 A;  4DE1 A;  3ZCZ A;  3UDF A;  4WZ4 A;  4OOM A;  3GSG A;  1Z6F A;  4DDY A;  3MBZ A;  4U0X A;  4EWF A;  4E3K A;  1RGZ A;  5CEB A;  4GOG A;  2P9V A;  3OCN A;  1ONG A;  5L2F A;  3UO9 A;  4HBU A;  1TDG A;  1I5Q A;  4P85 A;  3O88 A;  3M6B A;  3HUO A;  1PZO A;  2ZQA A;  2Y2I A;  3HUM A;  3FKW A;  5KZH A;  3PAG A;  2XDM A;  3HL9 A;  1IEL A;  4OQI A;  2V1Z A;  5CXW A;  5FAT A;  4DRT A;  5FI6 A;  3OZH A;  3ZNT A;  2XFS A;  4KG5 A;  4H8R A;  4PMA A;  5CHM A;  2OV5 A;  4JXV A;  4ZAM A;  1BLC A;  1ZG4 A;  4S2O A;  3IWQ A;  4B4X A;  4KZ3 A;  3WS2 A;  3M2J A;  3HRE A;  3Q07 A;  5FAQ A;  3SH8 A;  3W4Q A;  4F94 A;  2EX2 A;  2Q9M A;  1W8Y A;  5GHY A;  4U3T A;  2Y2L A;  2ZQ9 A;  5M19 A;  3BFF A;  1XX2 A;  2Q9N A;  5CGX A;  4XUX A;  3IXB A;  5GHX A;  1ES3 A;  3OPH A;  2Y4A A;  5JYP A;  1PI5 A;  1DJB A;  1RGY A;  1K6R A;  4ZTK A;  4ZJ2 A;  3FKV A;  4XUZ A;  3JYI A;  3EQV A;  3C5A A;  3G31 A;  1CEF A;  4JXW A;  4UA7 A;  4OVD A;  2Y2O A;  2J8Y A;  1K57 A;  2XH9 A;  3WS0 A;  2XLN A;  2JBF A;  1MXO A;  4RX2 A;  5G18 A;  1MWR A;  4BD1 A;  4DE3 A;  2Y2Q A;  3LY4 A;  3Q7V B;  3VSK A;  2WKH A;  4P6B A;  4EQI A;  3BFE A;  3IWI A;  5DVA A;  1XGI A;  4GKU A;  4WEK A;  3CG5 A;  1YT4 A;  4R3J A;  1ZC2 A;  1BLS A;  5FQQ A;  1YMS A;  1K4E A;  4OPY A;  3N8S A;  2J9O A;  4PM9 A;  1QMF A;  1MKI A;  3DTM A;  1PWC A;  4HEF A;  4C6Y A;  4U0T A;  5HL1 A;  4YFM A;  3HLF A;  4LEN A;  4MLL A;  3IF6 C;  1N4O A;  3MXS A;  4CJN A;  1ONH A;  2ZC7 A;  4LV2 A;  5DF9 A;  2HDQ A;  5EOO A;  1LL5 A;  1SCW A;  3TSG A;  3WS5 A;  4GZB A;  2DNS A;  3Q81 A;  4PM6 A;  4DDS A;  3IH9 A;  3BRM A;  3N6I A;  1DJC A;  4E3O A;  1YLJ A;  4HES A;  4X6T A;  5CHJ A;  4BLM A;  4EBP A;  2Y2M A;  4RYE A;  4S2N A;  5AQA A;  3UPO A;  4MNR A;  3VSL A;  4E3M A;  1C3B A;  2HPB A;  4Y0O A;  3VOZ A;  4JBF A;  2Y55 A;  2ZD8 A;  4QU3 A;  5IHV A;  5HAQ A;  3IXG A;  4X56 A;  3LO7 A;  3E2K A;  1CI9 A;  4BJP A;  4BL3 A;  4CPK A;  1K56 A;  1KE3 A;  3FV7 A;  3Q7Z A;  1BTL A;  5I94 A;  2X02 A;  3W4O A;  4X69 A;  1DY6 A;  4ZBE A;  3OPP A;  1MWU A;  4R0Q A;  3UPN A;  1Y54 A;  3IHB A;  2ZQD A;  4GDN A;  3MFD A;  4X68 A;  4KZ8 A;  3CMZ A;  4NK3 A;  4D2O A;  4A5R A;  1O7E A;  5CTN A;  2EXA A;  1HVB A;  4BL2 A;  3BEC A;  4OQG A;  5FI2 A;  2ZC3 B;  3ZHH A;  2XD5 A;  3D4F A;  3G35 A;  2WAD A;  2WAE A;  1S6R A;  3IXH A;  3LY3 A;  3OPR A;  3V50 A;  3WRT A;  3N8L A;  4X53 A;  2XEP A;  2IWD A;  4KQR A;  2J7V A;  3IWO A;  4OQ0 A;  1L0F A;  2HP5 A;  5TGF A;  1I2W A;  1G68 A;  2ZC6 B;  1AXB A;  4N9K A;  1WYC A;  5HX9 A;  2EX8 A;  1PWD A;  2V20 A;  1GCE A;  3GQZ A;  3HBR A;  5AQB A;  3DW0 A;  5FI7 A;  1YLZ A;  3NC8 A;  3ZGA B;  1E3U D;  4QY5 A;  2WKE A;  1NZU A;  4YIN A;  4X55 A;  3SS5 A;  2PBY A;  1NZO A;  2BG1 A;  3VOY A;  2Y2K A;  4S2M A;  2XQZ A;  1H8Y A;  5DF8 A;  4OP5 A;  4OOY A;  2R9X A;  4EV4 A;  3A3F A;  3MZD A;  5HW3 A;  2EX9 A;  4Q8I A;  3BEB A;  5EVI D;  2JC7 A;  3DWZ A;  2C5W B;  4GN2 A;  4KQO A;  4KZ5 A;  4PM7 A;  5TR7 A;  3A3I A;  5CEC A;  3C4O A;  4S2P A;  3PTE A;  4N1X A;  3A3D A;  3VP3 A;  1E25 A;  2VGJ A;  4R23 A;  1SKF A;  1VM1 A;  4Y0U A;  3GV9 A;  3I7J A;  1S0W A;  1LL9 A;  1NY0 A;  4R4S A;  3O3V A;  5EVI C;  1L0E A;  3G2Y A;  4C3Q A;  1KGG A;  4OP8 A;  5TFQ A;  1BUL A;  1IYO A;  1DJA A;  1O07 A;  3PAE A;  4DXB A;  2E8I A;  3MZF A;  1XA1 A;  3WWX A;  3IQA A;  1LHY A;  1HTZ A;  5GLC A;  5D3O A;  1XXM A;  3NCK A;  4DF6 A;  4OPR A;  1I2S A;  5M18 A;  2WGV A;  5FQI A;  3UNW A;  5EE8 A;  3FZC A;  5E2E A;  5EPH A;  4IBX A;  3DWK A;  1XA7 A;  5EVI A;  2Y2P A;  2FFY A;  2UWX A;  2ZM8 A;  5CGW A;  5HAR A;  2QPN A;  3ZG7 B;  3ITA A;  1KVL A;  1NYM A;  1JWV A;  1XPB A;  3O87 A;  1KGE A;  5F83 A;  3MKE A;  4KZB A;  4P87 A;  1KE0 A;  2VGK A;  1K4F A;  2WGW A;  1ERO A;  3C7V A;  3G30 A;  5HFO A;  4WM9 A;  5GLD A;  3TOI A;  3FYZ A;  1H8Z A;  1YLW A;  1GA9 A;  1LI9 A;  3G32 A;  3VP0 A;  3IH8 A;  3PBN A;  1FOF A;  5EVL A;  3AGD A;  4Y0T A;  1ES2 A;  3NDE A;  3IT9 A;  3AGE A;  2ZLY A;  2OLU A;  2Y2H A;  3EQU A;  4WZ5 C;  5CER A;  5KSC A;  4WYY A;  1TDL A;  1PWG A;  2I72 A;  4EUZ A;  3BLS A;  4LV0 A;  3PBS A;  1E4D A;  2XD1 A;  3WS4 A;  2WZZ A;  4EBN A;  1K25 A;  3WRZ A;  4JXG A;  4RVA A;  3ISG A;  2C6W B;  4QD4 A;  5KMW A;  2H0T A;  5CGS A;  5BOH A;  1FCM A;  4ZJ1 A;  1U60 A;  2ZC5 B;  2Z2L B;  4K0X A;  2JCH A;  4KG2 A;  2ZM0 A;  4L0L A;  3W4P A;  4RA7 A;  3RXW A;  2H10 A;  3UDI A;  2DRW A;  4K0W A;  5FAO A;  2Y2J A;  3SH7 A;  3CZD A;  3NBL A;  2WKI A;  3TG9 A;  3IF6 A;  4WEJ A;  4MBF A;  4R1G A;  2G2U A;  4N9L A;  3V5M A;  1PIO A;  3UN7 A;  2PU4 A;  3N4I A;  1M6K A;  3W8K A;  5FSR A;  5CED A;  1ALQ A;  4P0M A;  2XK1 A;  1BZA A;  2WZX A;  3NDG A;  3V39 A;  2EFX A;  1XP4 A;  1K54 C;  4KZ6 A;  2HDU A;  4KEN B;  1YMX A;  5A90 A;  4KZ7 A;  1IEM A;  3NI9 A;  3UY6 A;  1LLB A;  1FR1 A;  1K6S A;  1JTD A;  5DTT A;  2A49 A;  2HDS A;  1W5D A;  1NRF A;  3ZG5 A;  1IYP A;  3HUN A;  3O86 A;  4IBR A;  5EVI B;  4ZJ3 A;  4MBH A;  1K38 A;  4EBL A;  1CK3 A;  1CI8 A;  2HP9 A;  5GLB A;  3UE0 A;  1BT5 A;  1TEM A;  4FCF A;  4E3N A;  1IYQ A;  3HLG A;  1JVJ A;  3BFC A;  4Y7P A;  2P74 A;  2G2W A;  2WGW B;  2H0Y A;  4S2I A;  3FWL A;  5KSH A;  5J8X A;  3V3R A;  4IVK A;  3ZNY A;  1Q2P A;  4R3B A;  2ZM2 A;  2GDN A;  5FQ9 A;  4LCL A;  1OME A;  3HLD A;  3LCE A;  3VFH A;  2XF3 A;  1J9M A;  1XGJ A;  4E3L A;  3PBR A;  5AQ7 A;  3VP2 A;  4C75 A;  4PM8 A;  4PPR A;  3IF5 A;  2R9W A;  2XGN A;  1G6A A;  4UHU A;  4QY6 A;  1BSG A;  5CTM A;  4LV1 A;  1QME A;  1JWP A;  4KG6 A;  1GHM A;  5E2H A;  2XR0 A;  2JE5 A;  3VFF A;  3N8R A;  5HAP A;  1MY8 A;  4IVI A;  3VP1 A;  2ZQC A;  5FQK A;  4OOL A;  5FQJ A;  3BFG A;  4HBT A;  3C4P A;  1MPL A;  3PBQ A;  4KZA A;  2Z2M B;  3OCL A;  2IWB A;  1TVF