2Y2MA

Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (e08)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
489
structure length
471
Chain Sequence
ISEITYSDGTVIASISRDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRDLAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQTGAILGFVGGRNYQENQNNHAFDTKRSPASTTKPLLAYGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYSWNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAADGRVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTSLNPTLANADWIGKTGTTGQDENMWLMLSTPRLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGNERFALDPSVVKSEVLKSTGQKPGKVSVEGKEVEVTGSTVTSYWANKSGAPATSYRFAIGGSDADYQNAWSSIVGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLIN-BINDING PROTEIN 1B
publication title Structure-Guided Design of Cell Wall Biosynthesis Inhibitors that Overcome Beta-Lactam Resistance in Staphylococcus Aureus (Mrsa).
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 163
structure length 471
sequence length 489
ec nomenclature ec 2.3.2.-:
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.80 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2y2mA01
2.10.10.60 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 2y2mA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2y2mA02
1PWGA 3MKFA 2BLSA 4P6BA 5M18A 3W4PA 4N1HA 4WYYA 1FCOA 4LCMA 1H5XA 5U47A 4ZJ3A 3W8KA 3HREA 4S2KA 4S2MA 5A91A 2ZC6B 4E6WA 3ZG9B 4DE3A 1CK3A 1ES4A 3C4OA 1YLWA 1PI4A 3UPPA 4S2PA 1LL9A 2ZC4B 1K57A 3HLGA 4F94A 2EX9A 4OH0A 1FCMA 1NYYA 1XX2A 3EQUA 4EUZA 3LEZA 5HL1A 1K25A 1SDEA 3M6HA 3BEBA 3IF6B 4R23A 2J9PA 2P9VB 1E3UD 2OV5A 1ERQA 1HZOA 1NZOA 4KZ4A 5BOHA 1ONGA 2WADA 4OPYA 2WKHA 2JE5A 5DF9A 3UE1A 1IELA 1YM1A 1K57C 1MWUA 3IF5A 3N8LA 5FQIA 3ZVTA 3A3DA 4JXVA 2XH9A 5FASA 1I5QA 2XDMA 2DRWA 4OP5A 4QD4A 2OLVA 2X01A 3V39A 2C6WB 3PBQA 5EE8A 3O3VA 4MEZA 2QZ6A 1LHYA 4U0XA 3VSLA 3A3EA 1NRFA 1YLJA 3TG9A 3UDXA 1IYOA 4ID4A 4LCLA 2R9XA 1L0EA 3BLMA 2XD1A 4BQMA 1E3UA 3O87A 2A3UA 2XR0A 4OOYA 4N92A 5EOOA 4UHUA 3VP1A 4WELA 1TDLA 4Y0UA 3PAEA 4Q8IA 1CEFA 3HLDA 4FSFA 3HBRA 3HVFA 4OOLA 4A5RA 1PWCA 3NCKA 3VFFA 3WS0A 5HAQA 4HBUA 2XFSA 1Z6FA 1ZG6A 4OQGA 1IEMA 5EPHA 3GRJA 3E2LA 5HAIA 3SH8A 2HDRA 3WS5A 3FV7A 4BL2A 4XUXA 3ZG7B 3PBSA 5CEBA 3A3IA 1CEGA 2GDNA 3N8SA 5CTMA 3P09A 1J9MA 3VP4A 3TOIA 2QPNA 5HW3A 2Y2JA 2WKEA 1YLYA 1K6RA 4OQHA 2IWCA 1PZOA 2ZQ7A 1XA7A 3SS4A 2WGWB 4JKTA 5AQAA 3LY4A 3FKWA 4DE2A 1RGYA 5GLAA 4ZJ1A 5A93A 2HP5A 2XFTA 1FR1A 4GDBA 4MNRA 3RXXA 3IWQA 4P0MA 1E4DA 2V20A 4DRTA 3HLWA 3G35A 1NY0A 4FD8A 3ZGAB 4E3IA 1NZUA 3VP3A 1ZG4A 3UY6A 4IBRA 5CHMA 5DTTA 4E3NA 3N8RA 3BFDA 4HBTA 3UNWA 3PBNA 1KDWA 3C7VA 4EV4A 5DTSA 4JF5A 3VSKA 4ZBEA 2ZC3B 3OCLA 1FOFA 1S6RA 4B4XA 5FI2A 2QMIA 3FWLA 3B3XA 5CTNA 2IWDA 2Z2MB 2HDUA 3V3SA 5I94A 4KZ9A 4R0QA 1G6AA 1K54A 3V50A 4LV2A 1JWZA 1GA0A 3VFHA 2Y4AA 3MZFA 2C5WB 3MZEA 5FQJA 4BL3A 4OOMA 5KSHA 1WE4A 4OPQA 1IYQA 4BLMA 5GLBA 3UN7A 1EWZA 2BG1A 4QHCA 1N9BA 1ES2A 4P87A 5TR7A 5CERA 4KZ8A 4ZAMA 3SS3A 1SCWA 5FAQA 2H0TA 3GVBA 3Q7VB 1K38A 1IYSA 3FYZA 5CGXA 3BFCA 1LI9A 1MBLA 4JLFA 1NXYA 2V1ZA 2XD5A 4NK3A 4JXGA 4KZ3A 4PM6A 1XXMA 5M19A 1PI5A 1XKZA 1PW1A 4MBHA 3Q81A 2HP6A 4PM9A 3BFEA 2R9WA 1GA9A 2EXAA 1JWVA 1MPLA 2XGNA 3MXRA 4ZJ2A 3ISGA 4EBLA 3MXSA 3ZG8B 3CJMA 4OVDA 3IXDA 1BULA 2Y59A 3HUMA 4U3TA 5JYOA 4KQOA 5EVID 3ZDJA 3GQZA 4LV0A 4GN2A 4XXRA 1KE4A 2IWBA 4IVKA 4UA7A 1DJCA 3VP2A 4JPMA 1O7EA 1WYCA 2A49A 4GD8A 5EOEA 4BJPA 3D4FA 4C6YA 1XPBA 4MBKA 4EBPA 1FSWA 2WKIA 2HDSA 5AQ9A 1IKIA 4E3KA 1BLPA 1W8QA 1FQGA 5GHZA 1MXOA 3HLBA 4B4ZA 1DJAA 4E3OA 1QMFA 1L0DA 1Q2QA 4KZBA 4OQIA 2Q9MA 2UWXA 5CGWA 5AQBA 5CECA 1W8YA 5EVIA 1BT5A 3GMWA 1W7FA 4H8RA 5CHJA 5GLDA 3RXWA 1RGZA 3SH9A 2XK1A 3MZDA 1ES3A 3G31A 1MWTA 5GL9A 5A90A 3GV9A 2EX2A 3NC8A 4KENB 5TFQA 4S2NA 4QJGA 3LY3A 3PBTA 3AGEA 5F83A 2WUQA 1CI8A 5DF7A 5GHXA 2Y2HA 2Z2LB 2Y2OA 1PWDA 1WYBA 5EVIC 4EWFA 4DXBA 1W5DA 4WEJA 3TSGA 4DF6A 5F82A 3IXGA 3Q7ZA 4RYEA 4Z9QA 4S2NC 1QMEA 1EI5A 3QHYA 1K6SA 3UDFA 3CG5A 2WGVA 3IXBA 4DKIA 4E3LA 4KG5A 1KVLA 2Y2MA 4R4SA 3ZHHA 4DXCA 3Q82A 2H5SA 4GNUA 4O7DA 3FZCA 1ZC2A 3IH9A 3VOYA 2EFXA 3BLSA 3HL9A 1TVFA 1FCNA 2DNSA 4KQQA 1M6KA 2JBFA 3QNCA 2PBYA 1TEMA 4RVAA 3M6BA 3BYDA 4OPZA 3CZDA 2Y2NA 1K4FA 4OONA 2JC7A 4KZ5A 4QY6A 2H0YA 4R1GA 3DWKA 3IWIA 1K55A 2V2FF 5E2FA 3ZCZA 5FATA 3E2KA 5JYPA 1ERMA 4PMAA 3WWXA 3W4OA 1MWRA 3WRZA 1JTGA 1N4OA 4K0WA 3UE3A 1BLCA 2EFUA 2ZJ9A 1GHMA 2ZQ9A 4RX3A 3Q07A 4NETA 3V3RA 4BD1A 4RX2A 5FA7A 1M40A 3PBOA 4WZ4A 3PAGA 5FQMA 2WAEA 3MFDA 3WS1A 3AGDA 5E2EA 3IQAA 4PM7A 4K0XA 3IF6A 3HUOA 3SOIA 3ZNYA 1K55C 2P9VA 3BRMA 5DF8A 1JVJA 3VMAA 1LL5A 2DCFA 3UO9A 3ZFZA 2ZM8A 1RCJA 4KQRA 1DY6A 5HAPA 3OCNA 4FCFA 4S2OA 2ZMAA 5L2FA 5CHUA 3IHBA 3N4IA 1KGFA 4QB8A 3WRTA 3ITAA 2J7VA 3C5AA 4ZDXA 4FH4A 4WBGA 4K91A 4MBFA 4P85A 1E25A 3IF6C 1SDNA 4YFMA 3N6IA 5EECA 1EROA 1MWSA 3A3JA 3LCEA 2X02A 3EQVA 3GSGA 4WM9A 5IHVA 4UAAA 4QY5A 3IHAA 4Y0OA 1IYPA 1BLHA 3N7WA 2H10A 2HPBA 5FAOA 4C75A 1ALQA 1LLBA 4KG6A 1ESIA 4QU3A 5M1AA 4DE1A 3AGFA 4S2IA 4FH2A 4HESA 4GD6A 1G68A 1XGIA 2E8IA 4GB7A 5TGFA 2Y2KA 2Y2QA 3G32A 5EUAA 1YMXA 4X56A 5A92A 2HDQA 1K56D 4RA7A 2OSUA 3OPPA 4YINA 4KZ6A 1TDGA 3BECA 4X6TA 4GZBA 1KE0A 1I2WA 4IBXA 4S2LA 3SS5A 3IWOA 4Y7PA 1PYYA 4DDSA 5FQ9A 3M2JA 1BTLA 1L0FA 1PW8A 1KGEA 2RCXA 3DTMA 1JTDA 4IEDA 1MKIA 2ZQCA 2OLUA 2WGWA 4WEKA 4Y0TA 2WK0A 1DJBA 1ESUA 2EX8A 4GKUA 1YLZA 4R3JA 5FSRA 3VOZA 3PBRA 2PU2A 1K56A 1LI0A 1S0WA 1YMSA 4M3KA 2ZD8A 4N1XA 5GHYA 4LV1A 1C3BA 1XGJA 1GHPA 1MY8A 2WGIA 3OPLA 3ZG5A 1FR6A 1PIOA 3Q1FA 1Q2PA 1H8YA 3BFFA 1PZPA 3GTCA 4S2JA 2Y2IA 4OP8A 5E2HA 3G34A 4LENA 3G2YA 5D3OA 3NY4A 3S1YA 3V5MA 2WAFA 3NBLA 5HX9A 4OQ0A 3NI9A 5AQ7A 5CXWA 1FSYA 4L0LA 1BSGA 4KZAA 3CMZA 4UA6A 4BENA 2Y55A 1KDSA 3WS2A 1ONHA 1I2SA 5EVLA 1VQQA 4IVIA 4B88A 1O07A 4U0TA 5DTKA 5DVAA 1YLTA 2ZLYA 1Y54A 2Y91A 1YLPA 3WS4A 4GDNA 1KE3A 2EXBA 4JBFA 3OC2A 4X55A 5FDHA 2Y2GA 1HVBA 5KMWA 3HUNA 2JCHA 4PM5A 1AXBA 3NIAA 3LO7A 1XP4A 5CEDA 1CI9A 3W4QA 4X68A 5E43A 1XA1A 3Q7VA 4BD0A 3MBZA 3HLEA 3IT9A 4C3QA 3MKEA 1BZAA 4HEFA 3G30A 1VM1A 1NYMA 3S22A 1IKGA 4CPKA 2RL3A 1RP5A 1BUEA 3BFGA 2XF3A 5F1FA 3ITBA 3P98A 3FKVA 5E2GA 3ZG0A 3JYIA 4EBNA 1L2SA 5G18A 3O86A 2WZXA 4LV3A 2ZC5B 4R3BA 3UE0A 4X69A 4KZ7A 4OLGA 2P74A 2XEPA 2X71A 4PPRA 2G2WA 3SH7A 4WMCD 4WZ5A 1NJ4A 2ZM0A 2EX6A 2CC1A 1K4EA 3ZNTA 2XLNA 3NDEA 3QNBA 1KGGA 2G2UA 1YQSA 1L0GA 2WZZA 1BLSA 2ZC7A 4N9KA 5CGSA 3UPOA 3HLFA 3IXHA 2FFFB 2PU4A 1KVMA 3G2ZA 4E6XA 3C4PA 4WZ5C 5EVIB 5F1GA 1HD8A 5HARA 3M2KA 4DE0A 3DW0A 4WMCA 3IH8A 3I7JA 5FI6A 4JXWA 4CJNA 2FFYA 2Y2LA 2VGJA 4GOGA 5FQKA 4JF6A 1YT4A 4DDYA 3C7UA 3PTEA 4OKPA 4UA9A 2Q9NA 4JF4A 4E3JA 2ZM2A 5FAPA 1GCEA 2B5RA 1ES5A 2ZQ8A 4JXSA 4N9LA 3RJUA 5KSCA 2ZQAA 2J8YA 2WYXA 1HTZA 3GR2A 3UDIA 4X53A 4OPRA 4XUZA 3A3FA 5FQQA 5GLCA 4E3MA 4D2OA 1SKFA 4ZTKA 1SHVA 1ZKJA 3DWZA 1JWPA 3HLCA 1GHIA 2HP9A 4MLLA 3NDGA 3ZVWA 5J8XA 5KZHA 4R4RA 4OLDA 3BM6A 3UPNA 2XQZA 4KG2A 5FI7A 1OMEA 3OPHA 1K54C 4PM8A 3G4PA 4EQIA 2VGKA 3OPRA 2I72A 2ZQDA 5CRFA 1W79A 3O88A 2J9OA 2Y2PA 1H8ZA 3VP0A 5HFOA 3S4XA 1U60A 3OZHA
chains in the Genus database with same CATH superfamily
1PWGA 1YU3A 3X1VD 4FTXA 3WD1A 1UR9A 4LCMA 1H5XA 5U47A 5HSQA 3UMEA 2ZBBA 3HREA 4S2KA 2AVXA 5GXQA 1CK3A 1ES4A 4D60A 1YLWA 3IS2B 2V8FA 4EW7A 4H9NB 4OH0A 3MGSB 3VV4A 4ETXA 1NYYA 1KOUA 3BEBA 1LSXA 1Q9CA 4ZUXB 4IJEA 3L26A 3IF6B 4R23A 3PHYA 1NZOA 1HZOA 1OTBA 2Y8HA 1NLYA 5AV5C 1ONGA 3OLOA 3PYPA 3LR5A 1IELA 1YM1A 1K57C 4J8UB 5L10A 3N8LA 3EPHA 1AOIB 2XH9A 3A3DA 1A7WA 2NZDD 3X1UC 3AZMC 2JN7A 2QZ6A 4U0XA 3FPVA 2CV5A 3VSLA 1W63M 1Z2CB 1YLJA 3UDXA 3AZHA 1L0EA 4JJNA 3C1CC 2NQBD 5G4YA 3MGPA 4N92A 5EOOA 3PAEA 5C3IB 3T4TA 4OOLA 1LSWA 4Q0HA 1PZRA 4IBCA 1Z6FA 5HD5A 1IEMA 3FPWA 5EPHA 1BH9B 5AV9D 5CPIA 4OJ5A 3PBSA 5AVBD 5F99D 3WKJC 1KX4D 1GSXA 1P34B 5CEBA 1CEGA 2GDNA 3N8SA 2PD8A 3DTIA 1J9MA 2Y2JA 1N1JA 2QWSA 2FJ7C 4EO5C 4OQHA 4AWLC 1PZOA 5B1MA 2RTSA 1LT0A 1XA7A 2IWCA 2W1TB 1P3PD 2GNXA 4CAYA 2HP5A 1FR1A 3RXXA 5AV8C 3IWQA 4DJ2A 4P0MA 2VGLM 3KWQC 4FD8A 3ZGAB 4E3IA 3VP3A 5B2IB 3UT9D 5CHMA 4CSRB 3C2WA 2W3HA 2V9AA 5BO0A 3C7VA 2V0UA 5DTSA 3X1TC 4L9EA 3VSKA 2ZC3B 3T4QA 4MB5A 3MQ0A 2JKTM 2IO5B 5K5BA 3FWLA 4R8PC 5CTNA 2IWDA 5JA4A 3LZ1A 4KZ9A 4R0QA 3V50A 4LV2A 1KX3A 1JWZA 3A1KA 3AZKC 3VFHA 3MZFA 5KSHA 3MZEA 3AZLA 4OOMA 5B0ZA 4BLMA 4Z2GA 3QP1A 3W97C 4NZ5A 3O62A 1S32D 4CQHA 5J7EA 5TR7A 3CITA 5B24A 3AZJC 1M1AD 4J8XC 4X1LA 1K38A 4EEUA 2JKGA 3FYZA 2HJEA 5CGXA 4LRXC 3BFCA 1LI9A 3OOVA 3T4SA 4NK3A 4JXGA 4KZ3A 4PM6A 1P3ID 1XKZA 2QKPA 3Q81A 2HP6A 5F69A 2R9WA 2YFWA 1N9NA 3MXSA 2A2LA 3DBAA 3AN2C 4XUJB 1KX5B 1ZLAC 3HUMA 5EVID 4XXRA 4GH9A 4IBEA 3REIC 1KE4A 1TZYC 2DF4C 2A49A 3D4FA 4H9RA 4LD9C 3UB8A 5AQ9A 1IKIA 1FQGA 3RH8B 4NXGA 1MXOA 4B4ZA 1DJAA 3MR0A 1T1AA 5CGWA 2UWXA 1W8YA 3GMWA 5GLDA 1FIKA 1GXDA 2H28A 2KX6A 1XJ6A 3T4LA 1ES3A 3G31A 3F1PA 4LG2A 4Z5TB 3T4OA 3LZ0A 1S1ZA 5TFQA 4QJGA 3MVDC 4X23C 4WU9B 4YS3A 5CPKA 5GHXA 2Z2LB 1PWDA 4EWFA 3AZFD 4DXBA 4J8VB 1F5MA 2DMWA 4Y15A 3Q7ZA 4Z9QA 5B31C 3QHYA 5B31G 3H7WB 5B1LD 3T1QB 4I3JA 2WGVA 3VH5A 4IBBA 1M18D 4KUDB 5B32D 2F8ND 3REJA 4GJ4A 5BT1D 5EV0A 2GX5A 3VOYA 5GT0D 3DTEA 2YFVA 4JGOA 3BLSA 3AZIC 2DNSA 5E5AA 3WTPC 4WU8D 1M6KA 2OAQ1 2PBYA 3W96C 4OPZA 2JKTI 3U4LP 2Y2NA 1MZUA 1P3AC 4QLCC 2H0YA 1W2EA 5E2FA 5JYPA 3X1VB 3W4OA 3IS2A 4K0WA 4RX3A 4H9NA 3MGSA 2J80A 4RX2A 4IBJA 3VH6A 3PAGA 1KX4C 4IBGA 3A0RA 3MQQA 4ZUXA 3IF6A 3SOIA 3BRMA 1F2KA 3VMAA 1U35D 3LELC 1LL5A 4NYYA 2ZM8A 4KQRA 3T4JA 3MFXA 1P3PC 1M19D 2HUEB 4FCFA 5B33D 4J8UA 5L2FA 5CHUA 3MGRC 3N4IA 4OJOA 1AOIA 1KGFA 2W27A 2FN2A 3ITAA 4BMWA 4EERA 4FH4A 4K91A 5JRGB 4P85A 1E25A 1W1PA 4J8WC 1P3FC 3A3JA 2X02A 3EQVA 3GSGA 5IHVA 4KGCD 3N7WA 1GOIA 4WNNB 4I3IA 5FAOA 1ALQA 2NQBB 1ESIA 1L6JA 3B6FC 3NHQA 1XGIA 3A6NC 1BH9A 4Z66C 3T1SA 4X56A 2HDQA 2OSUA 4GHAA 3CWFA 3E4QA 3OPPA 1KE0A 3LEQA 1OTDA 1YSQA 5AV9B 4CLCD 4IBXA 4S2LA 1P34A 4Y7PA 3C30A 3SZTA 3M2JA 1BTLA 5AVBB 5F99B 3AV2D 1KGEA 3DTMA 2W1TA 4M4XA 3UE6A 5FSRA 4GKUA 3PBRA 2PU2A 1W1VA 3GECA 2D01A 2ZD8A 4N1XA 2VV6A 5GT3D 5B2IA 1N9OA 4CSRA 1H8YA 3UTBC 3UT9B 1MC0A 2J3TD 3NY4A 5C5KA 1F9IA 4G3KA 3V5MA 5CXWA 3X1SC 1BSGA 3HONA 3CMZA 4UA6A 4BENA 4G3WA 3MGQD 4MCWA 1P3BB 4B88A 1O07A 4PAUA 1Y54A 1GSWA 1T18A 3B6GD 1TS7A 3OC2A 1CF0A 3QP5A 4H9PB 3MSHA 2VEAA 1G5UA 3HUNA 5CEDA 1S32B 3W4QA 4ETZA 4BD0A 3MBZA 3MKEA 5B40C 5CP6D 1R4VA 2XF3A 3AFAD 1M1AB 3ITBA 5B0YD 1UR8A 4EBNA 2HIOD 5CHLB 2NUPC 3IX8A 2L5AA 1XFNA 2PDRA 4X69A 4OLGA 1P3IB 2G2WA 4HH2A 3SH7A 5DNND 4WZ5A 1P3GC 2EX6A 2CC1A 4DN0A 3QNBA 2L0WA 3EG5B 1KGGA 2G2UA 1YQSA 4XUJA 2WZZA 3KSHA 1KX5A 1M18C 3UPOA 2QJ7A 2VJWA 3IXHA 5B32G 1UGUA 2F8NG 3B42A 3G2ZA 4Z2JA 5AY8C 5EVIB 3B0CW 3REKD 4DE0A 5GT0C 5FEGA 5FI6A 2P08A 3T4KA 3CPTA 5FQKA 3C7UA 3PTEA 4OKPA 3B47A 4UA9A 1GCEA 2VQRA 2ZQAA 2J8YA 3LUQA 4B9OA 3GR2A 4Z5TA 4X53A 4XUZA 2PBDP 4DQYB 3MJQA 4NKPA 4GCZA 1SKFA 4WU9A 1ZKJA 4HGAB 2JKFA 5FDSA 1GHIA 4YNRA 3LZ1C 4R4RA 4J8VA 3BM6A 5FI7A 5AV5D 1XJ3A 1P3KB 5HD3A 3AZFB 2VGKA 5DFYA 3H7WA 5CRFA 5L8MA 3O88A 2J9OA 3KUYB 3X1UD 5HFOA 2CWEA 4KUDA 5B1LB 3NULA 4N1HA 2W0NA 1FCOA 4NE5A 5B32B 3C1CD 2F8NB 4HI4A 2ZC6B 4E6WA 2EA9A 3ZG9B 4DE3A 3C4OA 5EVEA 1MKMA 4S2PA 1LL9A 5EFWA 2ZC4B 3HLGA 4YOFA 4F94A 3LYXA 4TX8A 2FH5A 1XX2A 4WU8B 1NRJA 1SDEA 1OJGA 4G92C 3F1NB 3X1VA 1ERQA 1OJ5A 1H0IA 1S4RA 5BOHA 2JE5A 5DF9A 2Q0OA 3WKJD 3A0VA 3TU4C 3E98A 4HP4A 3ZVTA 5FASA 3KSIA 4IJFA 2DRWA 4QD4A 4KHAB 3MF0A 2X01A 3V39A 5EE8A 3PBQA 2FJ7D 3LIAA 3VOLA 1E6NA 4IUKA 4ID4A 4LCLA 2XD1A 3W2ZA 4PHTA 4BQMA 2A3UA 2XR0A 1TDLA 1M19B 3KWQD 1YU1A 5B33B 3HBRA 5L07A 5JRGA 4B93A 1WA9A 5HAQA 1EQZA 1P3MB 2PR5A 4FUWA 3SH8A 3B0CT 3LJAD 4K08A 4NXEA 4XUXA 2M7UA 4WNNA 2NQBA 4KGCB 4NE6A 4R8PD 1B67A 3VP4A 5FUGB 2PHYA 1YLYA 3AZKD 3MGQC 3LY4A 4WLAA 1RGYA 5AV9A 3DTKA 4MNRA 3W97D 4DRTA 5F99A 5AVBA 1VEUB 4E44A 2B02A 4CLCB 1NZUA 3T12B 1ZG4A 3REJC 3AZJD 2V1AA 4J8XD 3UNWA 3AV2B 4JF5A 1ID3C 2O9BA 3OCLA 1D06A 1N9LA 4F3LB 5CP6C 1S6RA 5E5AC 3AFAC 4B4XA 2MJ6A 2QMIA 1E6PA 4UQIM 2Z2MB 2HDUA 5GT3B 1HQ3C 3F1OB 3AV1D 5I94A 3UT9A 1YAXA 1GA0A 2LB5A 2Y4AA 2C5WB 4BL3A 3AN2D 5CPJC 1ZLAD 1EWZA 2BG1A 1YSPA 3REID 4LGWA 1TZYD 1ES2A 1LL8A 2WKPA 4KZ8A 5IU1A 5KDMB 2O9CA 3SS3A 4G91B 2G7UA 1P3BA 3Q7VB 2XA7S 4LD9D 1IYSA 4Z2KA 3L7HA 2NUTC 3D3OA 3LR4A 3B0DB 5HPFA 4H9SA 2O0YA 4H9PA 1BH8B 1PI5A 1S32A 1PW1A 3B6GB 4MBHA 3AZEC 3WA9B 4LPZA 4OUIA 1M1AA 3MVDD 5DNMC 3MMHA 2BYMB 1OT6A 3CJMA 2OAP1 2BYKB 4X23D 1F98A 5JYOA 5B0YB 2K31A 4H6JB 1P3IA 2HIOB 4GN2A 5F5YA 5BS7A 1NLZA 3VP2A 4JPMA 5B31D 1ULYA 3D72A 5DNNB 2PAVP 4EBPA 2WKIA 1VHMA 1Q2QA 5CECA 2Q9MA 5EVIA 4H8RA 2VZWA 1RGZA 1V9ZA 3RELA 4GS9B 1E88A 3AZID 2VKSA 