A;  3PBO A;  4RX3 A;  5HAI A;  3A3E A;  1KGF A;  2WAF A;  3HLC A;  2OLV A;  1L0D A;  3IF6 B;  5GL9 A;  1KDW A;  1IKI A;  3ZG0 A;  5A91 A;  3ZFZ A;  3QNB A;  1HD8 A;  2B5R A;  5F82 A;  1E3U A;  3A3J A;  1ES5 A;  3ZVT A;  2Y2G A;  4ID4 A;  3HLE A;  4DE2 A;  1YM1 A;  5E2F A;  1MBL A;  2CC1 A;  2WGI A;  4WEL A;  5A92 A;  1FSW A;  5EOE A;  5F1G A;  5E43 A;  1WYB A;  3SH9 A;  2Y59 A;  1GHP A;  1NXY A;  2RCX A;  2WYX A;  4FH2 A;  3S4X A;  1YQS A;  3V3S A;  5GLA A;  4UAA A;  3ZVW A;  3S1Y A;  3BFD A;  1EWZ A;  2H5S A;  4JXS A;  1ESI A;  4PM5 A;  4GD6 A;  1N9B A;  3SS3 A;  1K57 C;  3VMA A;  4S2J A;  1LI0 A;  1NJ4 A;  4JKT A;  5DTS A;  5FA7 A;  1W79 A;  1JWZ A;  3B3X A;  4KZ9 A;  1FCO A;  3G2Z A;  5AQ9 A;  4UA6 A;  2EX6 A;  3GTC A;  4K91 A;  1HZO A;  3PBT A;  3N7W A;  3QHY A;  3SS4 A;  3OC2 A;  4BQM A;  3ZG9 B;  4Z9Q A;  3HLW A;  1FQG A;  4LCM A;  5DF7 A;  1BLH A;  4FH4 A;  4OKP A;  1ERM A;  3GMW A;  1IKG A;  1RP5 A;  4JF5 A;  4LV3 A;  4E6X A;  3HLB A;  1H5X A;  1EI5 A;  1CEG A;  3UE3 A;  2ZC4 B;  3LEZ A;  1KE4 A;  3QNC A;  3IHA A;  1K55 C;  4QHC A;  1XKZ A;  3E2L A;  4KQQ A;  4UA9 A;  4MBK A;  5EUA A;  3CJM A;  1GA0 A;  4BEN A;  4JLF A;  5FQM A;  3UE1 A;  2EXB A;  1K56 D;  1BUE A;  1SDE A;  2OSU A;  2RL3 A;  3MZE A;  5FAS A;  1ZKJ A;  2WUQ A;  2EFU A;  3GR2 A;  2ZQ8 A;  4KZ4 A;  3ZDJ A;  5M1A A;  1W8Q A;  4S2N C;  3UPP A;  4WZ5 A;  3VP4 A;  4B4Z A;  4OLD A;  4E3I A;  5EEC A;  3M2K A;  3RJU A;  1YLP A;  4MEZ A;  4GNU A;  2Y91 A;  3GVB A;  2PU2 A;  3HVF A;  4B88 A;  2Y2N A;  3MKF A;  4QB8 A;  4WBG A;  4FSF A;  3M6H A;  3MXR A;  1K55 A;  3RXX A;  4BD0 A;  1PZP A;  2P9V B;  2HDR A;  3G4P A;  1Q2Q A;  2WK0 A; 
#chains in the Genus database with same CATH topology
 3C7U A;  2D49 A;  2X01 A;  3Q1F A;  5F1F A;  4WMC D;  4WU8 D;  2QZ6 A;  2DCF A;  3BYD A;  5FAP A;  1ZTU A;  3A1K A;  1P3L C;  3REK A;  3QP5 A;  1S32 B;  3BM6 A;  1FR6 A;  1HQ3 A;  3NIA A;  2BTF P;  3LIF A;  1ZG6 A;  1KVM A;  3R45 A;  3C1B C;  1PW1 A;  4M3K A;  5C5K A;  2JHE A;  3W96 D;  3WAA A;  1IYS A;  5FDH A;  3KUY D;  3F1O A;  1RCJ A;  1KX5 B;  5A93 A;  3AN2 B;  3AZI B;  1L2S A;  2QMI A;  4OLG A;  3AZK B;  2PHY A;  1TZY C;  2ZOI A;  3BLM A;  1A7W A;  1KX3 A;  3AV1 B;  2FFF B;  1PNE A;  4KHA A;  3UB8 A;  1EQZ A;  5C3I B;  5AVF A;  3AZG B;  4GB7 A;  2HIO B;  4IBK A;  5GHZ A;  1ES4 A;  3GRJ A;  4HJ4 A;  1E6P A;  3LZ0 A;  1OTI A;  1VEU B;  2BLS A;  3CUE A;  1YLT A;  5CHU A;  3SOI A;  1WE4 A;  3MS6 A;  1BH8 A;  4DKI A;  3VV4 A;  4S2K A;  4ETX A;  4YS3 B;  4MB3 A;  2HP6 A;  2O99 A;  4DE1 A;  1AOI C;  4OOM A;  4QNL A;  3MBZ A;  4U0X A;  1RGZ A;  1ONG A;  1TDG A;  4P85 A;  3O88 A;  3REL C;  1UR9 A;  3M7P A;  3L26 A;  3HL9 A;  5B33 C;  4LD9 D;  4OQI A;  4XUJ A;  4DRT A;  5GT3 C;  5FI6 A;  5B40 A;  4H8R A;  2ZL1 B;  2OV5 A;  4JXV A;  1BLC A;  2I9V A;  4B4X A;  5AY8 D;  3M2J A;  3HRE A;  5B0Z C;  5GXQ A;  5FAQ A;  4F94 A;  1W8Y A;  4EQ1 A;  4JGQ A;  2Y2L A;  3TU4 C;  4XUX A;  3IXB A;  5JRG A;  5GHX A;  3OPH A;  2Y4A A;  3CWF A;  1P3L B;  4EU0 A;  5JYP A;  3CAX A;  3LZ1 B;  1DJB A;  1RGY A;  1K6R A;  2XA7 M;  4GHL A;  3EQV A;  1UWN X;  3C5A A;  2FJ7 C;  3KXB A;  4FUW A;  4RX2 A;  5G4Z A;  3UT9 C;  2F8N D;  5GSU C;  3NEC A;  3MGR B;  3MNN C;  3B6F D;  3Q7V B;  3LR0 A;  2XSS A;  4EQI A;  5DVA A;  3IWI A;  4GKU A;  4R3J A;  3AYW D;  1YU0 A;  1BLS A;  1YMS A;  4OPY A;  1TZY B;  3KSF A;  2J9O A;  4PM9 A;  1QMF A;  3DTM A;  1Y28 A;  1PWC A;  2LY8 A;  4LGW A;  5HL1 A;  3HLF A;  2ARO C;  4LEN A;  1N4O A;  1IOU A;  1J7M A;  3TSG A;  4CJN A;  4Z2K A;  5DF9 A;  2HDQ A;  5K5B A;  1KX4 A;  3LYX A;  5DNN D;  3C38 A;  3C1B D;  2QHK A;  5AQA A;  3VSL A;  4E3M A;  1C3B A;  3FKE A;  1P3M B;  3IX3 A;  3VOZ A;  2ZD8 A;  1AOI B;  1L6J A;  3LO7 A;  1CI9 A;  4MN5 A;  4Z66 B;  1BYW A;  1K56 A;  1KE3 A;  3FV7 A;  1BTL A;  4UEY A;  4X1M A;  5B24 B;  3LIE A;  3IHB A;  3X1S B;  4X68 A;  4KZ8 A;  3C30 A;  2F2A C;  5BT1 C;  4BWI A;  1HVB A;  5F68 A;  3AZF D;  4OQG A;  3IS2 A;  3LY3 A;  1GSV A;  1SKO A;  4HHD A;  4KQR A;  1L3L A;  3T4O A;  3AZL D;  4GJ4 A;  1H8P A;  5B0Z B;  1F98 A;  3AZH D;  3LIA A;  5B31 B;  1G68 A;  1ACF A;  1WYC A;  4Z2I A;  2EX8 A;  1PWD A;  3WA9 A;  3DW0 A;  5FI7 A;  1YLZ A;  2O9B A;  4MN7 A;  1OTA A;  2WKE A;  1NZU A;  1P3F D;  3W97 A;  1MKM A;  5CP6 B;  5B32 A;  4X55 A;  3SS5 A;  1P34 C;  4YM6 C;  5DF8 A;  4X23 D;  3AV2 A;  4J8X D;  4EV4 A;  4OJ6 A;  3UT9 B;  3MGS B;  4DRA A;  1YSQ A;  3MZD A;  5HW3 A;  1EW0 A;  5EVI D;  1M1A C;  4H9Q B;  4KQO A;  2J3T C;  4J8V A;  3C4O A;  2A24 B;  1P3G D;  3LJA C;  5EM1 A;  2CV5 C;  3VP3 A;  4NY2 A;  1Q9C A;  1SKF A;  3GV9 A;  3TU4 D;  1P3I C;  2ARO B;  1P9W A;  5AV9 C;  2HUE C;  1L0E A;  2O9C A;  5B2I C;  1M18 B;  5TFQ A;  3WKJ C;  1BUL A;  2OAQ 1;  3PAE A;  2YKF A;  3S7P A;  2FJ7 D;  4DXB A;  2GNX A;  1XA1 A;  3MZF A;  5DKK A;  3B6G C;  1HTZ A;  1P3O D;  5D3O A;  5B1M C;  4DF6 A;  1M19 A;  1ID3 B;  2G5I C;  5GSU D;  3MNN D;  5FQI A;  2PT7 A;  5AVC B;  1FIK A;  4IBX A;  3NOT C;  1XA7 A;  3NJA A;  4OJP A;  2L4R A;  1XJ2 A;  5HAR A;  4X25 A;  1KVL A;  2W8S A;  1JWV A;  1F1E A;  3WTP D;  4KZB A;  4P87 A;  2HV1 A;  2KX6 A;  2VGK A;  1K4F A;  5B1L A;  2CMN A;  3OLO A;  2WGW A;  2WKQ A;  4WM9 A;  5GLD A;  3TOI A;  3O62 B;  5DJU A;  5BNX B;  3LEL D;  4Y0T A;  3NDE A;  3IT9 A;  4J8W C;  4J8U B;  2OLU A;  3B47 A;  5KSC A;  4CSR B;  4NE6 A;  3X1T B;  3VH6 W;  1PWG A;  5B31 G;  3X1V C;  3AFA B;  1JNU A;  2V1A A;  1GOI A;  1K25 A;  4JXG A;  4LRY C;  5L8M A;  3ISG A;  1HQ3 D;  2C6W B;  3A0V A;  1FCM A;  1TAF B;  4ZJ1 A;  1PZR A;  2ZC5 B;  3A0S A;  1NWZ A;  4L0L A;  1MZU A;  4RA7 A;  3RXW A;  3UDI A;  4Z2G A;  3H82 A;  3WAA D;  5FAO A;  2Y2J A;  2NQB D;  3NBL A;  2WKI A;  3TG9 A;  5BT1 