3GV9A 2EX2A 3WTPD 4NFTA 1EAKA 3W96D 3REKB 3PBTA 4Y17A 3EGDC 1P3AD 4QLCD 5DF7A 3W98C 3REHC 1UWPX 4PKYA 1X0OA 5DJUA 3EPLA 1W5DA 3MNNC 5DKLA 3PR6A 3TSGA 3IXGA 3WAAB 4S2NC 1EI5A 1W63Q 3AZND 4NZ1A 4RQ9A 3CG5A 3IXBA 4ESPA 2F2AC 4Y3IA 4HIAA 3ZHHA 4DXCA 3LELD 5HL6A 1P3KA 5F6AA 3IH9A 3KXBC 3AZFA 3MGRD 1CXWA 5AV5B 3CHWP 3R7WB 3S7PA 3KUYA 2JBFA 3KS8A 3MQOA 5GSUC 1TEMA 4RVAA 5B1LA 2PD7A 4L9GA 3CZDA 4OONA 4J8WD 3X1UB 4QY6A 1P3FD 1PFLA 3IWIA 5B32A 3AZMB 1P3OD 2F8NA 1K55A 3CUEA 3E2KA 3EWKA 5FATA 2PYRA 3JPUA 5L09A 1MWRA 1OGBA 3LJAC 1JTGA 1N4OA 1P3LC 3C1CB 4BD1A 4EUVA 4NETA 5FA7A 3B6FD 3PBOA 3NECA 4WU8A 3F1NA 4PM7A 3A6ND 4Z66D 4HJ3A 2PYOB 3UO9A 1RCJA 4NY2A 1DY6A 2KOIA 3OCNA 4QB8A 2J7VA 4IHQA 4KHAA 1S4SA 3FC7A 3WKJB 3LI8A 4YFMA 3N6IA 3H0RC 4LRZE 1EROA 2INWA 2FJ7B 3W99C 4EO5B 1DP6A 3IBJA 4WM9A 4UAAA 4WV4B 4AWLB 2RIQA 1H8MA 4QY5A 1IYPA 5HDSA 4P6ZS 3UB5P 1M19A 2V0WA 5B33A 4QWOA 1TAFB 4NZ4A 5AV8B 4S2IA 4HESA 4GD6A 1GPFA 3KWQB 4GB7A 1P3MA 2Y2KA 3UTBD 3G32A 3TE8A 3AV1C 1K56D 4RA7A 2G5HC 4Z5TC 1TDGA 3BECA 1H3QA 4KGCA 3D9YA 3X1TB 3SS5A 2CMNA 4R6LA 3ZYTA 5HZHA 5FQ9A 3X1SD 3HCYA 1L0FA 1PW8A 5FUGA 2RCXA 4R8PB 1F66B 3L25A 2ZQCA 3EOIA 3ULFA 2HZ5A 2WK0A 1DJBA 1ESUA 3E0YA 3KYZA 4WJ3C 4XT2B 1E6ZA 1LI0A 1S0WA 5GHYA 2M1CA 3U2AA 1VEUA 1XGJA 1GHPA 4KUDC 4CLCA 4M6BA 3H0LC 1IOUA 3C1BC 3W97B 1PIOA 3Q1FA 3AZGC 1PZPA 3GTCA 4YWZA 3TW8A 3AV2A 3AZHD 4WL9A 5B40D 3MGPD 5A8BA 3AZJB 4F3LA 4J8XB 5D3OA 3V67A 5AQ7A 5GT3A 2ACGA 3F1OA 1P3GD 4Y13A 3KSFA 3WS2A 5DTKA 1VB6A 3MQLA 4XZQA 3AN2B 4GDNA 4JBFA 1HVBA 5KMWA 2AROC 1ZLAB 3UTAC 5AY8D 4O8GA 4PM5A 5KDMA 1E6RA 4EETB 3Q7VA 2ZL1B 1BZAA 1TZYB 2HUEC 2JSSA 3AYWC 5F1FA 3FKVA 5E2GA 3ZG0A 3JYIA 1H0MA 4LD9B 5AVCC 1BH8A 3L28A 4BBVA 3B6GA 4HP9A 1EQZC 2P74A 3WA9A 5B2JC 1S1YA 2BYMA 4DJ3A 3NDEA 1F1EA 2BYKA 1L0GA 3AZNC 3B33A 1BLSA 4N9KA 5B0YA 5CGSA 3HLFA 4H6JA 3LZ1D 2HIOA 4X23B 3C4PA 1HD8A 5HARA 5G49B 4YM6C 5J4EA 5DNNA 2VGJA 1QO6A 5B31B 2E8JA 4MB4A 2KLIA 2PYPA 2ZY3A 5FAPA 2NZDB 4CLCE 4JXSA 1E8BA 3UB7A 1P3OC 4GS9A 4NEED 3UDIA 4OPRA 3REKA 4OJLA 1P0ZA 3AZIB 4ZTKA 1SHVA 3DWZA 1KS0A 1JWPA 5BNVB 2HP9A 3NDGA 2WKRA 2D49A 2P7JA 3UPNA 2XQZA 1P3AB 4QLCB 2VA0A 3OPHA 4PM8A 3WAAA 3TU4D 1NWZA 3OPRA 1H8ZA 5AV6C 4MMNA 4NZ3A 1U60A 1KX4B 3MKFA 2ZM5A 4P6BA 4Z2MG 1ZTUA 4WYYA 4H9OB 1D7EA 3LELB 5AV5A 1UWNX 3R7WA 4ZBJC 4ME4A 1P3PB 1PI4A 4H9QB 5HDDA 1K57A 1HTAA 3MGRB 2EX9A 1FCMA 4HMEA 3EQUA 3X1UA 4H9SC 3LEZA 3AZMA 2XSSA 4IJGA 1E3UD 3V9RB 4J8WB 1OTEA 4KZ4A 1P3FB 5GXQC 3C1CA 2WADA 2WKHA 4OPYA 3VE3A 1TS0A 4JXVA 1I5QA 4YS3D 2VX8A 2OLVA 2C6WB 3O3VA 3A3EA 4R70A 1NRFA 2PYOA 2Z6DA 3O5YA 3A6NB 2R9XA 4Z66B 3O87A 4OOYA 4HH3A 4KUOA 4Y0UA 3WKJA 3HLDA 1Y4OA 3HVFA 1PWCA 3NCKA 3REJD 2R78A 2CV5C 1ZG6A 4OQGA 2FJ7A 1AIWA 3GRJA 3AZHC 4JJNC 1ID3D 2HDRA 2HJ9C 3RELC 3WS5A 3FV7A 3MGPC 4BL2A 5E5AD 2EWWA 1TAFA 5G4ZA 5AV8A 2G5IC 3LIBA 1T3UA 3A3IA 2VLGA 5CTMA 1HQ3D 3KWQA 3N3FA 3TOIA 4EQ1A 2QPNA 1HLUP 1K6RA 2J8PA 5CPIC 1G6OA 4JKTA 5HWTA 3FKWA 3A0SA 3MS6A 3UTBB 3MXQA 4WUJA 4DE2A 3X1TA 5GLAA 5CPJD 2XFTA 4GDBA 3LIEA 1E4DA 2V20A 3WD2A 3HLWA 3K3DA 1NY0A 4ZUXD 4O01A 4R8PA 3KSGA 1F66A 1YU4A 1OTIA 5DTTA 3BFDA 3X1SB 4HBTA 2ZMFA 5B1MC 3PBNA 4XT2A 1KDWA 3VE4A 4ZBEA 1OPXA 5FI2A 3W97A 4I38A 3B3XA 3VH5W 1YUEA 3AZED 3V3SA 1KU5A 1K54A 3TJZC 3AZJA 3TRCA 5DNMD 4J8XA 2PT7A 2K7SA 2F8NH 2IOUA 1WE4A 5B40B 3NQUB 5GLBA 1J3WA 3UN7A 5IT5A 1TD5A 1N9BA 4IBIA 5CERA 4ZAMA 1KX3C 1SCWA 5FAQA 3GVBA 4HJ4A 1P3GB 3AZLC 5LBRA 5B0ZC 2ZY2A 4NG2A 1PDCA 2FZ0A 2XD5A 3WX7A 3AN2A 2O9AA 3L9KA 4X1MA 2B95A 3O62C 3R45B 1XXMA 1ZLAA 1T1BA 1M18B 1Y28A 3QP2A 5B24C 2ZL1A 4PM9A 1TZYA 1P97A 3BFEA 5AY8B 5HDCA 2EXAA 3NOTC 3ISGA 5GT0B 3ZG8B 3LIFA 4OVDA 4LD9A 3W98D 5B2ID 3REHD 4KUKA 4KQOA 3ZDJA 4LV0A 3QP6A 3MNND 1P3MC 4I39A 1S66L 2IWBA 1DRMA 4BJPA 1XPBA 4L9FA 3JVUA 2HDSA 3UB9A 1BLPA 1W8QA 5GHZA 4X23A 4E3OA 5TBMB 4KZBA 5AQBA 3T1XA 3S7OA 3KXBD 5KIZA 1W7FA 3EPJA 3KS4A 5G49A 2XK1A 1U35B 1MWTA 5A90A 2HF6A 2VGLS 5GSUD 5B31A 3H82B 3LY3A 4Y2FA 1H0GA 4MN6A 2NZDA 1WYBA 1H3OB 1P3LD 4DF6A 3LZ0C 4X25A 3WD4A 1QMEA 1AWIA 3AZIA 4EU0A 3UDFA 5BNVA 4DKIA 1YKDA 4YS3C 5AJGA 5CPKC 1KVLA 4R4SA 2XRNA 3Q82A 3LR3A 3VH5T 1P3AA 4QLCA 4O7DA 1IFQA 3FZCA 1ZC2A 4Q0IA 1YU0A 3HL9A 1FCNA 4KQQA 3TU4B 2V5OA 2YFWB 4XZQC 3M6BA 1KX4A 1XJ4A 5I5LA 3EEHA 3S7NA 2V2FF 3W99D 4H9OA 2QJ5A 3ZCZA 3LELA 1ERMA 3WRZA 1P3PA 4H9QA 2PRFA 2EFUA 4E45A 2ZJ9A 3Q07A 3MGRA 1M40A 4LFUA 4WZ4A 5FQMA 2WAEA 3AGDA 4GW9A 1SZVA 3HUOA 5DF8A 3V9RA 1JVJA 4J8WA 5TJJA 1P3FA 4Z5TD 2DCFA 3ZFZA 4HY8A 5HAPA 2EWVA 3ZQ5A 3MGSC 3WRTA 3K3CA 3C5AA 2OWJA 4WBGA 1BYWA 4MBFA 4ZUXC 3IF6C 4J8VD 3L29A 1SDNA 5EECA 5FL3A 3A6NA 4O0PA 4Z66A 3LCEA 4HHDA 4DMZA 3IHAA 4J8UC 3MGQB 2XROA 1AOIC 4KUDD 3K2NA 1LLBA 4DE1A 3AGFA 3C1BD 3AZGD 1G68A 2E8IA 3HSHA 5TGFA 4NE3A 1YMXA 5A92A 4KZ6A 4GHIB 5C3IC 1ID3B 1FILA 3IWOA 1PYYA 5CP6B 3AFAB 5FEFA 2RVQC 3OBFA 4I3AA 1MKIA 1HQ3B 3H9WA 3UTBA 1YLZA 4EESA 3C38A 3WAAC 1VETB 1K56A 4Z2IA 4M3KA 1P34C 3IX3A 1C3BA 4IBFA 5EM0A 5CPJB 2AROD 3FDDA 3UTAD 1FR6A 1Q2PA 3X1SA 1LSVA 4NYUA 3AYWD 3IP4C 1WWIA 3LGOA 4LENA 3S7QA 5HWWA 5AVCD 4EXOA 1EW0A 5JRGD 5B2IC 3NBLA 2V1BA 4L0LA 1EQZD 4KZAA 5B2JD 2ZY5A 2L4RA 1KDSA 3AZEB 1ONHA 5EM1A 5EVLA 1VQQA 4IVIA 5B40A 3NJAA 3NQUA 2IO5C 1SKOB 5DNMB 2Y91A 2M7VA 3WS4A 1KE3A 1OTAA 2PR6A 4G3VA 4NXBA 1V9YA 5BNXB 3LO7A 1XP4A 2HGVA 4YM6D 2PYOC 4X68A 1P3GA 4HEFA 1NYMA 3S22A 4HJ6A 4OJ6A 1IKGA 1RP5A 1BUEA 3P98A 3UMDA 1L2SA 3KYQA 3R45A 3O86A 1M18A 2VV8A 1K0KA 4Q0JA 2ZC5B 4KZ7A 3NQJB 3L27A 2XEPA 3IBRA 4PPRA 5AY8A 4WMCD 2ZM0A 1K4EA 2XLNA 4JGQA 5DKKA 5GT0A 2V8CA 2ZC7A 5IS1A 2FFFB 3ICYA 1CJFA 3W98B 3REHB 4E6XA 4WZ5C 5F1GA 3M2KA 3MNNB 3DW0A 3IH8A 2FFYA 4XUJC 2Y2LA 5AV6D 1YU2A 4GOGA 1KX5C 1YT4A 2W3GA 3C8CA 1JNUA 4JF4A 5TBMA 4FOFA 2ZM2A 2F8NK 1H8PA 2B5RA 4N9LA 1F66C 1ES5A 2ZQ8A 3BW6A 2WYXA 2OWHA 1U35A 1P3BD 5CX7A 2W8SA 3EGXC 3KXBB 3A3FA 3H82A 5GLCA 4E3MA 1STZA 4D2OA 4UUZB 3KX0X 5GSUB 3HLCA 3ZVWA 5J8XA 4OLDA 4KG2A 1H3OA 1ACFA 1OMEA 5GXQD 2GJ3A 3QP4A 1K54C 3T50A 3G4PA 2I72A 3LJAB 1W79A 2QYBA 1P3LB 2Y2PA 3VP0A 4WU9C 5HPIA 4Y5FA 3BY9A 1D1JA 3OZHA 2BLSA 5M18A 4J8VC 4WF0A 3W4PA 1W1YA 2BASA 1TS8A 4ZJ3A 3W8KA 4S2MA 5A91A 3AZKB 3BQAA 2UV0E 2JKRM 3UPPA 3BJNA 3TU4A 1OT9A 3P5JB 2LB9A 2W3FA 1W1TA 4JGRA 2CV5D 4EUZA 5DJTA 5HL1A 1K25A 4BBUA 3M6HA 4JJND 2J9PA 2P9VB 2OV5A 3RELD 3W99B 3UE1A 3BQ8A 1MWUA 2OOLA 3IF5A 2XA7M 1G28A 5FQIA 3JVVA 2XDMA 4OP5A 3CPTB 4Z1WA 4MEZA 1LHYA 3RTYA 5CPID 3X1VC 3TG9A 1IYOA 3BLMA 3AV1B 1E3UA 4UHUA 3VP1A 4WELA 4Q8IA 3EEAA 1CEFA 4FSFA 4A5RA 3WD3A 3VFFA 3WS0A 3H0MC 4HNBA 4HBUA 4KQDA 2XFSA 5B1MD 1P3KD 1JFIB 3REIB 3E2LA 5HAIA 3MGQA 3FG8A 3KUYD 3ZG7B 1WWSA 2W3DA 5JRGC 3P09A 2NZDC 4MN5A 5HW3A 3C1BB 2WKEA 3AZGB 2VV7A 2ZQ7A 3L2AA 2WGWB 5AQAA 3SS4A 4GHIA 4EEPA 2ZY4A 4ZJ1A 1ID3A 5A93A 2NQBC 2BTFP 5CP6A 3AFAA 3MVDB 2J3WA 1L3LA 3G35A 1ZHHB 3UY6A 4IBRA 1HQ3A 4E3NA 1KX3D 3N8RA 3AZLD 1VETA 5B0ZD 4EV4A 5AV9C 1FOFA 3WD0A 3O62D 5CPJA 5AVBC 5F99C 1ODVA 1XFQA 5B24D 2AROB 3UTAB 1G6AA 4BWIA 5FQJA 2A24B 3WTPB 4OPQA 1DP9A 1IYQA 3AYWB 4II7A 3W96B 3KFUG 5AVCB 1P3MD 2P04A 4QHCA 4P87A 3UT9C 4WN5A 3AZEA 1EQZB 2H0TA 3A1IA 5B2JB 3T1RA 1SKOA 5DNMA 1MBLA 4JLFA 1NXYA 2V1ZA 2JKRI 3AZNB 1J7MA 4GHLA 5BNXA 5M19A 1P3BC 1ED7A 1GA9A 2XGNA 1JWVA 1MPLA 3MXRA 4R3AA 4ZJ2A 1TF1A 2W3EA 4YM6B 4EBLA 3IXDA 1BULA 2Y59A 3CAXA 4U3TA 4HMDA 1T1CA 3GQZA 3NQJA 1S32C 4IVKA 4UA7A 3LZ0D 1DJCA 1P3OB 3NOPC 5MC7A 1O7EA 1M1AC 1WYCA 4GD8A 4MN7A 5EOEA 4C6YA 4Z2MH 3DAVA 4MBKA 1FSWA 5CPKD 4ARZB 4E3KA 4P6ZM 3B6FB 4LRYC 3HLBA 3LICA 3W98A 3REHA 1P3IC 1L0DA 1QMFA 4OQIA 4DRAA 1BT5A 2QHKA 5BS7C 5CHJA 3RXWA 3SH9A 4HMCA 3MNNA 1B6WA 3MZDA 5GL9A 3NC8A 2KDKA 4KENB 4S2NA 1YPRA 4XZQD 3AGEA 5F83A 2WUQA 1CI8A 5AV6B 2Y2HA 4I5SA 1P9WA 2Y2OA 5EVIC 4WZSB 4WEJA 3KXBA 2YKHA 5F82A 3R4KA 4RYEA 2Y79A 4UUZA 4ZBJB 3EPKA 1K6SA 3KO6A 3F6TA 2ZOHA 4UQIS 3G6OA 5GSUA 3AL0C 4E3LA 4KG5A 1A0KA 2Y2MA 4PKYG 2H5SA 1T19A 3WA9D 4GNUA 2JHEA 2EFXA 2HV1A 3LJAA 3MGSD 1P3LA 1TVFA 5GXQB 3KYEA 1Z09A 4HGAC 3QNCA 3RFBA 3BYDA 1K4FA 2JC7A 4KZ5A 4R1GA 3DWKA 1P3KC 4GLQA 4J8UD 3AZFC 2LY8A 3AZKA 4PMAA 3WWXA 1AOID 3UE3A 1BLCA 2ZQ9A 3KUYC 1GHMA 3V3RA 2IA2A 5B1LC 3MFDA 3WS1A 3HJKA 5E2EA 4JGPA 4HQAA 3IQAA 4K0XA 3ZNYA 5B32C 1K55C 2P9VA 3CUEC 2CV5B 3LR0A 1DP8A 5BT1C 3W99A 3AZHB 4JJNB 4S2OA 2ZMAA 3RELB 3IHBA 3MGPB 4WU8C 4ZDXA 4QNLA 2RVQD 4Z2LA 2YKFA 4OJPA 2K2NA 2D02A 4MDZA 3KSYA 1MWSA 3AV1A 3WAAD 5CPIB 3HJIA 4Y0OA 1P34D 1BLHA 2H10A 2HPBA 5DFXA 4C75A 4QU3A 4KG6A 5M1AA 4FH2A 3VH6W 2GZAA 2I9VA 1JFIA 2Y2QA 3REIA 4IUHA 1N1JB 5EUAA 1U35C 5B1MB 1PNEA 4YINA 2VK3A 4X6TA 4GZBA 5HWVA 1M19C 4CAYB 4UEYA 1I2WA 5B33C 1P9RA 4DDSA 3AZMD 5AVEA 3C1BA 1O6IA 3AZGA 1BFMA 4IEDA 1JTDA 2OLUA 2WGWA 4WEKA 4Y0TA 5J3WA 2EX8A 4R3JA 3VOZA 5BO0B 4KGCC 1YMSA 2DQNC 3MVDA 1E15A 4HOIA 4LV1A 4ZRRA 1MY8A 2WGIA 3OPLA 4R38A 3ZG5A 2L1MA 3BFFA 5JA4B 3LZ1B 2PYOD 4S2JA 1CK7A 2WKQA 2Y2IA 1KX3B 4OP8A 5E2HA 3G34A 3G2YA 3AZLB 4UPKA 5B0ZB 3UB6A 3S1YA 4CLCC 3LFVA 2WAFA 5HX9A 4OQ0A 3NI9A 1FSYA 3O62B 2AROA 3UTAA 3AV2C 5BPVA 3P7NA 2B18A 2Y55A 5B24B 3BY8A 4IBKA 3P01A 2A24A 1I2SA 3WTPA 4U0TA 5DVAA 1YLTA 2ZLYA 5AV8D 3AYWA 3W96A 1YLPA 4X55A 5AVCA 2EXBA 5FDHA 5GT3C 1GSVA 2Y2GA 3M7PA 4DRBA 4AFIA 2JCHA 4G92B 1AXBA 3NIAA 3LIDA 1CI9A 5E43A 1XA1A 5B2JA 4C3QA 3HLEA 3IT9A 3X1TD 3G30A 1VM1A 4XUJD 4CPKA 2RL3A 1KX5D 3BFGA 2J3TC 3AZNA 5G18A 2ZOIA 2W1RA 4Z2HA 2WZXA 1F66D 4LV3A 4BBTA 3CI6A 4R3BA 3E4OA 3QP8A 3PXPA 3UE0A 4G91C 1XJ2A 2X71A 1NJ4A 4YM6A 3ZNTA 4H9RB 3B0DC 4MB3A 3GDIA 5F68A 4QPRA 3VH6T 3FKEA 3B0BA 3B6GC 2PU4A 1KVMA 3WA9C 2Z6CA 1P3OA 3E4PA 4WMCA 3CLOA 3I7JA 3F1PB 4JXWA 4WU9D 3LZ0B 4CJNA 2O99A 4ARZA 4DDYA 4JF6A 5AVFA 3B6FA 5B0YC 2Q9NA 4IBDA 2HIOC 4E3JA 4E04A 4YS3B 5CPKB 5KSCA 3RJUA 1TS6A 1HTZA 3BWLA 5DNNC 5FQQA 5AV6A 3IX4A 4MLLA 4XZQB 3LI9A 5KZHA 1PRQA 3REJB 2ZMVA 3SW1A 4EQIA 4LLOB 1CQAA 3REKC 2ZQDA 2YFVB 4NXFA 1S67L 5E5AB 1OGGA 3WTPE 3NOUC 3S4XA
chains in the Genus database with same CATH topology
1PWGA 1YU3A 3X1VD 4LCMA 1H5XA 5U47A 3HREA 4S2KA 5GXQA 1CK3A 1ES4A 1YLWA 4H9NB 4OH0A 3MGSB 1NYYA 3BEBA 1Q9CA 4ZUXB 4IJEA 3L26A 3IF6B 4R23A 1NZOA 1HZOA 5AV5C 1ONGA 1IELA 1YM1A 1K57C 4J8UB 3N8LA 3EPHA 1AOIB 2XH9A 3A3DA 1A7WA 2NZDD 3X1UC 3AZMC 2QZ6A 4U0XA 2CV5A 3VSLA 1Z2CB 1YLJA 3UDXA 3AZHA 1L0EA 4JJNA 3C1CC 2NQBD 3MGPA 4N92A 5EOOA 3PAEA 5C3IB 4OOLA 1PZRA 4IBCA 1Z6FA 1IEMA 5EPHA 1BH9B 5AV9D 5CPIA 4OJ5A 3PBSA 5AVBD 5F99D 3WKJC 1KX4D 1P34B 5CEBA 1CEGA 2GDNA 3N8SA 1J9MA 2Y2JA 1N1JA 2FJ7C 4EO5C 4OQHA 4AWLC 1PZOA 5B1MA 1XA7A 2IWCA 1P3PD 4CAYA 2HP5A 1FR1A 3RXXA 5AV8C 3IWQA 4P0MA 3KWQC 4FD8A 3ZGAB 4E3IA 3VP3A 5B2IB 3UT9D 5CHMA 4CSRB 5BO0A 3C7VA 5DTSA 3X1TC 3VSKA 2ZC3B 2IO5B 3FWLA 4R8PC 5CTNA 2IWDA 5JA4A 3LZ1A 4KZ9A 4R0QA 3V50A 4LV2A 1KX3A 1JWZA 3A1KA 3AZKC 3VFHA 3MZFA 5KSHA 3MZEA 3AZLA 4OOMA 5B0ZA 4BLMA 3W97C 4NZ5A 3O62A 1S32D 5TR7A 5B24A 3AZJC 1M1AD 4J8XC 1K38A 3FYZA 5CGXA 3BFCA 1LI9A 4NK3A 4JXGA 4KZ3A 4PM6A 1P3ID 1XKZA 3Q81A 2HP6A 2R9WA 2YFWA 3MXSA 3AN2C 4XUJB 1KX5B 1ZLAC 3HUMA 5EVID 4XXRA 4GH9A 4IBEA 3REIC 1KE4A 1TZYC 2DF4C 2A49A 3D4FA 4H9RA 4LD9C 5AQ9A 1IKIA 1FQGA 1MXOA 4B4ZA 1DJAA 5CGWA 2UWXA 1W8YA 3GMWA 5GLDA 1ES3A 3G31A 4LG2A 4Z5TB 3LZ0A 5TFQA 4QJGA 3MVDC 4X23C 4WU9B 4YS3A 5CPKA 5GHXA 2Z2LB 1PWDA 4EWFA 3AZFD 4DXBA 4J8VB 3Q7ZA 4Z9QA 5B31C 3QHYA 5B31G 5B1LD 2WGVA 3VH5A 4IBBA 1M18D 4KUDB 5B32D 2F8ND 3REJA 5BT1D 3VOYA 5GT0D 2YFVA 3BLSA 3AZIC 2DNSA 5E5AA 3WTPC 4WU8D 1M6KA 2PBYA 3W96C 4OPZA 2Y2NA 1P3AC 4QLCC 2H0YA 1W2EA 5E2FA 5JYPA 3X1VB 3W4OA 4K0WA 4RX3A 4H9NA 3MGSA 4RX2A 4IBJA 3VH6A 3PAGA 1KX4C 4IBGA 4ZUXA 3IF6A 3SOIA 3BRMA 3VMAA 1U35D 3LELC 1LL5A 4NYYA 2ZM8A 4KQRA 1P3PC 1M19D 2HUEB 4FCFA 5B33D 4J8UA 5L2FA 5CHUA 3MGRC 3N4IA 4OJOA 1AOIA 1KGFA 3ITAA 4FH4A 4K91A 5JRGB 4P85A 1E25A 4J8WC 1P3FC 3A3JA 2X02A 3EQVA 3GSGA 5IHVA 4KGCD 3N7WA 4WNNB 5FAOA 1ALQA 2NQBB 1ESIA 3B6FC 1XGIA 3A6NC 1BH9A 4Z66C 4X56A 2HDQA 2OSUA 4GHAA 3OPPA 1KE0A 5AV9B 4IBXA 4S2LA 1P34A 4Y7PA 3M2JA 1BTLA 5AVBB 5F99B 3AV2D 1KGEA 3DTMA 5FSRA 4GKUA 3PBRA 2PU2A 2ZD8A 4N1XA 5GT3D 5B2IA 4CSRA 1H8YA 3UTBC 3UT9B 3NY4A 3V5MA 5CXWA 3X1SC 1BSGA 3HONA 3CMZA 4UA6A 4BENA 3MGQD 1P3BB 4B88A 1O07A 1Y54A 3B6GD 3OC2A 4H9PB 3HUNA 5CEDA 1S32B 3W4QA 4BD0A 3MBZA 3MKEA 5B40C 5CP6D 1R4VA 2XF3A 3AFAD 1M1AB 3ITBA 5B0YD 4EBNA 2HIOD 5CHLB 2L5AA 4X69A 4OLGA 1P3IB 2G2WA 3SH7A 5DNND 4WZ5A 1P3GC 2EX6A 2CC1A 3QNBA 3EG5B 1KGGA 2G2UA 1YQSA 4XUJA 2WZZA 1KX5A 1M18C 3UPOA 3IXHA 5B32G 2F8NG 3G2ZA 5AY8C 5EVIB 3B0CW 3REKD 4DE0A 5GT0C 5FI6A 5FQKA 3C7UA 3PTEA 4OKPA 4UA9A 1GCEA 2VQRA 2ZQAA 2J8YA 3GR2A 4Z5TA 4X53A 4XUZA 4DQYB 1SKFA 4WU9A 1ZKJA 4HGAB 1GHIA 3LZ1C 4R4RA 4J8VA 3BM6A 5FI7A 5AV5D 1P3KB 3AZFB 