D;  4R8P A;  4L9E A;  4N9L A;  3KSI A;  1P3P B;  1PIO A;  3UN7 A;  3LIB A;  3QP8 A;  2RIQ A;  1M6K A;  5CED A;  1F66 C;  2XK1 A;  4WU9 C;  3REJ C;  4KZ6 A;  2KOI A;  4KEN B;  1EQZ D;  2CV5 B;  1CXW A;  4KZ7 A;  3NI9 A;  1P3A B;  3UY6 A;  1JTD A;  4KQD A;  5AV5 B;  2EA9 A;  1P3I B;  4IBI A;  2HDS A;  4NKP A;  4E45 A;  1NRF A;  1IYP A;  2YKH A;  3E4P A;  3O86 A;  4IBR A;  1CF0 A;  4WF0 A;  4EBL A;  5CPI C;  3X1U B;  3V3R A;  4KGC A;  4R3B A;  2H28 A;  3C8C A;  1M1A D;  3VFH A;  3MGQ B;  4E3L A;  1P0Z A;  4C75 A;  5B2J C;  3LJA D;  4UHU A;  5FL3 A;  1BSG A;  4LV1 A;  4NE3 A;  1GHM A;  3HJK A;  3AZN B;  3WD2 A;  2XR0 A;  3VFF A;  1PFL A;  3MXQ A;  2JKR I;  5B0Y A;  2ZQC A;  3P5J B;  4G91 B;  2QWS A;  3BFG A;  3WKJ D;  4KZA A;  5F6A A;  3B6G D;  2NZD C;  2L1M A;  1KGF A;  5B1M D;  3UTA A;  4QLC A;  3IF6 B;  5JRG D;  5HDC A;  1KDW A;  1S1Z A;  5A91 A;  3ZFZ A;  2E8J A;  1E3U A;  3L27 A;  1ES5 A;  3ZVT A;  5GT0 A;  4G3W A;  4DE2 A;  2CC1 A;  1LL8 A;  5A92 A;  5EOE A;  3SH9 A;  1NRJ A;  5F99 C;  5GLA A;  3DTI A;  3BFD A;  3UE6 A;  4P6Z M;  4PM5 A;  3UTB D;  1S32 A;  1N9B A;  2W3F A;  3SS3 A;  2M7V A;  2KLI A;  2VV7 A;  1W79 A;  3B3X A;  1J3W A;  1E15 A;  1DP8 A;  2W1T B;  3X1V D;  4XZQ B;  1HZO A;  3PBT A;  1HTA A;  3N7W A;  3QHY A;  4FTX A;  4IBJ A;  3SS4 A;  1KX4 D;  1KX5 A;  1FQG A;  2ZMV A;  3AN2 A;  3AZI A;  3AZK A;  1ERM A;  3GMW A;  3KWQ B;  1O6I A;  1DRM A;  3AV1 A;  2ZC4 B;  3T4L A;  4JJN A;  3H0R C;  3AZG A;  3BJN A;  4QHC A;  2HIO A;  3E2L A;  4MBK A;  3CJM A;  4BEN A;  1VEU A;  5FQM A;  2W0N A;  2EXB A;  3A6N B;  1K56 D;  1BUE A;  4CQH A;  1R4V A;  2YFV B;  5E5A B;  3AZE C;  4KZ4 A;  3REI C;  1W8Q A;  3UPP A;  1F66 D;  4WU9 D;  4E3I A;  2V0U A;  3MMH A;  1JFI B;  1YLP A;  4MEZ A;  2PD8 A;  3P01 A;  2Y91 A;  4YS3 A;  1OTB A;  2PU2 A;  4B88 A;  2Y2N A;  3RXX A;  5CPK C;  4BD0 A;  2HDR A;  4B93 A;  4QJG A;  4GDB A;  1GHI A;  1YU1 A;  3T50 A;  5E2G A;  1ZLA B;  4IED A;  5F5Y A;  3AZJ C;  1W7F A;  2IWC A;  3EPH A;  1E6R A;  4NET A;  2ZL1 A;  2J3W A;  1YUE A;  3G34 A;  2Q0O A;  4Z2M G;  4WU8 C;  4PAU A;  5B2J D;  2EWV A;  3S22 A;  3KYQ A;  5G49 B;  4CAY B;  1K54 A;  1SDN A;  4E44 A;  4LPZ A;  3SZT A;  1L0G A;  2EWW A;  4HNB A;  4OON A;  5AV6 C;  3P09 A;  3LZ1 A;  2J9P A;  4JPM A;  4FD8 A;  4J8V D;  3ITB A;  4WNN B;  1LSX A;  3HCY A;  3W96 C;  3WS1 A;  3ZG8 B;  1TS7 A;  3VH5 A;  1ULY A;  3KUY C;  5HPI A;  3MGP C;  4R4R A;  3AZM C;  1P3B C;  4CLC B;  3MGR A;  3Q7V A;  4F3L A;  1ESU A;  4E6W A;  4EUV A;  3NOU C;  2QYB A;  5B32 G;  1FCN A;  4OPQ A;  3REH B;  3VH5 T;  5EFW A;  5KIZ A;  3LI8 A;  4UUZ B;  1M19 D;  5IS1 A;  3BQ8 A;  4Z5T B;  4E3K A;  3CI6 A;  4NE5 A;  4HBU A;  3UO9 A;  1YKD A;  3M6B A;  1PZO A;  3HUM A;  5KZH A;  3V67 A;  2XDM A;  5B1L D;  1IEL A;  3L9K A;  1U35 B;  5KDM A;  1P3M A;  3ZNT A;  2XFS A;  4KG5 A;  4PMA A;  3G6O A;  3IWQ A;  4Z66 A;  3WS2 A;  3Q07 A;  2INW A;  3SH8 A;  2L5A A;  1OJG A;  3KS4 A;  2Q9M A;  3B0D B;  5B24 A;  4LD9 C;  2ZQ9 A;  2JKF A;  3X1S A;  1XX2 A;  2HGV A;  1ES3 A;  1B67 A;  4ZTK A;  4XUZ A;  3G31 A;  4OVD A;  2Y2O A;  3AZE D;  1OGB A;  1K57 A;  3REI D;  3WS0 A;  1W63 Q;  4WU8 B;  1MXO A;  5G18 A;  5B31 A;  4DJ3 A;  4BMW A;  2Y2Q A;  4R8P D;  1OT9 A;  4H9R B;  2XA7 S;  1XGI A;  5CPK D;  1ZC2 A;  1VHM A;  1K4E A;  3N8S A;  1UGU A;  5CP6 A;  4ME4 A;  4HEF A;  4C6Y A;  4YFM A;  5IU1 A;  3B6F C;  3W99 A;  3KUY B;  2ZC7 A;  5EOO A;  4OJO A;  1LL5 A;  3Q81 A;  3IX4 A;  3MGS A;  1H0G A;  4DDS A;  4QPR A;  3N6I A;  1DJC A;  4E3O A;  1YSP A;  4HES A;  2A24 A;  5CPJ D;  3PXP A;  3E0Y A;  4HY8 A;  3UPO A;  1F5M A;  2HPB A;  2Z6D A;  4Y0O A;  4QU3 A;  3QP4 A;  5DNN C;  4X56 A;  5AV6 D;  4JGO A;  3W4O A;  3W98 C;  4X69 A;  1M18 A;  3MQO A;  1W1P A;  1P3K B;  1QO6 A;  1Y54 A;  4GDN A;  2GZA A;  3CMZ A;  4NK3 A;  1TS0 A;  4A5R A;  1O7E A;  2PDR A;  2EXA A;  1ODV A;  1ID3 A;  3MGP D;  3BEC A;  3AZM D;  1P3B D;  2ZC3 B;  3NQU A;  2XD5 A;  1T1C A;  3D4F A;  2WAD A;  3IXH A;  5AVC A;  2PR5 A;  5DFX A;  4NZ1 A;  2J7V A;  3IWO A;  4K08 A;  4LFU A;  4II7 A;  3E4Q A;  1AXB A;  3NUL A;  4N9K A;  3VE4 A;  5HX9 A;  4LD9 B;  1P97 A;  3AZF C;  3UTA D;  4QLC D;  3MFX A;  2ZOH A;  4X1L A;  3H7W B;  1T1B A;  1GCE A;  3O62 A;  1E88 A;  5AQB A;  3NC8 A;  1E3U D;  5AY8 B;  5GT0 D;  4H6J A;  3AZL C;  4YIN A;  4J8U A;  3AZH C;  3T4Q A;  1NZO A;  3VOY A;  1G6O A;  4CSR A;  2XQZ A;  1H0M A;  5A8B A;  3BWL A;  3X1T A;  5HWT A;  4DN0 A;  1XFQ A;  2O0Y A;  2R9X A;  3AFA A;  3MVD B;  2Y79 A;  3LR4 A;  4Q8I A;  1P3F C;  3IX8 A;  4PM7 A;  5CEC A;  5G4Y A;  3KX0 X;  1CJF A;  1D1J A;  3PTE A;  1TAF A;  4X23 C;  2BYM B;  2VGJ A;  4J8X C;  1VM1 A;  4Y0U A;  2HZ5 A;  2F8N B;  5DNM D;  3B6F B;  1D7E A;  1NY0 A;  5FUG B;  4G92 C;  5EVI C;  3C1C C;  1KGG A;  3AYW B;  1P3G C;  1P3P A;  1O07 A;  3KO6 A;  1WA9 A;  3WWX A;  3MQL A;  3IQA A;  4JJN D;  2QJ7 A;  5M18 A;  3AZG D;  1P3A A;  2V8F A;  2J80 A;  3WD1 A;  2HIO D;  5BS7 A;  5AV5 A;  3LR3 A;  3IBJ A;  5EPH A;  1P3I A;  2F8N H;  4Z1W A;  3DWK A;  5HWW A;  3LID A;  3EPK A;  4LLO B;  3C1B B;  3ITA A;  1P3O C;  1NYM A;  4IJG A;  3O87 A;  1DP9 A;  4Y2F A;  3X1U A;  2IA2 A;  3W2Z A;  4YS3 D;  5HFO A;  4GCZ A;  3H9W A;  3FYZ A;  1H8Z A;  2JKT I;  3IH8 A;  5EVL A;  4WLA A;  4ZRR A;  4WZ5 C;  5CER A;  3WTP C;  3MGQ A;  2I72 A;  4EUZ A;  4LV0 A;  5DKL A;  2WZZ A;  3AZN A;  3LEL C;  3AZF B;  3WRZ A;  4EEP A;  1Y4O A;  4QD4 A;  2H0T A;  4M4X A;  3W98 D;  3AZL B;  2H10 A;  2DRW A;  5BO0 B;  3REK C;  3IF6 A;  1HQ3 C;  3V5M A;  3T1R A;  3B0C W;  5FSR A;  5HDD A;  4Z2H A;  3NDG A;  3V39 A;  4EO5 C;  4I5S A;  3WAA C;  1YMX A;  3REL B;  2NQB C;  5AVE A;  5J4E A;  5B33 B;  4KUK A;  5DTT A;  1UR8 A;  4J8X B;  5GT3 B;  4MMN A;  2A49 A;  1S67 L;  4G92 B;  5EVI B;  1K38 A;  1KX3 C;  3S7Q A;  2VKS A;  2HP9 A;  1EQZ C;  3HLG A;  1JVJ A;  2V1B A;  2P74 A;  3KS8 A;  1TD5 A;  2H0Y A;  3FWL A;  5J8X A;  3DTK A;  3ZNY A;  3TU4 B;  2W1T A;  3LZ0 C;  4XZQ A;  1AIW A;  2GJ3 A;  2W3D A;  2ZM2 A;  4HP9 A;  5FEF A;  5FQ9 A;  4ETZ A;  5AV8 A;  3HSH A;  4Y5F A;  5CHL B;  1LT0 A;  1J9M A;  3KWQ A;  2FJ7 B;  3KYZ A;  3PBR A;  2HJ9 C;  2R9W A;  1G6A A;  1P3O B;  5CTM A;  1QME A;  4KG6 A;  2JE5 A;  5GSU B;  1P3M D;  3N8R A;  3MNN B;  2YFW A;  3C1C D;  4Z66 D;  4ZUX A;  2VZW A;  3A6N A;  4HBT A;  5L07 A;  3C4P A;  1MPL A;  4EES A;  5E5A A;  3OCL A;  4NXF A;  2IWB A;  1K0K A;  3LI9 A;  1TVF A;  3PBO A;  5B24 D;  4RX3 A;  1JFI A;  4EXO A;  3X1S D;  2V0W A;  2WAF A;  3HLC A;  1L0D A;  2KDK A;  5B40 C;  5GL9 A;  3ZG0 A;  1HD8 A;  3EPJ A;  2WKP A;  5GXQ C;  3S7O A;  2JN7 A;  4ID4 A;  3HLE A;  1YM1 A;  4PKY A;  4IBB A;  5B31 D;  5JRG C;  5AVB D;  1WYB A;  2Y59 A;  1GHP A;  1ZLA A;  1NXY A;  2RCX A;  3S4X A;  1PRQ A;  4UAA A;  4WUJ A;  4GD6 A;  2PYO A;  3KXB C;  4NXB A;  2JKT M;  3VMA A;  3KYE A;  4JKT A;  5J3W A;  2ZY3 A;  1X0O A;  4DMZ A;  3WAA B;  5G49 A;  4O0P A;  3W99 D;  4UA6 A;  1LSW A;  2NQB B;  3EWK A;  4Q0J A;  4P6Z S;  3OC2 A;  4BQM A;  3ZG9 B;  3UTB C;  3HLW A;  4LCM A;  3MGS D;  1BLH A;  2P08 A;  4H9S A;  1VET B;  1RP5 A;  4JF5 A;  4LV3 A;  2QKP A;  4WNN A;  1CEG A;  4HI4 A;  3F1P B;  3QNC A;  1KX4 C;  3REK D;  5HD5 A;  1D06 A;  1G28 A;  4UA9 A;  4CLC A;  4JLF A;  2DF4 C;  2HJE A;  4CLC E;  2OSU A;  1ZKJ A;  2WUQ A;  3UMD A;  4FOF A;  2ZQ8 A;  4D60 A;  5M1A A;  4EW7 A;  4OLD A;  4RQ9 A;  1P34 B;  4IBD A;  4YM6 B;  1CQA A;  1OT6 A;  3REH A;  3M2K A;  4I3A A;  3RJU A;  2M7U A;  1ID3 D;  1KS0 A;  3MKF A;  4QB8 A;  2M1C A;  3RFB A;  3MXR A;  4Z5T A;  1M1A B;  3FZC A;  4MLL A;  3IP4 C;  2WK0 A;  3QP2 A;  1KX3 D;  3QP6 A;  3LJA B;  2WKR A;  2MJ6 A;  1KOU A;  4WN5 A;  5DTK A;  4JF4 A;  4N1H A;  3LZ0 D;  1U35 A;  4R38 A;  3IXD A;  2PYP A;  4JGP A;  5AV9 B;  1OPX A;  2HUE B;  5B2I B;  1YLY A;  4HGA C;  3WKJ B;  4OJ5 A;  4J8U D;  2A3U A;  4OPZ A;  4DE0 A;  4ZDX A;  1HLU P;  3B6G B;  3X1T D;  1VQQ A;  5B1M B;  5JRG B;  3Q82 A;  3AFA D;  4G3V A;  1SHV A;  4NXG A;  2V2F F;  2XFT A;  2ZJ9 A;  2QJ5 A;  3W97 C;  4MCW A;  3R7W B;  1E8B A;  3T12 B;  2G7U A;  1BLP A;  1KDS A;  2PD7 A;  4JF6 A;  4WMC A;  4WU8 A;  3PYP A;  2DQN C;  4XUJ D;  2X71 A;  3P98 A;  5B40 D;  4S2L A;  3H0L C;  1MWT A;  3UTB B;  4J8V C;  1P3P D;  1PW8 A;  5GXQ D;  4J8W B;  4NZ5 A;  4GD8 A;  4KUD A;  4I38 A;  3X1V B;  3ZCZ A;  1P3A D;  3KUY A;  3UB5 P;  3CIT A;  1Z6F A;  3GSG A;  4ARZ B;  1S4S A;  2XRO A;  4DDY A;  5AV5 D;  4EEU A;  4EWF A;  2CWE A;  1GSX A;  1YU4 A;  2P9V A;  3OCN A;  3SW1 A;  3KXB D;  1OTD A;  2OOL A;  4Y3I A;  3HUO A;  4Y15 A;  3X1U D;  2LB9 A;  3PAG A;  1M19 C;  2RVQ D;  2OWJ A;  2V1Z A;  3E98 A;  3OZH A;  5CHM A;  4KZ3 A;  1VB6 A;  1F66 B;  4LRX C;  5GHY A;  4WU9 B;  3REJ B;  5B1L C;  1P3K A;  2ACG A;  3BFF A;  3CPT B;  2Q9N A;  2IOU A;  5CGX A;  4NZ3 A;  1E6N A;  3AZN D;  2W3E A;  3IS2 B;  4ZJ2 A;  2W1R A;  3D72 A;  5CPI B;  3NQJ B;  2JBF A;  4TX8 A;  4BD1 A;  1NLZ A;  3FPW A;  4Z2M H;  3LY4 A;  3GDI A;  3KSH A;  2WKH A;  3H7W A;  4WEK A;  4H9P B;  5FQQ A;  5AY8 A;  1PDC A;  5B2J B;  4U0T A;  3MXS A;  4R8P C;  1SCW A;  3MVD A;  2DNS A;  3L25 A;  4PHT A;  1H3Q A;  3IH9 A;  4WV4 B;  1TF1 A;  4HOI A;  1YLJ A;  4BLM A;  4NXE A;  2Y2M A;  4GLQ A;  4RYE A;  4S2N A;  2NZD B;  5EVE A;  3EPL A;  4JBF A;  2Y55 A;  3WA9 D;  3IXG A;  3EEA A;  3B6F A;  3E2K A;  3ULF A;  1AWI A;  5FUG A;  5AV8 D;  4IBF A;  4BL3 A;  4CPK A;  2OAP 1;  5I94 A;  3W97 D;  2X02 A;  3AYW A;  5CPJ C;  5B32 D;  1DY6 A;  4L9F A;  1MWU A;  4R0Q A;  3MQ0 A;  1E6Z A;  3UB9 A;  3MFD A;  3AV2 D;  4KGC C;  3DBA A;  4D2O A;  3JVV A;  5CTN A;  2VV8 A;  4BL2 A;  5F99 B;  5TBM B;  5FI2 A;  3ZHH A;  1P3L A;  3G35 A;  2WAE A;  3V50 A;  1V9Z A;  4ZUX D;  1ZHH B;  4X53 A;  3A6N D;  2IWD A;  5EM0 A;  1L0F A;  2HP5 A;  5TGF A;  3C1B A;  1N9N A;  3LFV A;  3ZQ5 A;  3EG5 B;  5B0Y C;  4M6B A;  3GQZ A;  2B95 A;  3LEQ A;  3HON A;  2D01 A;  3ZGA B;  4QWO A;  4QY5 A;  1TZY A;  3B42 A;  5IT5 A;  2BG1 A;  2RTS A;  2Y2K A;  1S1Y A;  4S2M A;  1H8Y A;  3UTA C;  4QLC C;  3WD0 A;  4XT2 B;  1F9I A;  1ZLA D;  4GHI B;  3A3F A;  3JPU A;  3AZF A;  5GT0 C;  1GXD A;  2JC7 A;  3D3O A;  2C5W B;  2PYO D;  4NFT A;  4S2P A;  3AZE B;  3REI B;  3A3D A;  1E25 A;  4I3J A;  3KSG A;  3D9Y A;  3H82 B;  3I7J A;  5BO0 A;  4H9O B;  1S0W A;  1AOI A;  1LL9 A;  4R4S A;  1S32 C;  5CPK B;  4OP8 A;  1N1J B;  3TE8 A;  1IYO A;  4PKY G;  2ZY2 A;  1LHY A;  3BW6 A;  3MQQ A;  5GLC A;  5DNM C;  1XXM A;  3REL A;  3NCK A;  1I2S A;  5B33 A;  2JKG A;  4J8X A;  3AZJ B;  1KX5 C;  3AZI C;  5EE8 A;  5GT3 A;  3AZK C;  3QP1 A;  1CK7 A;  2Z6C A;  1DP6 A;  3U4L P;  5EVI A;  2Y2P A;  2FFY A;  2UWX A;  4BBT A;  4GH9 A;  3AV1 C;  2J8P A;  5CPJ B;  5F83 A;  5B0Z A;  1KGE A;  3MKE A;  5BNV B;  4JJN C;  5C3I C;  3LR5 A;  1KE0 A;  3RTY A;  3AZG C;  3G30 A;  1ERO A;  3C7V A;  3MJQ A;  2HIO C;  3TU4 A;  3OBF A;  1YLW A;  1LI9 A;  5AV6 B;  3G32 A;  3VP0 A;  3BY9 A;  4E04 A;  4Z5T D;  1ES2 A;  2ZLY A;  2Y2H A;  2FJ7 A;  3W96 B;  4YS3 C;  1P3O A;  1F2K A;  3UB6 A;  3BLS A;  5HDS A;  3PBS A;  2XD1 A;  3WS4 A;  2NUP C;  1U35 D;  4EBN A;  3MGP B;  3UT9 A;  4IBG A;  1H3O B;  5GSU A;  3AZM B;  1P3B B;  3MNN A;  3BQA A;  4H9Q A;  4WJ3 C;  5CGS A;  5BOH A;  1U60 A;  2Z2L B;  4KG2 A;  2JCH A;  5DFY A;  2ZM0 A;  4K0W A;  3MSH A;  3SH7 A;  4KGC D;  3WTP E;  3CZD A;  3UTA B;  2ARO A;  4MBF A;  1Z09 A;  5CX7 A;  1BFM A;  4DRB A;  2PU4 A;  4NYU A;  3N4I A;  3VE3 A;  2XRN A;  1K54 C;  4HIA A;  3V9R B;  2PR6 A;  1FR1 A;  1K6S A;  4EER A;  1OJ5 A;  5B0Y D;  3P7N A;  1W5D A;  3LZ1 C;  3ZG5 A;  3U2A A;  4MBH A;  3K3C A;  4BBU A;  1H0I A;  4KUO A;  1CI8 A;  3L7H A;  2HF6 A;  1TEM A;  4GW9 A;  3BFC A;  4HJ3 A;  4KUD D;  2G2W A;  5AJG A;  2PBD P;  3MGR C;  5DNM B;  2NQB A;  1GPF A;  3FDD A;  2GDN A;  3T1X A;  5BNX A;  4LCL A;  1OME A;  3HLD A;  4R6L A;  3MR0 A;  1VET A;  4MDZ A;  3VP2 A;  5AQ7 A;  3IF5 A;  1T3U A;  4QY6 A;  3F1P A;  4JJN B;  5E2H A;  1N9O A;  4EET B;  3N3F A;  5HAP A;  3GEC A;  3DTE A;  1S32 D;  3VP1 A;  5FQK A;  4H9N B;  4L9G A;  3B0B A;  3TRC A;  4HJ6 A;  3PBQ A;  2VV6 A;  1P3K D;  1P34 A;  5HAI A;  4YM6 A;  2BYK B;  3A3E A;  1P3M C;  3O5Y A;  2OLV A;  4UQI M;  2VQR A;  1KX5 D;  3VH6 A;  1IKI A;  3AN2 D;  3AZI D;  4Z66 C;  3AZK D;  2VEA A;  5F82 A;  1M1A A;  3EGD C;  5E2F A;  1MBL A;  3AV1 D;  5B24 C;  4OUI A;  1H8M A;  3RH8 B;  1FSW A;  4ZBJ C;  3LJA A;  3X1S C;  2CV5 A;  5F1G A;  5E43 A;  5JA4 B;  2VGL M;  5J7E A;  3VH6 T;  5DNN B;  2A2L A;  2H5S A;  5DJT A;  5AV9 A;  3VH5 W;  5B2I A;  3W98 B;  1K57 C;  5FA7 A;  3WKJ A;  1NJ4 A;  5DTS A;  5EV0 A;  5FEG A;  1JWZ A;  5B31 C;  5AVB C;  4JGR A;  1MC0 A;  3B6G A;  3G2Z A;  2PRF A;  4MB4 A;  2EX6 A;  4K91 A;  5B1M A;  4OJL A;  3MVD D;  3HJI A;  2D02 A;  4IUH A;  4IBC A;  4FH4 A;  4LG2 A;  1IKG A;  3R7W A;  5CP6 C;  2IO5 C;  5L10 A;  3T1S A;  3W99 C;  3UE3 A;  3LEZ A;  1KE4 A;  3WX7 A;  1K55 C;  1XKZ A;  3MGS C;  4KQQ A;  5EUA A;  1GA0 A;  3UE1 A;  1SDE A;  1XJ4 A;  3MZE A;  3UTB A;  5FAS A;  3GR2 A;  4J8W A;  3AZH B;  3ZDJ A;  3VP4 A;  4AWL C;  5EEC A;  2P04 A;  4GNU A;  2ZBB A;  3X1V A;  4DJ2 A;  2P7J A;  1P3L D;  1BH9 B;  3M6H A;  4ARZ A;  2VJW A;  3LZ1 D;  1PZP A;  1P3F B;  1M18 C;  1Q2Q A;  4G3K A;  1M40 A;  4E3J A;  4O7D A;  1ERQ A;  4X23 B;  1GSW A;  1ID3 C;  2F8N G;  1PYY A;  3EGX C;  5KDM B;  3MGR D;  2ZMA A;  5AVC C;  3NY4 A;  3C1C B;  3OPL A;  3UDX A;  1P3G B;  1TZY D;  1OGG A;  1JTG A;  1W1V A;  1UWP X;  4HMC A;  1F66 A;  4XXR A;  4WU9 A;  3REJ A;  4O01 A;  4IJE A;  5JYO A;  4ZBJ B;  3B33 A;  3CPT A;  3O62 C;  5HWV A;  3CUE C;  4HME A;  5U47 A;  3NOP C;  1G5U A;  4J8U C;  4GS9 B;  1S4R A;  4N92 A;  1FSY A;  4OQH A;  3UB7 A;  1NYY A;  1MWS A;  1S66 L;  4OH0 A;  5CPI A;  3X1T C;  3NQJ A;  5AVB B;  3AFA C;  1AOI D;  5TJJ A;  5CRF A;  1PI4 A;  4DXC A;  3AGF A;  4H9P A;  2YFV A;  3F1N B;  2VK3 A;  3WTP B;  3BY8 A;  3T4S A;  2IO5 B;  5B2J A;  4XUJ C;  2ZQ7 A;  3REL D;  3W99 B;  2JSS A;  3UDF A;  1ED7 A;  4WZ4 A;  5B33 D;  3LEL B;  5GT3 D;  1P3P C;  4F3L B;  4HMD A;  5CEB A;  4GOG A;  5L2F A;  3R4K A;  1I5Q A;  2B18 A;  2ZMF A;  3DAV A;  5B0Z D;  2ZQA A;  2Y2I A;  3FKW A;  1P3A C;  2NZD A;  4AWL B;  5BS7 C;  3REK B;  5CXW A;  5AV5 C;  5FAT A;  4R3A A;  1HQ3 B;  1YPR A;  4NG2 A;  4ZAM A;  3PR6 A;  5HD3 A;  1ZG4 A;  4S2O A;  3R45 B;  3FC7 A;  5CP6 D;  3W4Q A;  4YOF A;  2EX2 A;  3X1U C;  4EO5 B;  2RVQ C;  3WD4 A;  4CAY A;  4U3T A;  5M19 A;  2OWH A;  3F1O B;  3UT9 D;  1TS8 A;  5F99 A;  5TBM A;  3NQU B;  1PI5 A;  3JYI A;  1KX3 B;  4GHA A;  1CEF A;  3MGQ C;  4JXW A;  4UA7 A;  2ZM5 A;  4KHA B;  2J8Y A;  2XH9 A;  2AVX A;  1EQZ B;  2XLN A;  1MWR A;  4DE3 A;  3AZN C;  1XFN A;  3AL0 C;  3LZ0 B;  2ARO D;  2PAV P;  3VSK A;  4G91 C;  4P6B A;  3BFE A;  3CG5 A;  1YT4 A;  1M18 D;  4H6J B;  1BH8 B;  1MKI A;  2W3G A;  2V9A A;  3TJZ C;  4NZ4 A;  3IF6 C;  4XT2 A;  4UUZ A;  1ONH A;  4LV2 A;  4GHI A;  1XJ6 A;  3WS5 A;  4Z2J A;  4GZB A;  4PM6 A;  5AVC D;  1TS6 A;  2Y8H A;  3BRM A;  5CHJ A;  4X6T A;  4EBP A;  4MN6 A;  3AZE A;  3REI A;  4MNR A;  4XUJ B;  3CHW P;  5IHV A;  5B40 B;  3O62 D;  5HAQ A;  4H9O A;  2G5H C;  3EEH A;  1T1A A;  4BJP A;  3Q7Z A;  5CPK A;  5GXQ B;  1N1J A;  4ZBE A;  4Y17 A;  3OPP A;  1T19 A;  2GX5 A;  3UPN A;  5HPF A;  2ZQD A;  4XZQ C;  2K2N A;  4IUK A;  3WA9 C;  4NYY A;  5AV8 C;  3AZJ A;  3OPR A;  1S6R A;  5B32 C;  3WRT A;  3EOI A;  3N8L A;  3KWQ C;  4Q0I A;  2XEP A;  3KXB B;  4HH3 A;  4OQ0 A;  2DMW A;  1I2W A;  5CPJ A;  3AV2 C;  2ZC6 B;  2VX8 A;  5BNV A;  1P34 D;  4YM6 D;  1LSV A;  2V20 A;  3HBR A;  4H9R A;  4ZUX C;  5AV6 A;  3A6N C;  1NLY A;  2FH5 A;  4AFI A;  5E5A C;  4Y13 A;  2J3T D;  2PBY A;  1W1Y A;  3W96 A;  2CV5 D;  4OP5 A;  4OOY A;  5HZH A;  1KX4 B;  3MGP A;  1P3I D;  1H3O A;  3AZM A;  1P3B A;  2EX9 A;  3BEB A;  5AV9 D;  3DWZ A;  4GN2 A;  4KZ5 A;  5TR7 A;  3A3I A;  5B2I D;  4N1X A;  3A0R A;  5BPV A;  4R23 A;  3T1Q B;  1ZLA C;  5I5L A;  3O3V A;  2PYO C;  1EAK A;  3G2Y A;  4C3Q A;  1OTE A;  1W2E A;  2F8N K;  2ZY4 A;  1DJA A;  3MGQ D;  2E8I A;  3V9R A;  4OPR A;  2WGV A;  3UNW A;  4R70 A;  5E2E A;  4IJF A;  3NHQ A;  4H9S C;  1SKO B;  5MC7 A;  2ZM8 A;  4YNR A;  5CGW A;  3ZG7 B;  4HGA B;  2QPN A;  4J8W D;  1XPB A;  2FN2 A;  3OOV A;  4LD9 A;  4CLC C;  4O8G A;  3WA9 B;  5DNM A;  1GA9 A;  5F69 A;  3PBN A;  5AV8 B;  1FOF A;  3AGD A;  1IFQ A;  3W97 B;  3AGE A;  5B32 B;  3EQU A;  5HSQ A;  4WYY A;  3REH C;  3MF0 A;  1TDL A;  1FIL A;  4IBE A;  3ICY A;  3AV2 B;  1E4D A;  4Z5T C;  2YFW B;  4RVA A;  2FZ0 A;  1SZV A;  5KMW A;  4ZUX B;  4J8V B;  4I39 A;  4H9N A;  3FG8 A;  4K0X A;  2BYM A;  4Z2L A;  3W4P A;  1YU3 A;  3REJ D;  1U35 C;  4XZQ D;  2LB5 A;  2F8N A;  2BYK A;  2V5O A;  4WEJ A;  4R1G A;  4DQY B;  2G2U A;  4UPK A;  1N9L A;  3W8K A;  3KWQ D;  1ALQ A;  4P0M A;  2NUT C;  2R78 A;  3B0D C;  1BZA A;  2WZX A;  2EFX A;  1XP4 A;  5CPI D;  3T4K A;  2HDU A;  5A90 A;  1T18 A;  3H0M C;  3ZYT A;  1IEM A;  1M19 B;  1LLB A;  5JA4 A;  1A0K A;  3S7N A;  2L0W A;  5DNN A;  3HUN A;  4ZJ3 A;  2PYO B;  1CK3 A;  1W1T A;  5GLB A;  3UE0 A;  1BT5 A;  5E5A D;  3K3D A;  1Z2C B;  4FCF A;  3W98 A;  1IYQ A;  4E3N A;  3C2W A;  4Y7P A;  5B1L B;  2WGW B;  4S2I A;  5KSH A;  4IVK A;  1Q2P A;  5HL6 A;  3T4J A;  3JVU A;  2UV0 E;  3LCE A;  1WWI A;  3LGO A;  2XF3 