2VGKA 5CRFA 3O88A 2J9OA 3KUYB 3X1UD 5HFOA 2CWEA 4KUDA 5B1LB 4N1HA 1FCOA 4NE5A 5B32B 3C1CD 2F8NB 2ZC6B 4E6WA 3ZG9B 4DE3A 3C4OA 4S2PA 1LL9A 2ZC4B 3HLGA 4F94A 1XX2A 4WU8B 1SDEA 4G92C 3X1VA 1ERQA 5BOHA 2JE5A 5DF9A 3WKJD 3TU4C 3ZVTA 5FASA 4IJFA 2DRWA 4QD4A 4KHAB 2X01A 3V39A 5EE8A 3PBQA 2FJ7D 4ID4A 4LCLA 2XD1A 4BQMA 2A3UA 2XR0A 1TDLA 1M19B 3KWQD 1YU1A 5B33B 3HBRA 5JRGA 5HAQA 1EQZA 1P3MB 3SH8A 3B0CT 3LJAD 4XUXA 4WNNA 2NQBA 4KGCB 4NE6A 4R8PD 1B67A 3VP4A 5FUGB 1YLYA 3AZKD 3MGQC 3LY4A 1RGYA 5AV9A 4MNRA 3W97D 4DRTA 5F99A 5AVBA 4E44A 1NZUA 1ZG4A 3REJC 3AZJD 4J8XD 3UNWA 3AV2B 4JF5A 1ID3C 3OCLA 5CP6C 1S6RA 5E5AC 3AFAC 4B4XA 2QMIA 2Z2MB 2HDUA 5GT3B 1HQ3C 3AV1D 5I94A 3UT9A 1GA0A 2Y4AA 2C5WB 4BL3A 3AN2D 5CPJC 1ZLAD 1EWZA 2BG1A 3REID 1TZYD 1ES2A 4KZ8A 5KDMB 3SS3A 4G91B 1P3BA 3Q7VB 4LD9D 1IYSA 3B0DB 4H9SA 4H9PA 1BH8B 1PI5A 1S32A 1PW1A 3B6GB 4MBHA 3AZEC 3WA9B 4OUIA 1M1AA 3MVDD 5DNMC 2BYMB 3CJMA 2BYKB 4X23D 5JYOA 5B0YB 1P3IA 2HIOB 4GN2A 5BS7A 3VP2A 4JPMA 5B31D 1ULYA 5DNNB 4EBPA 2WKIA 1Q2QA 5CECA 2Q9MA 5EVIA 4H8RA 1RGZA 3RELA 3AZID 3GV9A 2EX2A 3WTPD 4NFTA 3W96D 3REKB 3PBTA 1P3AD 4QLCD 5DF7A 3W98C 3REHC 3EPLA 1W5DA 3MNNC 3TSGA 3IXGA 3WAAB 4S2NC 1EI5A 3AZND 4NZ1A 3CG5A 3IXBA 2F2AC 3ZHHA 4DXCA 3LELD 1P3KA 3IH9A 3KXBC 3AZFA 3MGRD 5AV5B 3KUYA 2JBFA 3KS8A 5GSUC 1TEMA 4RVAA 5B1LA 3CZDA 4OONA 4J8WD 3X1UB 4QY6A 1P3FD 3IWIA 5B32A 3AZMB 1P3OD 2F8NA 1K55A 5FATA 3E2KA 1MWRA 3LJAC 1JTGA 1N4OA 1P3LC 3C1CB 4BD1A 4NETA 5FA7A 3B6FD 3PBOA 4WU8A 4PM7A 3A6ND 4Z66D 2PYOB 3UO9A 1RCJA 4NY2A 1DY6A 3OCNA 4QB8A 2J7VA 4KHAA 3WKJB 4YFMA 3N6IA 3H0RC 1EROA 2FJ7B 3W99C 4EO5B 4WM9A 4UAAA 4WV4B 4AWLB 2RIQA 4QY5A 1IYPA 1M19A 5B33A 1TAFB 4NZ4A 5AV8B 4S2IA 4HESA 4GD6A 3KWQB 4GB7A 1P3MA 2Y2KA 3UTBD 3G32A 3AV1C 1K56D 4RA7A 2G5HC 4Z5TC 1TDGA 3BECA 4KGCA 3X1TB 3SS5A 5FQ9A 3X1SD 1L0FA 1PW8A 5FUGA 2RCXA 4R8PB 1F66B 3L25A 2ZQCA 2WK0A 1DJBA 1ESUA 4WJ3C 1LI0A 1S0WA 5GHYA 1XGJA 1GHPA 4KUDC 4M6BA 3H0LC 3C1BC 3W97B 1PIOA 3Q1FA 3AZGC 1PZPA 3GTCA 3AV2A 3AZHD 5B40D 3MGPD 3AZJB 4J8XB 5D3OA 5AQ7A 5GT3A 1P3GD 3WS2A 5DTKA 4XZQA 3AN2B 4GDNA 4JBFA 1HVBA 5KMWA 2AROC 1ZLAB 3UTAC 5AY8D 4PM5A 5KDMA 3Q7VA 1BZAA 1TZYB 2HUEC 2JSSA 3AYWC 5F1FA 3FKVA 5E2GA 3ZG0A 3JYIA 4LD9B 5AVCC 1BH8A 3L28A 3B6GA 1EQZC 2P74A 3WA9A 5B2JC 2BYMA 3NDEA 1F1EA 2BYKA 1L0GA 3AZNC 1BLSA 4N9KA 5B0YA 5CGSA 3HLFA 3LZ1D 2HIOA 4X23B 3C4PA 1HD8A 5HARA 5G49B 4YM6C 5DNNA 2VGJA 5B31B 2ZY3A 5FAPA 2NZDB 4JXSA 1P3OC 3UDIA 4OPRA 3REKA 4OJLA 3AZIB 4ZTKA 1SHVA 3DWZA 1JWPA 5BNVB 2HP9A 3NDGA 3UPNA 2XQZA 1P3AB 4QLCB 3OPHA 4PM8A 3WAAA 3TU4D 3OPRA 1H8ZA 5AV6C 4NZ3A 1U60A 1KX4B 3MKFA 2ZM5A 4P6BA 4Z2MG 4WYYA 4H9OB 3LELB 5AV5A 4ZBJC 1P3PB 1PI4A 4H9QB 1K57A 1HTAA 3MGRB 2EX9A 1FCMA 3EQUA 3X1UA 4H9SC 3LEZA 3AZMA 1E3UD 3V9RB 4J8WB 4KZ4A 1P3FB 5GXQC 3C1CA 2WADA 2WKHA 4OPYA 4JXVA 1I5QA 4YS3D 2OLVA 2C6WB 3O3VA 3A3EA 1NRFA 2PYOA 3A6NB 2R9XA 4Z66B 3O87A 4OOYA 4Y0UA 3WKJA 3HLDA 3HVFA 1PWCA 3NCKA 3REJD 2CV5C 1ZG6A 4OQGA 2FJ7A 3GRJA 3AZHC 4JJNC 1ID3D 2HDRA 3RELC 3WS5A 3FV7A 3MGPC 4BL2A 5E5AD 1TAFA 5AV8A 2G5IC 1T3UA 3A3IA 5CTMA 1HQ3D 3KWQA 3N3FA 3TOIA 2QPNA 1K6RA 2J8PA 5CPIC 4JKTA 3FKWA 4DE2A 3UTBB 3X1TA 5GLAA 5CPJD 2XFTA 4GDBA 1E4DA 2V20A 3HLWA 1NY0A 4ZUXD 4R8PA 1F66A 1YU4A 5DTTA 3BFDA 3X1SB 4HBTA 5B1MC 3PBNA 1KDWA 4ZBEA 5FI2A 3W97A 3B3XA 3VH5W 1YUEA 3AZED 3V3SA 1KU5A 1K54A 3AZJA 5DNMD 4J8XA 2F8NH 2IOUA 1WE4A 5B40B 3NQUB 5GLBA 3UN7A 1N9BA 4IBIA 5CERA 4ZAMA 1KX3C 1SCWA 5FAQA 3GVBA 1P3GB 3AZLC 5B0ZC 2ZY2A 2XD5A 3WX7A 3AN2A 3O62C 3R45B 1XXMA 1ZLAA 1M18B 5B24C 4PM9A 1TZYA 3BFEA 5AY8B 2EXAA 3ISGA 5GT0B 3ZG8B 4OVDA 4LD9A 3W98D 5B2ID 3REHD 4KQOA 3ZDJA 4LV0A 3MNND 1P3MC 2IWBA 4BJPA 1XPBA 2HDSA 1BLPA 1W8QA 5GHZA 4X23A 4E3OA 4KZBA 5AQBA 3KXBD 1W7FA 3EPJA 3KS4A 5G49A 2XK1A 1U35B 1MWTA 5A90A 5GSUD 5B31A 3LY3A 2NZDA 1WYBA 1H3OB 1P3LD 4DF6A 3LZ0C 1QMEA 3AZIA 3UDFA 5BNVA 4DKIA 4YS3C 5CPKC 1KVLA 4R4SA 3Q82A 3VH5T 1P3AA 4QLCA 4O7DA 3FZCA 1ZC2A 1YU0A 3HL9A 1FCNA 4KQQA 3TU4B 2YFWB 4XZQC 3M6BA 1KX4A 2V2FF 3W99D 4H9OA 3ZCZA 3LELA 1ERMA 3WRZA 1P3PA 4H9QA 2EFUA 4E45A 2ZJ9A 3Q07A 3MGRA 1M40A 4WZ4A 5FQMA 2WAEA 3AGDA 3HUOA 5DF8A 3V9RA 1JVJA 4J8WA 1P3FA 4Z5TD 2DCFA 3ZFZA 5HAPA 3MGSC 3WRTA 3C5AA 4WBGA 4MBFA 4ZUXC 3IF6C 4J8VD 3L29A 1SDNA 5EECA 3A6NA 4Z66A 3LCEA 3IHAA 4J8UC 3MGQB 1AOIC 4KUDD 1LLBA 4DE1A 3AGFA 3C1BD 3AZGD 1G68A 2E8IA 3HSHA 5TGFA 4NE3A 1YMXA 5A92A 4KZ6A 5C3IC 1ID3B 3IWOA 1PYYA 5CP6B 3AFAB 2RVQC 1MKIA 1HQ3B 3UTBA 1YLZA 3WAAC 1K56A 4M3KA 1P34C 1C3BA 4IBFA 5CPJB 2AROD 3FDDA 3UTAD 1FR6A 1Q2PA 3X1SA 4NYUA 3AYWD 3IP4C 1WWIA 4LENA 5AVCD 5JRGD 5B2IC 3NBLA 4L0LA 1EQZD 4KZAA 5B2JD 2ZY5A 1KDSA 3AZEB 1ONHA 5EVLA 1VQQA 4IVIA 5B40A 3NQUA 2IO5C 5DNMB 2Y91A 3WS4A 1KE3A 5BNXB 3LO7A 1XP4A 4YM6D 2PYOC 4X68A 1P3GA 4HEFA 1NYMA 3S22A 4OJ6A 1IKGA 1RP5A 1BUEA 3P98A 1L2SA 3R45A 3O86A 1M18A 2ZC5B 4KZ7A 3NQJB 2XEPA 3L27A 4PPRA 5AY8A 4WMCD 2ZM0A 1K4EA 2XLNA 5GT0A 2ZC7A 2FFFB 3W98B 3REHB 4E6XA 4WZ5C 5F1GA 3M2KA 3MNNB 3DW0A 3IH8A 2FFYA 4XUJC 2Y2LA 5AV6D 1YU2A 4GOGA 1KX5C 1YT4A 4JF4A 2ZM2A 2F8NK 2B5RA 4N9LA 1F66C 1ES5A 2ZQ8A 2WYXA 1U35A 1P3BD 2W8SA 3KXBB 3A3FA 5GLCA 4E3MA 4D2OA 4UUZB 5GSUB 3HLCA 3ZVWA 5J8XA 4OLDA 4KG2A 1H3OA 1OMEA 5GXQD 1K54C 3G4PA 2I72A 3LJAB 1W79A 1P3LB 2Y2PA 3VP0A 4WU9C 3OZHA 2BLSA 5M18A 4J8VC 3W4PA 4ZJ3A 3W8KA 4S2MA 5A91A 3AZKB 3UPPA 3TU4A 3P5JB 2CV5D 4EUZA 5HL1A 1K25A 3M6HA 4JJND 2J9PA 2P9VB 2OV5A 3RELD 3W99B 3UE1A 1MWUA 3IF5A 5FQIA 2XDMA 4OP5A 4MEZA 1LHYA 5CPID 3X1VC 3TG9A 1IYOA 3BLMA 3AV1B 1E3UA 4UHUA 3VP1A 4WELA 4Q8IA 1CEFA 4FSFA 4A5RA 3VFFA 3WS0A 3H0MC 4HBUA 2XFSA 5B1MD 1P3KD 1JFIB 3REIB 3E2LA 5HAIA 3MGQA 3KUYD 3ZG7B 1WWSA 5JRGC 3P09A 2NZDC 5HW3A 3C1BB 2WKEA 3AZGB 2ZQ7A 3L2AA 2WGWB 5AQAA 3SS4A 2ZY4A 4ZJ1A 1ID3A 5A93A 2NQBC 5CP6A 3AFAA 3MVDB 3G35A 3UY6A 4IBRA 1HQ3A 4E3NA 1KX3D 3N8RA 3AZLD 5B0ZD 4EV4A 5AV9C 1FOFA 3O62D 5CPJA 5AVBC 5F99C 5B24D 2AROB 3UTAB 1G6AA 5FQJA 3WTPB 4OPQA 1IYQA 3AYWB 3W96B 3KFUG 5AVCB 1P3MD 4QHCA 4P87A 3UT9C 3AZEA 1EQZB 2H0TA 3A1IA 5B2JB 5DNMA 1MBLA 4JLFA 1NXYA 2V1ZA 3AZNB 4GHLA 5BNXA 5M19A 1P3BC 2XGNA 1GA9A 4ZJ2A 1JWVA 1MPLA 3MXRA 4YM6B 4EBLA 3IXDA 1BULA 2Y59A 4U3TA 3GQZA 3NQJA 1S32C 4IVKA 4UA7A 3LZ0D 1DJCA 1P3OB 1O7EA 1M1AC 1WYCA 4GD8A 5EOEA 4C6YA 4Z2MH 4MBKA 1FSWA 5CPKD 4E3KA 3B6FB 3HLBA 3W98A 3REHA 1P3IC 