A;  3K2N A;  2JKR M;  1XGJ A;  4KUD C;  4MB5 A;  2VLG A;  2BAS A;  4PM8 A;  4PPR A;  2XGN A;  3VOL A;  1JWP A;  3TW8 A;  2NZD D;  2O9A A;  2VA0 A;  3UME A;  2W3H A;  2ZY5 A;  1MY8 A;  4IVI A;  2W27 A;  4WL9 A;  4OOL A;  5FQJ A;  2V8C A;  3AZL A;  2Z2M B;  3AZH A;  4HQA A;  2B02 A;  3A1I A;  4I3I A;  4R8P B;  5L09 A;  5F99 D;  1V9Y A;  3QNB A;  2B5R A;  5FDS A;  3A3J A;  1BH9 A;  2Y2G A;  1XJ3 A;  1P3F A;  2WGI A;  4WEL A;  1P3K C;  4WZS B;  4HP4 A;  4X23 A;  4IHQ A;  3V3S A;  4FH2 A;  2WYX A;  1YQS A;  3AN2 C;  4UQI S;  4CLC D;  3ZVW A;  3S1Y A;  1WWS A;  1EWZ A;  4JXS A;  2PYR A;  3CLO A;  1ESI A;  3C1C A;  3F6T A;  5LBR A;  1P3G A;  4S2J A;  1LI0 A;  4KZ9 A;  3REH D;  1FCO A;  3LIC A;  3IBR A;  4HH2 A;  2VGL S;  5AQ9 A;  4KGC B;  3GTC A;  4BBV A;  1W63 M;  4Z9Q A;  5DF7 A;  1P9R A;  4OKP A;  5AY8 C;  2K7S A;  4YWZ A;  3L28 A;  4GS9 A;  4E6X A;  3HLB A;  1H5X A;  1EI5 A;  3B0C T;  1B6W A;  1KU5 A;  3PHY A;  5AVB A;  3IHA A;  3MVD C;  3FPV A;  5B0Y B;  3KSY A;  3L2A A;  4B9O A;  4LRZ E;  2RL3 A;  2K31 A;  2EFU A;  4NEE D;  3F1N A;  3T4T A;  3KFU G;  4S2N C;  4WZ5 A;  3WD3 A;  3WTP A;  1STZ A;  4B4Z A;  4KUD B;  3LUQ A;  4Q0H A;  1YU2 A;  4QLC B;  3GVB A;  3HVF A;  4ESP A;  4WBG A;  3AZJ D;  4FSF A;  3LEL A;  1K55 A;  3L29 A;  5GT0 B;  3AYW C;  2P9V B;  3E4O A;  3G4P A;  1YAX A;  3FKV A; 
#chains in the Genus database with same CATH homology
 3C7U A;  2X01 A;  3Q1F A;  5F1F A;  4WMC D;  4WU8 D;  2QZ6 A;  2DCF A;  3BYD A;  5FAP A;  3A1K A;  1P3L C;  3REK A;  1S32 B;  3BM6 A;  1FR6 A;  1HQ3 A;  3NIA A;  1KVM A;  1ZG6 A;  3R45 A;  3C1B C;  1PW1 A;  4M3K A;  3W96 D;  3WAA A;  1IYS A;  5FDH A;  3KUY D;  1RCJ A;  1KX5 B;  5A93 A;  3AN2 B;  3AZI B;  1L2S A;  2QMI A;  4OLG A;  3AZK B;  1TZY C;  3BLM A;  1A7W A;  1KX3 A;  3AV1 B;  2FFF B;  4KHA A;  1EQZ A;  5C3I B;  3AZG B;  4GB7 A;  2HIO B;  4IBK A;  5GHZ A;  1ES4 A;  3GRJ A;  3LZ0 A;  2BLS A;  1YLT A;  5CHU A;  3SOI A;  1WE4 A;  1BH8 A;  4DKI A;  4S2K A;  4YS3 B;  2HP6 A;  4DE1 A;  1AOI C;  4OOM A;  4QNL A;  3MBZ A;  4U0X A;  1RGZ A;  1ONG A;  1TDG A;  4P85 A;  3O88 A;  3REL C;  3L26 A;  3HL9 A;  5B33 C;  4LD9 D;  4OQI A;  4XUJ A;  4DRT A;  5GT3 C;  5FI6 A;  5B40 A;  4H8R A;  2OV5 A;  4JXV A;  1BLC A;  4B4X A;  5AY8 D;  3M2J A;  3HRE A;  5B0Z C;  5GXQ A;  5FAQ A;  4F94 A;  1W8Y A;  2Y2L A;  3TU4 C;  4XUX A;  3IXB A;  5JRG A;  5GHX A;  3OPH A;  2Y4A A;  1P3L B;  5JYP A;  3LZ1 B;  1DJB A;  1RGY A;  1K6R A;  4GHL A;  3EQV A;  3C5A A;  2FJ7 C;  3KXB A;  4RX2 A;  3UT9 C;  2F8N D;  5GSU C;  3MGR B;  3MNN C;  3B6F D;  3Q7V B;  4EQI A;  5DVA A;  3IWI A;  4GKU A;  4R3J A;  3AYW D;  1YU0 A;  1BLS A;  1YMS A;  4OPY A;  1TZY B;  2J9O A;  4PM9 A;  1QMF A;  3DTM A;  1PWC A;  2LY8 A;  5HL1 A;  3HLF A;  2ARO C;  4LEN A;  1N4O A;  4CJN A;  3TSG A;  5DF9 A;  2HDQ A;  1KX4 A;  5DNN D;  3C1B D;  5AQA A;  3VSL A;  4E3M A;  1C3B A;  3FKE A;  1P3M B;  3VOZ A;  2ZD8 A;  1AOI B;  3LO7 A;  1CI9 A;  4Z66 B;  1K56 A;  1KE3 A;  3FV7 A;  1BTL A;  5B24 B;  3IHB A;  3X1S B;  4X68 A;  4KZ8 A;  2F2A C;  5BT1 C;  1HVB A;  3AZF D;  4OQG A;  3LY3 A;  4KQR A;  3AZL D;  5B0Z B;  3AZH D;  5B31 B;  1G68 A;  1WYC A;  2EX8 A;  1PWD A;  3WA9 A;  3DW0 A;  5FI7 A;  1YLZ A;  2WKE A;  1NZU A;  1P3F D;  3W97 A;  5CP6 B;  5B32 A;  4X55 A;  3SS5 A;  1P34 C;  4YM6 C;  5DF8 A;  4X23 D;  3AV2 A;  4J8X D;  4EV4 A;  4OJ6 A;  3UT9 B;  3MGS B;  4DRA A;  3MZD A;  5HW3 A;  5EVI D;  1M1A C;  4H9Q B;  4KQO A;  4J8V A;  3C4O A;  1P3G D;  3LJA C;  2CV5 C;  3VP3 A;  4NY2 A;  1Q9C A;  1SKF A;  3GV9 A;  3TU4 D;  1P3I C;  2ARO B;  5AV9 C;  2HUE C;  1L0E A;  5B2I C;  1M18 B;  5TFQ A;  3WKJ C;  1BUL A;  3PAE A;  4DXB A;  2FJ7 D;  3MZF A;  1XA1 A;  3B6G C;  1HTZ A;  1P3O D;  5D3O A;  5B1M C;  4DF6 A;  1M19 A;  1ID3 B;  2G5I C;  5GSU D;  3MNN D;  5FQI A;  5AVC B;  4IBX A;  1XA7 A;  4OJP A;  5HAR A;  1KVL A;  2W8S A;  1JWV A;  1F1E A;  3WTP D;  4KZB A;  4P87 A;  2VGK A;  1K4F A;  5B1L A;  2WGW A;  4WM9 A;  5GLD A;  3TOI A;  3O62 B;  5BNX B;  3LEL D;  4Y0T A;  3NDE A;  3IT9 A;  4J8W C;  4J8U B;  2OLU A;  5KSC A;  4CSR B;  4NE6 A;  3X1T B;  3VH6 W;  1PWG A;  5B31 G;  3X1V C;  3AFA B;  1K25 A;  4JXG A;  3ISG A;  1HQ3 D;  2C6W B;  1FCM A;  1TAF B;  4ZJ1 A;  1PZR A;  2ZC5 B;  4L0L A;  4RA7 A;  3RXW A;  3UDI A;  3WAA D;  5FAO A;  2Y2J A;  2NQB D;  3NBL A;  2WKI A;  3TG9 A;  5BT1 D;  4R8P A;  4N9L A;  1P3P B;  1PIO A;  3UN7 A;  2RIQ A;  1M6K A;  5CED A;  1F66 C;  2XK1 A;  4WU9 C;  3REJ C;  4KZ6 A;  4KEN B;  1EQZ D;  2CV5 B;  4KZ7 A;  3NI9 A;  1P3A B;  3UY6 A;  1JTD A;  5AV5 B;  1P3I B;  4IBI A;  2HDS A;  4E45 A;  1NRF A;  1IYP A;  3O86 A;  4IBR A;  4EBL A;  5CPI C;  3X1U B;  3V3R A;  4KGC A;  4R3B A;  1M1A D;  3VFH A;  3MGQ B;  4E3L A;  4C75 A;  5B2J C;  3LJA D;  4UHU A;  1BSG A;  4LV1 A;  4NE3 A;  1GHM A;  3AZN B;  2XR0 A;  3VFF A;  5B0Y A;  2ZQC A;  3P5J B;  4G91 B;  3BFG A;  3WKJ D;  4KZA A;  3B6G D;  2NZD C;  1KGF A;  5B1M D;  3UTA A;  4QLC A;  3IF6 B;  5JRG D;  1KDW A;  5A91 A;  3ZFZ A;  1E3U A;  3L27 A;  1ES5 A;  3ZVT A;  5GT0 A;  4DE2 A;  2CC1 A;  5A92 A;  5EOE A;  3SH9 A;  5F99 C;  5GLA A;  3BFD A;  4PM5 A;  3UTB D;  1S32 A;  1N9B A;  3SS3 A;  1W79 A;  3B3X A;  3X1V D;  4XZQ B;  1HZO A;  3PBT A;  1HTA A;  3N7W A;  3QHY A;  4IBJ A;  3SS4 A;  1KX4 D;  1KX5 A;  1FQG A;  3AN2 A;  3AZI A;  3AZK A;  1ERM A;  3GMW A;  3KWQ B;  3AV1 A;  2ZC4 B;  4JJN A;  3H0R C;  3AZG A;  4QHC A;  2HIO A;  3E2L A;  4MBK A;  3CJM A;  4BEN A;  5FQM A;  2EXB A;  3A6N B;  1K56 D;  1BUE A;  1R4V A;  2YFV B;  5E5A B;  3AZE C;  4KZ4 A;  3REI C;  1W8Q A;  3UPP A;  1F66 D;  4WU9 D;  4E3I A;  1JFI B;  1YLP A;  4MEZ A;  2Y91 A;  4YS3 A;  2PU2 A;  4B88 A;  2Y2N A;  3RXX A;  5CPK C;  4BD0 A;  2HDR A;  4QJG A;  4GDB A;  1GHI A;  1YU1 A;  5E2G A;  1ZLA B;  4IED A;  3AZJ C;  1W7F A;  2IWC A;  3EPH A;  4NET A;  1YUE A;  3G34 A;  4Z2M G;  4WU8 C;  5B2J D;  3S22 A;  5G49 B;  4CAY B;  1K54 A;  1SDN A;  4E44 A;  1L0G A;  4OON A;  5AV6 C;  3P09 A;  3LZ1 A;  2J9P A;  4JPM A;  4FD8 A;  4J8V D;  3ITB A;  4WNN B;  3W96 C;  3WS1 A;  3ZG8 B;  3VH5 A;  1ULY A;  3KUY C;  3MGP C;  4R4R A;  3AZM C;  1P3B C;  3MGR A;  3Q7V A;  1ESU A;  4E6W A;  5B32 G;  1FCN A;  4OPQ A;  3REH B;  3VH5 T;  4UUZ B;  1M19 D;  4Z5T B;  4E3K A;  4NE5 A;  4HBU A;  3UO9 A;  3M6B A;  1PZO A;  3HUM A;  5KZH A;  2XDM A;  5B1L D;  1IEL A;  1U35 B;  5KDM A;  1P3M A;  3ZNT A;  2XFS A;  4KG5 A;  4PMA A;  3IWQ A;  4Z66 A;  3WS2 A;  3Q07 A;  3SH8 A;  2L5A A;  3KS4 A;  2Q9M A;  3B0D B;  5B24 A;  4LD9 C;  2ZQ9 A;  3X1S A;  1XX2 A;  1ES3 A;  1B67 A;  4ZTK A;  4XUZ A;  3G31 A;  4OVD A;  2Y2O A;  3AZE D;  1K57 A;  3REI D;  3WS0 A;  4WU8 B;  1MXO A;  5G18 A;  5B31 A;  2Y2Q A;  4R8P D;  4H9R B;  1XGI A;  5CPK D;  1ZC2 A;  1K4E A;  3N8S A;  5CP6 A;  4HEF A;  4C6Y A;  4YFM A;  3B6F C;  3W99 A;  3KUY B;  2ZC7 A;  5EOO A;  4OJO A;  1LL5 A;  3Q81 A;  3MGS A;  4DDS A;  3N6I A;  1DJC A;  4E3O A;  4HES A;  5CPJ D;  3UPO A;  2HPB A;  4Y0O A;  4QU3 A;  5DNN C;  4X56 A;  5AV6 D;  3W4O A;  3W98 C;  4X69 A;  1M18 A;  1P3K B;  1Y54 A;  4GDN A;  3CMZ A;  4NK3 A;  4A5R A;  1O7E A;  2EXA A;  1ID3 A;  3MGP D;  3BEC A;  3AZM D;  1P3B D;  2ZC3 B;  3NQU A;  2XD5 A;  3D4F A;  2WAD A;  3IXH A;  5AVC A;  4NZ1 A;  2J7V A;  3IWO A;  1AXB A;  4N9K A;  5HX9 A;  4LD9 B;  3AZF C;  3UTA D;  4QLC D;  1GCE A;  3O62 A;  5AQB A;  3NC8 A;  1E3U D;  5AY8 B;  5GT0 D;  3AZL C;  4YIN A;  4J8U A;  3AZH C;  1NZO A;  3VOY A;  4CSR A;  2XQZ A;  3X1T A;  2R9X A;  3AFA A;  3MVD B;  4Q8I A;  1P3F C;  4PM7 A;  5CEC A;  3PTE A;  1TAF A;  4X23 C;  2BYM B;  2VGJ A;  4J8X C;  1VM1 A;  4Y0U A;  2F8N B;  5DNM D;  3B6F B;  1NY0 A;  5FUG B;  4G92 C;  5EVI C;  3C1C C;  1KGG A;  3AYW B;  1P3G C;  1P3P A;  1O07 A;  3WWX A;  3IQA A;  4JJN D;  5M18 A;  3AZG D;  1P3A A;  2HIO D;  5BS7 A;  5AV5 A;  5EPH A;  1P3I A;  2F8N H;  3DWK A;  3EPK A;  3C1B B;  3ITA A;  1P3O C;  1NYM A;  3O87 A;  3X1U A;  4YS3 D;  5HFO A;  3FYZ A;  1H8Z A;  3IH8 A;  5EVL A;  5CER A;  4WZ5 C;  3WTP C;  3MGQ A;  2I72 A;  4EUZ A;  4LV0 A;  2WZZ A;  3AZN A;  3LEL C;  3AZF B;  3WRZ A;  4QD4 A;  2H0T A;  3W98 D;  3AZL B;  2H10 A;  2DRW A;  5BO0 B;  3REK C;  3IF6 A;  1HQ3 C;  3V5M A;  3B0C W;  5FSR A;  3NDG A;  3V39 A;  4EO5 C;  3WAA C;  1YMX A;  3REL B;  2NQB C;  5B33 B;  5DTT A;  4J8X B;  5GT3 B;  2A49 A;  4G92 B;  5EVI B;  1K38 A;  1KX3 C;  2HP9 A;  1EQZ C;  3HLG A;  1JVJ A;  2P74 A;  3KS8 A;  2H0Y A;  3FWL A;  5J8X A;  3ZNY A;  3TU4 B;  3LZ0 C;  4XZQ A;  2ZM2 A;  5FQ9 A;  5AV8 A;  3HSH A;  5CHL B;  1J9M A;  3KWQ A;  2FJ7 B;  3PBR A;  2R9W A;  1G6A A;  1P3O B;  5CTM A;  1QME A;  4KG6 A;  2JE5 A;  5GSU B;  1P3M D;  3N8R A;  3MNN B;  2YFW A;  3C1C D;  4Z66 D;  4ZUX A;  3A6N A;  4HBT A;  3C4P A;  1MPL A;  5E5A A;  3OCL A;  2IWB A;  1TVF A;  3PBO A;  5B24 D;  4RX3 A;  1JFI A;  3X1S D;  2WAF A;  3HLC A;  1L0D A;  5B40 C;  5GL9 A;  3ZG0 A;  1HD8 A;  3EPJ A;  5GXQ C;  4ID4 A;  3HLE A;  1YM1 A;  4IBB A;  5B31 D;  5JRG C;  5AVB D;  1WYB A;  2Y59 A;  1GHP A;  1ZLA A;  1NXY A;  2RCX A;  3S4X A;  4UAA A;  4GD6 A;  2PYO A;  3KXB C;  3VMA A;  4JKT A;  2ZY3 A;  3WAA B;  5G49 A;  4UA6 A;  3W99 D;  2NQB B;  3OC2 A;  4BQM A;  3ZG9 B;  3UTB C;  3HLW A;  4LCM A;  3MGS D;  1BLH A;  4H9S A;  1RP5 A;  4JF5 A;  4LV3 A;  4WNN A;  1CEG A;  3QNC A;  1KX4 C;  3REK D;  4UA9 A;  4JLF A;  2DF4 C;  2OSU A;  1ZKJ A;  2WUQ A;  2ZQ8 A;  5M1A A;  4OLD A;  1P34 B;  4IBD A;  4YM6 B;  3M2K A;  3RJU A;  3REH A;  1ID3 D;  3MKF A;  4QB8 A;  3MXR A;  4Z5T A;  3FZC A;  1M1A B;  4MLL A;  2WK0 A;  3IP4 C;  1KX3 D;  3LJA B;  5DTK A;  4JF4 A;  4N1H A;  3LZ0 D;  1U35 A;  3IXD A;  5AV9 B;  2HUE B;  5B2I B;  1YLY A;  4HGA C;  3WKJ B;  4OJ5 A;  4J8U D;  2A3U A;  4OPZ A;  4DE0 A;  4ZDX A;  3B6G B;  3X1T D;  1VQQ A;  5B1M B;  5JRG B;  3Q82 A;  3AFA D;  1SHV A;  2V2F F;  2XFT A;  2ZJ9 A;  3W97 C;  1BLP A;  1KDS A;  4JF6 A;  4WMC A;  4WU8 A;  2DQN C;  4XUJ D;  2X71 A;  3P98 A;  5B40 D;  4S2L A;  3H0L C;  1MWT A;  3UTB B;  4J8V C;  1P3P D;  1PW8 A;  5GXQ D;  4J8W B;  4NZ5 A;  4GD8 A;  4KUD A;  3X1V B;  3ZCZ A;  1P3A D;  3KUY A;  3GSG A;  1Z6F A;  4DDY A;  5AV5 D;  4EWF A;  2CWE A;  1YU4 A;  2P9V A;  3OCN A;  3KXB D;  3HUO A;  3X1U D;  3PAG A;  1M19 C;  2RVQ D;  2V1Z A;  3OZH A;  5CHM A;  4KZ3 A;  1F66 B;  5GHY A;  4WU9 B;  3REJ B;  5B1L C;  1P3K A;  3BFF A;  5CGX A;  2Q9N A;  2IOU A;  4NZ3 A;  3AZN D;  4ZJ2 A;  5CPI B;  3NQJ B;  2JBF A;  4BD1 A;  4Z2M H;  3LY4 A;  2WKH A;  4WEK A;  4H9P B;  5FQQ A;  5AY8 A;  5B2J B;  4U0T A;  3MXS A;  4R8P C;  1SCW A;  3MVD A;  2DNS A;  3L25 A;  3IH9 A;  4WV4 B;  1YLJ A;  4BLM A;  2Y2M A;  4RYE A;  4S2N A;  2NZD B;  3EPL A;  4JBF A;  2Y55 A;  3WA9 D;  3IXG A;  3B6F A;  3E2K A;  5FUG A;  5AV8 D;  4IBF A;  4BL3 A;  4CPK A;  5I94 A;  3W97 D;  2X02 A;  3AYW A;  5CPJ C;  5B32 D;  1DY6 A;  1MWU A;  4R0Q A;  3MFD A;  3AV2 D;  4KGC C;  4D2O A;  5CTN A;  4BL2 A;  5F99 B;  5FI2 A;  3ZHH A;  1P3L A;  3G35 A;  2WAE A;  3V50 A;  4ZUX D;  4X53 A;  3A6N D;  2IWD A;  1L0F A;  2HP5 A;  5TGF A;  3C1B A;  3EG5 B;  5B0Y C;  4M6B A;  3GQZ A;  3HON A;  3ZGA B;  4QY5 A;  1TZY A;  2BG1 A;  2Y2K A;  4S2M A;  1H8Y A;  3UTA C;  4QLC C;  1ZLA D;  3A3F A;  3AZF A;  5GT0 C;  2JC7 A;  2C5W B;  2PYO D;  4NFT A;  4S2P A;  3AZE B;  3REI B;  3A3D A;  1E25 A;  3I7J A;  5BO0 A;  4H9O B;  1S0W A;  1AOI A;  1LL9 A;  4R4S A;  1S32 C;  5CPK B;  4OP8 A;  1N1J B;  1IYO A;  2ZY2 A;  1LHY A;  5GLC A;  5DNM C;  1XXM A;  3REL A;  3NCK A;  1I2S A;  5B33 A;  4J8X