1L0DA 1QMFA 4OQIA 4DRAA 1BT5A 5BS7C 5CHJA 3RXWA 3SH9A 3MNNA 1B6WA 3MZDA 5GL9A 3NC8A 4KENB 4S2NA 4XZQD 3AGEA 5F83A 2WUQA 1CI8A 5AV6B 2Y2HA 2Y2OA 5EVIC 4WZSB 4WEJA 3KXBA 5F82A 4RYEA 4UUZA 4ZBJB 3EPKA 1K6SA 3F6TA 5GSUA 3AL0C 4E3LA 4KG5A 2Y2MA 2H5SA 3WA9D 4GNUA 2EFXA 3LJAA 3MGSD 1P3LA 1TVFA 5GXQB 4HGAC 3QNCA 3BYDA 1K4FA 2JC7A 4KZ5A 4R1GA 3DWKA 1P3KC 4J8UD 3AZFC 2LY8A 3AZKA 4PMAA 3WWXA 1AOID 3UE3A 1BLCA 2ZQ9A 3KUYC 1GHMA 3V3RA 5B1LC 3MFDA 3WS1A 5E2EA 3IQAA 4K0XA 3ZNYA 5B32C 1K55C 2P9VA 2CV5B 5BT1C 3W99A 3AZHB 4JJNB 4S2OA 2ZMAA 3RELB 3IHBA 3MGPB 4WU8C 4ZDXA 4QNLA 2RVQD 4OJPA 3KSYA 1MWSA 3AV1A 3WAAD 5CPIB 4Y0OA 1P34D 1BLHA 2H10A 2HPBA 4C75A 4QU3A 4KG6A 5M1AA 4FH2A 3VH6W 1JFIA 2Y2QA 3REIA 1N1JB 5EUAA 1U35C 5B1MB 4YINA 4X6TA 4GZBA 1M19C 4CAYB 1I2WA 5B33C 4DDSA 3AZMD 3C1BA 3AZGA 1BFMA 4IEDA 1JTDA 2OLUA 2WGWA 4WEKA 4Y0TA 2EX8A 4R3JA 3VOZA 5BO0B 4KGCC 1YMSA 2DQNC 3MVDA 4LV1A 1MY8A 2WGIA 3OPLA 3ZG5A 3BFFA 5JA4B 3LZ1B 2PYOD 4S2JA 2Y2IA 1KX3B 4OP8A 5E2HA 3G34A 3G2YA 3AZLB 4UPKA 5B0ZB 3S1YA 2WAFA 5HX9A 4OQ0A 3NI9A 1FSYA 3O62B 2AROA 3UTAA 3AV2C 5BPVA 2Y55A 5B24B 4IBKA 1I2SA 3WTPA 4U0TA 5DVAA 1YLTA 2ZLYA 5AV8D 3AYWA 3W96A 1YLPA 4X55A 5AVCA 2EXBA 5FDHA 5GT3C 2Y2GA 4DRBA 2JCHA 4G92B 1AXBA 3NIAA 1CI9A 5E43A 1XA1A 5B2JA 4C3QA 3HLEA 3IT9A 3X1TD 3G30A 1VM1A 4XUJD 4CPKA 2RL3A 1KX5D 3BFGA 3AZNA 5G18A 2WZXA 1F66D 4LV3A 4R3BA 3UE0A 4G91C 2X71A 1NJ4A 4YM6A 3ZNTA 4H9RB 3B0DC 3VH6T 3FKEA 3B0BA 3B6GC 2PU4A 1KVMA 3WA9C 1P3OA 4WMCA 3I7JA 4JXWA 4WU9D 3LZ0B 4CJNA 4DDYA 4JF6A 3B6FA 5B0YC 2Q9NA 4IBDA 2HIOC 4E3JA 4YS3B 5CPKB 5KSCA 3RJUA 1HTZA 5DNNC 5FQQA 5AV6A 4MLLA 4XZQB 5KZHA 3REJB 4EQIA 3REKC 2ZQDA 2YFVB 5E5AB 3WTPE 3S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWG A;  3MKF A;  2BLS A;  4P6B A;  5M18 A;  3W4P A;  4N1H A;  4WYY A;  1FCO A;  4LCM A;  1H5X A;  5U47 A;  4ZJ3 A;  3W8K A;  3HRE A;  4S2K A;  4S2M A;  5A91 A;  2ZC6 B;  4E6W A;  3ZG9 B;  4DE3 A;  1CK3 A;  1ES4 A;  3C4O A;  1YLW A;  1PI4 A;  3UPP A;  4S2P A;  1LL9 A;  2ZC4 B;  1K57 A;  3HLG A;  4F94 A;  2EX9 A;  4OH0 A;  1FCM A;  1NYY A;  1XX2 A;  3EQU A;  4EUZ A;  3LEZ A;  5HL1 A;  1K25 A;  1SDE A;  3M6H A;  3BEB A;  3IF6 B;  4R23 A;  2J9P A;  2P9V B;  1E3U D;  2OV5 A;  1ERQ A;  1HZO A;  1NZO A;  4KZ4 A;  5BOH A;  1ONG A;  2WAD A;  4OPY A;  2WKH A;  2JE5 A;  5DF9 A;  3UE1 A;  1IEL A;  1YM1 A;  1K57 C;  1MWU A;  3IF5 A;  3N8L A;  5FQI A;  3ZVT A;  3A3D A;  4JXV A;  2XH9 A;  5FAS A;  1I5Q A;  2XDM A;  2DRW A;  4OP5 A;  4QD4 A;  2OLV A;  2X01 A;  3V39 A;  2C6W B;  3PBQ A;  5EE8 A;  3O3V A;  4MEZ A;  2QZ6 A;  1LHY A;  4U0X A;  3VSL A;  3A3E A;  1NRF A;  1YLJ A;  3TG9 A;  3UDX A;  1IYO A;  4ID4 A;  4LCL A;  2R9X A;  1L0E A;  3BLM A;  2XD1 A;  4BQM A;  1E3U A;  3O87 A;  2A3U A;  2XR0 A;  4OOY A;  4N92 A;  5EOO A;  4UHU A;  3VP1 A;  4WEL A;  1TDL A;  4Y0U A;  3PAE A;  4Q8I A;  1CEF A;  3HLD A;  4FSF A;  3HBR A;  3HVF A;  4OOL A;  4A5R A;  1PWC A;  3NCK A;  3VFF A;  3WS0 A;  5HAQ A;  4HBU A;  2XFS A;  1Z6F A;  1ZG6 A;  4OQG A;  1IEM A;  5EPH A;  3GRJ A;  3E2L A;  5HAI A;  3SH8 A;  2HDR A;  3WS5 A;  3FV7 A;  4BL2 A;  4XUX A;  3ZG7 B;  3PBS A;  5CEB A;  3A3I A;  1CEG A;  2GDN A;  3N8S A;  5CTM A;  3P09 A;  1J9M A;  3VP4 A;  3TOI A;  2QPN A;  5HW3 A;  2Y2J A;  2WKE A;  1YLY A;  1K6R A;  4OQH A;  2IWC A;  1PZO A;  2ZQ7 A;  1XA7 A;  3SS4 A;  2WGW B;  4JKT A;  5AQA A;  3LY4 A;  3FKW A;  4DE2 A;  1RGY A;  5GLA A;  4ZJ1 A;  5A93 A;  2HP5 A;  2XFT A;  1FR1 A;  4GDB A;  4MNR A;  3RXX A;  3IWQ A;  4P0M A;  1E4D A;  2V20 A;  4DRT A;  3HLW A;  3G35 A;  1NY0 A;  4FD8 A;  3ZGA B;  4E3I A;  1NZU A;  3VP3 A;  1ZG4 A;  3UY6 A;  4IBR A;  5CHM A;  5DTT A;  4E3N A;  3N8R A;  3BFD A;  4HBT A;  3UNW A;  3PBN A;  1KDW A;  3C7V A;  4EV4 A;  5DTS A;  4JF5 A;  3VSK A;  4ZBE A;  2ZC3 B;  3OCL A;  1FOF A;  1S6R A;  4B4X A;  5FI2 A;  2QMI A;  3FWL A;  3B3X A;  5CTN A;  2IWD A;  2Z2M B;  2HDU A;  3V3S A;  5I94 A;  4KZ9 A;  4R0Q A;  1G6A A;  1K54 A;  3V50 A;  4LV2 A;  1JWZ A;  1GA0 A;  3VFH A;  2Y4A A;  3MZF A;  2C5W B;  3MZE A;  5FQJ A;  4BL3 A;  4OOM A;  5KSH A;  1WE4 A;  4OPQ A;  1IYQ A;  4BLM A;  5GLB A;  3UN7 A;  1EWZ A;  2BG1 A;  4QHC A;  1N9B A;  1ES2 A;  4P87 A;  5TR7 A;  5CER A;  4KZ8 A;  4ZAM A;  3SS3 A;  1SCW A;  5FAQ A;  2H0T A;  3GVB A;  3Q7V B;  1K38 A;  1IYS A;  3FYZ A;  5CGX A;  3BFC A;  1LI9 A;  1MBL A;  4JLF A;  1NXY A;  2V1Z A;  2XD5 A;  4NK3 A;  4JXG A;  4KZ3 A;  4PM6 A;  1XXM A;  5M19 A;  1PI5 A;  1XKZ A;  1PW1 A;  4MBH A;  3Q81 A;  2HP6 A;  4PM9 A;  3BFE A;  2R9W A;  1GA9 A;  2EXA A;  1JWV A;  1MPL A;  2XGN A;  3MXR A;  4ZJ2 A;  3ISG A;  4EBL A;  3MXS A;  3ZG8 B;  3CJM A;  4OVD A;  3IXD A;  1BUL A;  2Y59 A;  3HUM A;  4U3T A;  5JYO A;  4KQO A;  5EVI D;  3ZDJ A;  3GQZ A;  4LV0 A;  4GN2 A;  4XXR A;  1KE4 A;  2IWB A;  4IVK A;  4UA7 A;  1DJC A;  3VP2 A;  4JPM A;  1O7E A;  1WYC A;  2A49 A;  4GD8 A;  5EOE A;  4BJP A;  3D4F A;  4C6Y A;  1XPB A;  4MBK A;  4EBP A;  1FSW A;  2WKI A;  2HDS A;  5AQ9 A;  1IKI A;  4E3K A;  1BLP A;  1W8Q A;  1FQG A;  5GHZ A;  1MXO A;  3HLB A;  4B4Z A;  1DJA A;  4E3O A;  1QMF A;  1L0D A;  1Q2Q A;  4KZB A;  4OQI A;  2Q9M A;  2UWX A;  5CGW A;  5AQB A;  5CEC A;  1W8Y A;  5EVI A;  1BT5 A;  3GMW A;  1W7F A;  4H8R A;  5CHJ A;  5GLD A;  3RXW A;  1RGZ A;  3SH9 A;  2XK1 A;  3MZD A;  1ES3 A;  3G31 A;  1MWT A;  5GL9 A;  5A90 A;  3GV9 A;  2EX2 A;  3NC8 A;  4KEN B;  5TFQ A;  4S2N A;  4QJG A;  3LY3 A;  3PBT A;  3AGE A;  5F83 A;  2WUQ A;  1CI8 A;  5DF7 A;  5GHX A;  2Y2H A;  2Z2L B;  2Y2O A;  1PWD A;  1WYB A;  5EVI C;  4EWF A;  4DXB A;  1W5D A;  4WEJ A;  3TSG A;  4DF6 A;  5F82 A;  3IXG A;  3Q7Z A;  4RYE A;  4Z9Q A;  4S2N C;  1QME A;  1EI5 A;  3QHY A;  1K6S A;  3UDF A;  3CG5 A;  2WGV A;  3IXB A;  4DKI A;  4E3L A;  4KG5 A;  1KVL A;  2Y2M A;  4R4S A;  3ZHH A;  4DXC A;  3Q82 A;  2H5S A;  4GNU A;  4O7D A;  3FZC A;  1ZC2 A;  3IH9 A;  3VOY A;  2EFX A;  3BLS A;  3HL9 A;  1TVF A;  1FCN A;  2DNS A;  4KQQ A;  1M6K A;  2JBF A;  3QNC A;  2PBY A;  1TEM A;  4RVA A;  3M6B A;  3BYD A;  4OPZ A;  3CZD A;  2Y2N A;  1K4F A;  4OON A;  2JC7 A;  4KZ5 A;  4QY6 A;  2H0Y A;  4R1G A;  3DWK A;  3IWI A;  1K55 A;  2V2F F;  5E2F A;  3ZCZ A;  5FAT A;  3E2K A;  5JYP A;  1ERM A;  4PMA A;  