A;  3AZJ B;  1KX5 C;  3AZI C;  5EE8 A;  5GT3 A;  3AZK C;  5EVI A;  2Y2P A;  2FFY A;  2UWX A;  4GH9 A;  3AV1 C;  2J8P A;  5CPJ B;  5F83 A;  5B0Z A;  1KGE A;  3MKE A;  5BNV B;  4JJN C;  5C3I C;  1KE0 A;  3AZG C;  3G30 A;  1ERO A;  3C7V A;  2HIO C;  3TU4 A;  1YLW A;  1LI9 A;  5AV6 B;  3G32 A;  3VP0 A;  4Z5T D;  1ES2 A;  2ZLY A;  2Y2H A;  2FJ7 A;  3W96 B;  4YS3 C;  1P3O A;  3BLS A;  3PBS A;  2XD1 A;  3WS4 A;  1U35 D;  4EBN A;  3MGP B;  3UT9 A;  4IBG A;  1H3O B;  5GSU A;  3AZM B;  1P3B B;  3MNN A;  4H9Q A;  4WJ3 C;  5CGS A;  5BOH A;  1U60 A;  2Z2L B;  4KG2 A;  2JCH A;  2ZM0 A;  4K0W A;  3SH7 A;  4KGC D;  3WTP E;  3CZD A;  3UTA B;  2ARO A;  4MBF A;  1BFM A;  4DRB A;  2PU4 A;  4NYU A;  3N4I A;  1K54 C;  3V9R B;  1FR1 A;  1K6S A;  5B0Y D;  1W5D A;  3LZ1 C;  3ZG5 A;  4MBH A;  1CI8 A;  1TEM A;  3BFC A;  4KUD D;  2G2W A;  3MGR C;  5DNM B;  2NQB A;  3FDD A;  2GDN A;  5BNX A;  4LCL A;  1OME A;  3HLD A;  3VP2 A;  5AQ7 A;  3IF5 A;  1T3U A;  4QY6 A;  4JJN B;  5E2H A;  3N3F A;  5HAP A;  3VP1 A;  1S32 D;  5FQK A;  4H9N B;  3B0B A;  3PBQ A;  1P3K D;  1P34 A;  5HAI A;  4YM6 A;  2BYK B;  3A3E A;  1P3M C;  2OLV A;  2VQR A;  1KX5 D;  3VH6 A;  1IKI A;  3AN2 D;  3AZI D;  4Z66 C;  3AZK D;  5F82 A;  1M1A A;  5E2F A;  1MBL A;  3AV1 D;  5B24 C;  4OUI A;  1FSW A;  4ZBJ C;  3LJA A;  3X1S C;  2CV5 A;  5F1G A;  5E43 A;  5JA4 B;  3VH6 T;  5DNN B;  2H5S A;  5AV9 A;  3VH5 W;  5B2I A;  3W98 B;  1K57 C;  5FA7 A;  3WKJ A;  1NJ4 A;  5DTS A;  1JWZ A;  5B31 C;  5AVB C;  3B6G A;  3G2Z A;  2EX6 A;  4K91 A;  5B1M A;  4OJL A;  3MVD D;  4IBC A;  4FH4 A;  4LG2 A;  1IKG A;  5CP6 C;  2IO5 C;  3W99 C;  3UE3 A;  3LEZ A;  1KE4 A;  3WX7 A;  1K55 C;  1XKZ A;  3MGS C;  4KQQ A;  5EUA A;  1GA0 A;  3UE1 A;  1SDE A;  3MZE A;  5FAS A;  3UTB A;  3GR2 A;  4J8W A;  3AZH B;  3ZDJ A;  3VP4 A;  4AWL C;  5EEC A;  4GNU A;  3X1V A;  1P3L D;  1BH9 B;  3M6H A;  3LZ1 D;  1PZP A;  1P3F B;  1M18 C;  1Q2Q A;  1M40 A;  4E3J A;  4O7D A;  1ERQ A;  4X23 B;  1ID3 C;  2F8N G;  1PYY A;  5KDM B;  3MGR D;  2ZMA A;  5AVC C;  3NY4 A;  3C1C B;  3OPL A;  3UDX A;  1P3G B;  1TZY D;  1JTG A;  1F66 A;  4XXR A;  4WU9 A;  3REJ A;  4IJE A;  5JYO A;  4ZBJ B;  3O62 C;  5U47 A;  4J8U C;  4N92 A;  1FSY A;  4OQH A;  1NYY A;  1MWS A;  4OH0 A;  5CPI A;  3X1T C;  3NQJ A;  5AVB B;  3AFA C;  1AOI D;  5CRF A;  1PI4 A;  4DXC A;  3AGF A;  4H9P A;  2YFV A;  3WTP B;  2IO5 B;  5B2J A;  4XUJ C;  2ZQ7 A;  3REL D;  3W99 B;  2JSS A;  3UDF A;  4WZ4 A;  5B33 D;  3LEL B;  5GT3 D;  1P3P C;  5CEB A;  4GOG A;  5L2F A;  1I5Q A;  5B0Z D;  2ZQA A;  2Y2I A;  3FKW A;  1P3A C;  2NZD A;  4AWL B;  5BS7 C;  3REK B;  5CXW A;  5AV5 C;  5FAT A;  1HQ3 B;  4ZAM A;  1ZG4 A;  4S2O A;  3R45 B;  5CP6 D;  3W4Q A;  2EX2 A;  3X1U C;  4EO5 B;  2RVQ C;  4CAY A;  4U3T A;  5M19 A;  3UT9 D;  5F99 A;  3NQU B;  1PI5 A;  3JYI A;  1KX3 B;  4GHA A;  1CEF A;  3MGQ C;  4JXW A;  4UA7 A;  2ZM5 A;  4KHA B;  2J8Y A;  2XH9 A;  1EQZ B;  2XLN A;  1MWR A;  4DE3 A;  3AZN C;  3AL0 C;  3LZ0 B;  2ARO D;  3VSK A;  4G91 C;  4P6B A;  3BFE A;  3CG5 A;  1YT4 A;  1M18 D;  1BH8 B;  1MKI A;  4NZ4 A;  3IF6 C;  4UUZ A;  1ONH A;  4LV2 A;  3WS5 A;  4GZB A;  4PM6 A;  5AVC D;  3BRM A;  5CHJ A;  4X6T A;  4EBP A;  3AZE A;  3REI A;  4MNR A;  4XUJ B;  5IHV A;  5B40 B;  3O62 D;  5HAQ A;  4H9O A;  2G5H C;  4BJP A;  3Q7Z A;  5CPK A;  5GXQ B;  1N1J A;  4ZBE A;  3OPP A;  3UPN A;  2ZQD A;  4XZQ C;  3WA9 C;  4NYY A;  5AV8 C;  3AZJ A;  3OPR A;  1S6R A;  5B32 C;  3WRT A;  3N8L A;  3KWQ C;  2XEP A;  3KXB B;  4OQ0 A;  1I2W A;  5CPJ A;  3AV2 C;  2ZC6 B;  5BNV A;  1P34 D;  4YM6 D;  2V20 A;  3HBR A;  4H9R A;  4ZUX C;  5AV6 A;  3A6N C;  5E5A C;  2PBY A;  3W96 A;  2CV5 D;  4OP5 A;  4OOY A;  1KX4 B;  3MGP A;  1P3I D;  1H3O A;  3AZM A;  1P3B A;  2EX9 A;  3BEB A;  5AV9 D;  3DWZ A;  4GN2 A;  4KZ5 A;  5TR7 A;  3A3I A;  5B2I D;  4N1X A;  5BPV A;  4R23 A;  1ZLA C;  3O3V A;  2PYO C;  3G2Y A;  4C3Q A;  1W2E A;  2F8N K;  2ZY4 A;  1DJA A;  3MGQ D;  2E8I A;  3V9R A;  4OPR A;  2WGV A;  3UNW A;  5E2E A;  4IJF A;  4H9S C;  2ZM8 A;  5CGW A;  3ZG7 B;  4HGA B;  2QPN A;  4J8W D;  1XPB A;  4LD9 A;  3WA9 B;  5DNM A;  1GA9 A;  3PBN A;  5AV8 B;  1FOF A;  3AGD A;  3W97 B;  3AGE A;  5B32 B;  3EQU A;  4WYY A;  3REH C;  1TDL A;  4IBE A;  3AV2 B;  1E4D A;  4Z5T C;  2YFW B;  4RVA A;  5KMW A;  4ZUX B;  4J8V B;  4H9N A;  4K0X A;  2BYM A;  3W4P A;  1YU3 A;  3REJ D;  1U35 C;  4XZQ D;  2F8N A;  2BYK A;  4WEJ A;  4R1G A;  4DQY B;  2G2U A;  4UPK A;  3W8K A;  3KWQ D;  1ALQ A;  4P0M A;  3B0D C;  1BZA A;  2WZX A;  2EFX A;  1XP4 A;  5CPI D;  5A90 A;  2HDU A;  3H0M C;  1IEM A;  1M19 B;  1LLB A;  5JA4 A;  5DNN A;  3HUN A;  4ZJ3 A;  2PYO B;  1CK3 A;  5GLB A;  3UE0 A;  1BT5 A;  5E5A D;  4FCF A;  1Z2C B;  4E3N A;  3W98 A;  1IYQ A;  4Y7P A;  5B1L B;  2WGW B;  4S2I A;  5KSH A;  4IVK A;  1Q2P A;  3LCE A;  1WWI A;  2XF3 A;  1XGJ A;  4KUD C;  4PM8 A;  4PPR A;  2XGN A;  1JWP A;  2NZD D;  2ZY5 A;  1MY8 A;  4IVI A;  4OOL A;  5FQJ A;  3AZL A;  2Z2M B;  3AZH A;  3A1I A;  4R8P B;  5F99 D;  3QNB A;  2B5R A;  3A3J A;  1BH9 A;  2Y2G A;  1P3F A;  2WGI A;  4WEL A;  1P3K C;  4WZS B;  4X23 A;  3V3S A;  4FH2 A;  2WYX A;  1YQS A;  3AN2 C;  3ZVW A;  3S1Y A;  1WWS A;  1EWZ A;  4JXS A;  1ESI A;  3C1C A;  3F6T A;  1P3G A;  4S2J A;  1LI0 A;  4KZ9 A;  3REH D;  1FCO A;  5AQ9 A;  4KGC B;  3GTC A;  4Z9Q A;  5DF7 A;  4OKP A;  5AY8 C;  3L28 A;  4E6X A;  3HLB A;  1H5X A;  1EI5 A;  3B0C T;  1B6W A;  1KU5 A;  5AVB A;  3IHA A;  3MVD C;  5B0Y B;  3KSY A;  3L2A A;  2RL3 A;  2EFU A;  3KFU G;  4S2N C;  4WZ5 A;  4B4Z A;  3WTP A;  4KUD B;  1YU2 A;  4QLC B;  3GVB A;  3HVF A;  4WBG A;  3AZJ D;  4FSF A;  3LEL A;  1K55 A;  3L29 A;  5GT0 B;  3AYW C;  2P9V B;  3G4P A;  3FKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...