3WWX A;  3W4O A;  1MWR A;  3WRZ A;  1JTG A;  1N4O A;  4K0W A;  3UE3 A;  1BLC A;  2EFU A;  2ZJ9 A;  1GHM A;  2ZQ9 A;  4RX3 A;  3Q07 A;  4NET A;  3V3R A;  4BD1 A;  4RX2 A;  5FA7 A;  1M40 A;  3PBO A;  4WZ4 A;  3PAG A;  5FQM A;  2WAE A;  3MFD A;  3WS1 A;  3AGD A;  5E2E A;  3IQA A;  4PM7 A;  4K0X A;  3IF6 A;  3HUO A;  3SOI A;  3ZNY A;  1K55 C;  2P9V A;  3BRM A;  5DF8 A;  1JVJ A;  3VMA A;  1LL5 A;  2DCF A;  3UO9 A;  3ZFZ A;  2ZM8 A;  1RCJ A;  4KQR A;  1DY6 A;  5HAP A;  3OCN A;  4FCF A;  4S2O A;  2ZMA A;  5L2F A;  5CHU A;  3IHB A;  3N4I A;  1KGF A;  4QB8 A;  3WRT A;  3ITA A;  2J7V A;  3C5A A;  4ZDX A;  4FH4 A;  4WBG A;  4K91 A;  4MBF A;  4P85 A;  1E25 A;  3IF6 C;  1SDN A;  4YFM A;  3N6I A;  5EEC A;  1ERO A;  1MWS A;  3A3J A;  3LCE A;  2X02 A;  3EQV A;  3GSG A;  4WM9 A;  5IHV A;  4UAA A;  4QY5 A;  3IHA A;  4Y0O A;  1IYP A;  1BLH A;  3N7W A;  2H10 A;  2HPB A;  5FAO A;  4C75 A;  1ALQ A;  1LLB A;  4KG6 A;  1ESI A;  4QU3 A;  5M1A A;  4DE1 A;  3AGF A;  4S2I A;  4FH2 A;  4HES A;  4GD6 A;  1G68 A;  1XGI A;  2E8I A;  4GB7 A;  5TGF A;  2Y2K A;  2Y2Q A;  3G32 A;  5EUA A;  1YMX A;  4X56 A;  5A92 A;  2HDQ A;  1K56 D;  4RA7 A;  2OSU A;  3OPP A;  4YIN A;  4KZ6 A;  1TDG A;  3BEC A;  4X6T A;  4GZB A;  1KE0 A;  1I2W A;  4IBX A;  4S2L A;  3SS5 A;  3IWO A;  4Y7P A;  1PYY A;  4DDS A;  5FQ9 A;  3M2J A;  1BTL A;  1L0F A;  1PW8 A;  1KGE A;  2RCX A;  3DTM A;  1JTD A;  4IED A;  1MKI A;  2ZQC A;  2OLU A;  2WGW A;  4WEK A;  4Y0T A;  2WK0 A;  1DJB A;  1ESU A;  2EX8 A;  4GKU A;  1YLZ A;  4R3J A;  5FSR A;  3VOZ A;  3PBR A;  2PU2 A;  1K56 A;  1LI0 A;  1S0W A;  1YMS A;  4M3K A;  2ZD8 A;  4N1X A;  5GHY A;  4LV1 A;  1C3B A;  1XGJ A;  1GHP A;  1MY8 A;  2WGI A;  3OPL A;  3ZG5 A;  1FR6 A;  1PIO A;  3Q1F A;  1Q2P A;  1H8Y A;  3BFF A;  1PZP A;  3GTC A;  4S2J A;  2Y2I A;  4OP8 A;  5E2H A;  3G34 A;  4LEN A;  3G2Y A;  5D3O A;  3NY4 A;  3S1Y A;  3V5M A;  2WAF A;  3NBL A;  5HX9 A;  4OQ0 A;  3NI9 A;  5AQ7 A;  5CXW A;  1FSY A;  4L0L A;  1BSG A;  4KZA A;  3CMZ A;  4UA6 A;  4BEN A;  2Y55 A;  1KDS A;  3WS2 A;  1ONH A;  1I2S A;  5EVL A;  1VQQ A;  4IVI A;  4B88 A;  1O07 A;  4U0T A;  5DTK A;  5DVA A;  1YLT A;  2ZLY A;  1Y54 A;  2Y91 A;  1YLP A;  3WS4 A;  4GDN A;  1KE3 A;  2EXB A;  4JBF A;  3OC2 A;  4X55 A;  5FDH A;  2Y2G A;  1HVB A;  5KMW A;  3HUN A;  2JCH A;  4PM5 A;  1AXB A;  3NIA A;  3LO7 A;  1XP4 A;  5CED A;  1CI9 A;  3W4Q A;  4X68 A;  5E43 A;  1XA1 A;  3Q7V A;  4BD0 A;  3MBZ A;  3HLE A;  3IT9 A;  4C3Q A;  3MKE A;  1BZA A;  4HEF A;  3G30 A;  1VM1 A;  1NYM A;  3S22 A;  1IKG A;  4CPK A;  2RL3 A;  1RP5 A;  1BUE A;  3BFG A;  2XF3 A;  5F1F A;  3ITB A;  3P98 A;  3FKV A;  5E2G A;  3ZG0 A;  3JYI A;  4EBN A;  1L2S A;  5G18 A;  3O86 A;  2WZX A;  4LV3 A;  2ZC5 B;  4R3B A;  3UE0 A;  4X69 A;  4KZ7 A;  4OLG A;  2P74 A;  2XEP A;  2X71 A;  4PPR A;  2G2W A;  3SH7 A;  4WMC D;  4WZ5 A;  1NJ4 A;  2ZM0 A;  2EX6 A;  2CC1 A;  1K4E A;  3ZNT A;  2XLN A;  3NDE A;  3QNB A;  1KGG A;  2G2U A;  1YQS A;  1L0G A;  2WZZ A;  1BLS A;  2ZC7 A;  4N9K A;  5CGS A;  3UPO A;  3HLF A;  3IXH A;  2FFF B;  2PU4 A;  1KVM A;  3G2Z A;  4E6X A;  3C4P A;  4WZ5 C;  5EVI B;  5F1G A;  1HD8 A;  5HAR A;  3M2K A;  4DE0 A;  3DW0 A;  4WMC A;  3IH8 A;  3I7J A;  5FI6 A;  4JXW A;  4CJN A;  2FFY A;  2Y2L A;  2VGJ A;  4GOG A;  5FQK A;  4JF6 A;  1YT4 A;  4DDY A;  3C7U A;  3PTE A;  4OKP A;  4UA9 A;  2Q9N A;  4JF4 A;  4E3J A;  2ZM2 A;  5FAP A;  1GCE A;  2B5R A;  1ES5 A;  2ZQ8 A;  4JXS A;  4N9L A;  3RJU A;  5KSC A;  2ZQA A;  2J8Y A;  2WYX A;  1HTZ A;  3GR2 A;  3UDI A;  4X53 A;  4OPR A;  4XUZ A;  3A3F A;  5FQQ A;  5GLC A;  4E3M A;  4D2O A;  1SKF A;  4ZTK A;  1SHV A;  1ZKJ A;  3DWZ A;  1JWP A;  3HLC A;  1GHI A;  2HP9 A;  4MLL A;  3NDG A;  3ZVW A;  5J8X A;  5KZH A;  4R4R A;  4OLD A;  3BM6 A;  3UPN A;  2XQZ A;  4KG2 A;  5FI7 A;  1OME A;  3OPH A;  1K54 C;  4PM8 A;  3G4P A;  4EQI A;  2VGK A;  3OPR A;  2I72 A;  2ZQD A;  5CRF A;  1W79 A;  3O88 A;  2J9O A;  2Y2P A;  1H8Z A;  3VP0 A;  5HFO A;  3S4X A;  1U60 A;  3OZH A; 
#chains in the Genus database with same CATH topology
 1PWG A;  1YU3 A;  3X1V D;  4FTX A;  3WD1 A;  1UR9 A;  4LCM A;  1H5X A;  5U47 A;  5HSQ A;  3UME A;  2ZBB A;  3HRE A;  4S2K A;  2AVX A;  5GXQ A;  1CK3 A;  1ES4 A;  4D60 A;  1YLW A;  3IS2 B;  2V8F A;  4EW7 A;  4H9N B;  4OH0 A;  3MGS B;  3VV4 A;  4ETX A;  1NYY A;  1KOU A;  3BEB A;  1LSX A;  1Q9C A;  4ZUX B;  4IJE A;  3L26 A;  3IF6 B;  4R23 A;  3PHY A;  1NZO A;  1HZO A;  1OTB A;  2Y8H A;  1NLY A;  5AV5 C;  1ONG A;  3OLO A;  3PYP A;  3LR5 A;  1IEL A;  1YM1 A;  1K57 C;  4J8U B;  5L10 A;  3N8L A;  3EPH A;  1AOI B;  2XH9 A;  3A3D A;  1A7W A;  2NZD D;  3X1U C;  3AZM C;  2JN7 A;  2QZ6 A;  4U0X A;  3FPV A;  2CV5 A;  3VSL A;  1W63 M;  1Z2C B;  1YLJ A;  3UDX A;  3AZH A;  1L0E A;  4JJN A;  3C1C C;  2NQB D;  5G4Y A;  3MGP A;  4N92 A;  5EOO A;  3PAE A;  5C3I B;  3T4T A;  4OOL A;  1LSW A;  4Q0H A;  1PZR A;  4IBC A;  1Z6F A;  5HD5 A;  1IEM A;  3FPW A;  5EPH A;  1BH9 B;  5AV9 D;  5CPI A;  4OJ5 A;  3PBS A;  5AVB D;  5F99 D;  3WKJ C;  1KX4 D;  1GSX A;  1P34 B;  5CEB A;  1CEG A;  2GDN A;  3N8S A;  2PD8 A;  3DTI A;  1J9M A;  2Y2J A;  1N1J A;  2QWS A;  2FJ7 C;  4EO5 C;  4OQH A;  4AWL C;  1PZO A;  5B1M A;  2RTS A;  1LT0 A;  1XA7 A;  2IWC A;  2W1T B;  1P3P D;  2GNX A;  4CAY A;  2HP5 A;  1FR1 A;  3RXX A;  5AV8 C;  3IWQ A;  4DJ2 A;  4P0M A;  2VGL M;  3KWQ C;  4FD8 A;  3ZGA B;  4E3I A;  3VP3 A;  5B2I B;  3UT9 D;  5CHM A;  4CSR B;  3C2W A;  2W3H A;  2V9A A;  5BO0 A;  3C7V A;  2V0U A;  5DTS A;  3X1T C;  4L9E A;  3VSK A;  2ZC3 B;  3T4Q A;  4MB5 A;  3MQ0 A;  2JKT M;  2IO5 B;  5K5B A;  3FWL A;  4R8P C;  5CTN A;  2IWD A;  5JA4 A;  3LZ1 A;  4KZ9 A;  4R0Q A;  3V50 A;  4LV2 A;  1KX3 A;  1JWZ A;  3A1K A;  3AZK C;  3VFH A;  3MZF A;  5KSH A;  3MZE A;  3AZL A;  4OOM A;  5B0Z A;  4BLM A;  4Z2G A;  3QP1 A;  3W97 C;  4NZ5 A;  3O62 A;  1S32 D;  4CQH A;  5J7E A;  5TR7 A;  3CIT A;  5B24 A;  3AZJ C;  1M1A D;  4J8X C;  4X1L A;  1K38 A;  4EEU A;  2JKG A;  3FYZ A;  2HJE A;  5CGX A;  4LRX C;  3BFC A;  1LI9 A;  3OOV A;  3T4S A;  4NK3 A;  4JXG A;  4KZ3 A;  4PM6 A;  1P3I D;  1XKZ A;  2QKP A;  3Q81 A;  2HP6 A;  5F69 A;  2R9W A;  2YFW A;  1N9N A;  3MXS A;  2A2L A;  3DBA A;  3AN2 C;  4XUJ B;  1KX5 B;  1ZLA C;  3HUM A;  5EVI D;  4XXR A;  4GH9 A;  4IBE A;  3REI C;  1KE4 A;  1TZY C;  2DF4 C;  2A49 A;  3D4F A;  4H9R A;  4LD9 C;  3UB8 A;  5AQ9 A;  1IKI A;  1FQG A;  3RH8 B;  4NXG A;  1MXO A;  4B4Z A;  1DJA A;  3MR0 A;  1T1A A;  5CGW A;  2UWX A;  1W8Y A;  3GMW A;  5GLD A;  1FIK A;  1GXD A;  2H28 A;  2KX6 A;  1XJ6 A;  3T4L A;  1ES3 A;  3G31 A;  3F1P A;  4LG2 A;  4Z5T B;  3T4O A;  3LZ0 A;  1S1Z A;  5TFQ A;  4QJG A;  3MVD C;  4X23 C;  4WU9 B;  4YS3 A;  5CPK A;  5GHX A;  2Z2L B;  1PWD A;  4EWF A;  3AZF D;  4DXB A;  4J8V B;  1F5M A;  2DMW A;  4Y15 A;  3Q7Z A;  4Z9Q A;  5B31 C;  3QHY A;  5B31 G;  3H7W B;  5B1L D;  3T1Q B;  4I3J A;  2WGV A;  3VH5 A;  4IBB A;  1M18 D;  4KUD B;  5B32 D;  2F8N D;  3REJ A;  4GJ4 A;  5BT1 D;  5EV0 A;  2GX5 A;  3VOY A;  5GT0 D;  3DTE A;  2YFV A;  4JGO A;  3BLS A;  3AZI C;  2DNS A;  5E5A A;  3WTP C;  4WU8 D;  1M6K A;  2OAQ 1;  2PBY A;  3W96 C;  4OPZ A;  2JKT I;  3U4L P;  2Y2N A;  1MZU A;  1P3A C;  4QLC C;  2H0Y A;  1W2E A;  5E2F A;  5JYP A;  3X1V B;  3W4O A;  3IS2 A;  4K0W A;  4RX3 A;  4H9N A;  3MGS A;  2J80 A;  4RX2 A;  4IBJ A;  3VH6 A;  3PAG A;  1KX4 C;  4IBG A;  3A0R A;  3MQQ A;  4ZUX A;  3IF6 A;  3SOI A;  3BRM A;  1F2K A;  3VMA A;  1U35 D;  3LEL C;  1LL5 A;  4NYY A;  2ZM8 A;  4KQR A;  3T4J A;  3MFX A;  1P3P C;  1M19 D;  2HUE B;  4FCF A;  5B33 D;  4J8U A;  5L2F A;  5CHU A;  3MGR C;  3N4I A;  4OJO A;  1AOI A;  1KGF A;  2W27 A;  2FN2 A;  3ITA A;  4BMW A;  4EER A;  4FH4 A;  4K91 A;  5JRG B;  4P85 A;  1E25 A;  1W1P A;  4J8W C;  1P3F C;  3A3J A;  2X02 A;  3EQV A;  3GSG A;  5IHV A;  4KGC D;  3N7W A;  1GOI A;  4WNN B;  4I3I A;  5FAO A;  1ALQ A;  2NQB B;  1ESI A;  1L6J A;  3B6F C;  3NHQ A;  1XGI A;  3A6N C;  1BH9 A;  4Z66 C;  3T1S A;  4X56 A;  2HDQ A;  2OSU A;  4GHA A;  3CWF A;  3E4Q A;  3OPP A;  1KE0 A;  3LEQ A;  1OTD A;  1YSQ A;  5AV9 B;  4CLC D;  4IBX A;  4S2L A;  1P34 A;  4Y7P A;  3C30 A;  3SZT A;  3M2J A;  1BTL A;  5AVB B;  5F99 B;  3AV2 D;  1KGE A;  3DTM A;  2W1T A;  4M4X A;  3UE6 A;  5FSR A;  4GKU A;  3PBR A;  2PU2 A;  1W1V A;  3GEC A;  2D01 A;  2ZD8 A;  4N1X A;  2VV6 A;  5GT3 D;  5B2I A;  1N9O A;  4CSR A;  1H8Y A;  3UTB C;  3UT9 B;  1MC0 A;  2J3T D;  3NY4 A;  5C5K A;  1F9I A;  4G3K A;  3V5M A;  5CXW A;  3X1S C;  1BSG A;  3HON A;  3CMZ A;  4UA6 A;  4BEN A;  4G3W A;  3MGQ D;  4MCW A;  1P3B B;  4B88 A;  1O07 A;  4PAU A;  1Y54 A;  1GSW A;  1T18 A;  3B6G D;  1TS7 A;  3OC2 A;  1CF0 A;  3QP5 A;  4H9P B;  3MSH A;  2VEA A;  1G5U A;  3HUN A;  5CED A;  1S32 B;  3W4Q A;  4ETZ A;  4BD0 A;  3MBZ A;  3MKE A;  5B40 C;  5CP6 D;  1R4V A;  2XF3 A;  3AFA D;  1M1A B;  3ITB A;  5B0Y D;  1UR8 A;  4EBN A;  2HIO D;  5CHL B;  2NUP C;  3IX8 A;  2L5A A;  1XFN A;  2PDR A;  4X69 A;  4OLG A;  1P3I B;  2G2W A;  4HH2 A;  3SH7 A;  5DNN D;  4WZ5 A;  1P3G C;  2EX6 A;  2CC1 A;  4DN0 A;  3QNB A;  2L0W A;  3EG5 B;  1KGG A;  2G2U A;  1YQS A;  4XUJ A;  2WZZ A;  3KSH A;  1KX5 A;  1M18 C;  3UPO A;  2QJ7 A;  2VJW A;  3IXH A;  5B32 G;  1UGU A;  2F8N G;  3B42 A;  3G2Z A;  4Z2J A;  5AY8 C;  5EVI B;  3B0C W;  3REK D;  4DE0 A;  5GT0 C;  5FEG A;  5FI6 A;  2P08 A;  3T4K A;  3CPT A;  5FQK A;  3C7U A;  3PTE A;  4OKP A;  3B47 A;  4UA9 A;  1GCE A;  2VQR A;  2ZQA A;  2J8Y A;  3LUQ A;  4B9O A;  3GR2 A;  4Z5T A;  4X53 A;  4XUZ A;  2PBD P;  4DQY B;  3MJQ A;  4NKP A;  4GCZ A;  1SKF A;  4WU9 A;  1ZKJ A;  4HGA B;  2JKF A;  5FDS A;  1GHI A;  4YNR A;  3LZ1 C;  4R4R A;  4J8V A;  3BM6 A;  5FI7 A;  5AV5 D;  1XJ3 A;  1P3K B;  5HD3 A;  3AZF B;  2VGK A;  5DFY A;  3H7W A;  5CRF A;  5L8M A;  3O88 A;  2J9O A;  3KUY B;  3X1U D;  5HFO A;  2CWE A;  4KUD A;  5B1L B;  3NUL A;  4N1H A;  2W0N A;  1FCO A;  4NE5 A;  5B32 B;  3C1C D;  2F8N B;  4HI4 A;  2ZC6 B;  4E6W A;  2EA9 A;  3ZG9 B;  4DE3 A;  3C4O A;  5EVE A;  1MKM A;  4S2P A;  1LL9 A;  5EFW A;  2ZC4 B;  3HLG A;  4YOF A;  4F94 A;  3LYX A;  4TX8 A;  2FH5 A;  1XX2 A;  4WU8 B;  1NRJ A;  1SDE A;  1OJG A;  4G92 C;  3F1N B;  3X1V A;  1ERQ A;  1OJ5 A;  1H0I A;  1S4R A;  5BOH A;  2JE5 A;  5DF9 A;  2Q0O A;  3WKJ D;  3A0V A;  3TU4 C;  3E98 A;  4HP4 A;  3ZVT A;  5FAS A;  3KSI A;  4IJF A;  2DRW A;  4QD4 A;  4KHA B;  3MF0 A;  2X01 A;  3V39 A;  5EE8 A;  3PBQ A;  2FJ7 D;  3LIA A;  3VOL A;  1E6N A;  4IUK A;  4ID4 A;  4LCL A;  2XD1 A;  3W2Z A;  4PHT A;  4BQM A;  2A3U A;  2XR0 A;  1TDL A;  1M19 B;  3KWQ D;  1YU1 A;  5B33 B;  3HBR A;  5L07 A;  5JRG A;  4B93 A;  1WA9 A;  5HAQ A;  1EQZ A;  1P3M B;  2PR5 A;  4FUW A;  3SH8 A;  3B0C T;  3LJA D;  4K08 A;  4NXE A;  4XUX A;  2M7U A;  4WNN A;  2NQB A;  4KGC B;  4NE6 A;  4R8P D;  1B67 A;  3VP4 A;  5FUG B;  2PHY A;  1YLY A;  3AZK D;  3MGQ C;  3LY4 A;  4WLA A;  1RGY A;  5AV9 A;  3DTK A;  4MNR A;  3W97 D;  4DRT A;  5F99 A;  5AVB A;  1VEU B;  4E44 A;  2B02 A;  4CLC B;  1NZU A;  3T12 B;  1ZG4 A;  3REJ C;  3AZJ D;  2V1A A;  4J8X D;  3UNW A;  3AV2 B;  4JF5 A;  1ID3 C;  2O9B A;  3OCL A;  1D06 A;  1N9L A;  4F3L B;  5CP6 C;  1S6R A;  5E5A C;  3AFA C;  4B4X A;  2MJ6 A;  2QMI A;  1E6P A;  4UQI M;  2Z2M B;  2HDU A;  5GT3 B;  1HQ3 C;  3F1O B;  3AV1 D;  5I94 A;  3UT9 A;  1YAX A;  1GA0 A;  2LB5 A;  2Y4A A;  2C5W B;  4BL3 A;  3AN2 D;  5CPJ C;  1ZLA D;  1EWZ A;  2BG1 A;  1YSP A;  3REI D;  4LGW A;  1TZY D;  1ES2 A;  1LL8 A;  2WKP A;  4KZ8 A;  5IU1 A;  5KDM B;  2O9C A;  3SS3 A;  4G91 B;  2G7U A;  1P3B A;  3Q7V B;  2XA7 S;  4LD9 D;  1IYS A;  4Z2K A;  3L7H A;  2NUT C;  3D3O A;  3LR4 A;  3B0D B;  5HPF A;  4H9S A;  2O0Y A;  4H9P A;  1BH8 B;  1PI5 A;  1S32 A;  1PW1 A;  3B6G B;  4MBH A;  3AZE C;  3WA9 B;  4LPZ A;  4OUI A;  1M1A A;  3MVD D;  5DNM C;  3MMH A;  2BYM B;  1OT6 A;  3CJM A;  2OAP 1;  2BYK B;  4X23 D;  1F98 A;  5JYO A;  5B0Y B;  2K31 A;  4H6J B;  1P3I A;  2HIO B;  4GN2 A;  5F5Y A;  5BS7 A;  1NLZ A;  3VP2 A;  4JPM A;  5B31 D;  1ULY A;  3D72 A;  5DNN B;  2PAV P;  4EBP A;  2WKI A;  1VHM A;  1Q2Q A;  5CEC A;  2Q9M A;  5EVI A;  4H8R A;  2VZW A;  1RGZ A;  1V9Z A;  3REL A;  4GS9 B;  1E88 A;  3AZI D;  2VKS A;  3GV9 A;  2EX2 A;  3WTP D;  4NFT A;  1EAK A;  3W96 D;  3REK B;  3PBT A;  4Y17 A;  3EGD C;  1P3A D;  4QLC D;  5DF7 A;  3W98 C;  3REH C;  1UWP X;  4PKY A;  1X0O A;  5DJU A;  3EPL A;  1W5D A;  3MNN C;  5DKL A;  3PR6 A;  3TSG A;  3IXG A;  3WAA B;  4S2N C;  1EI5 A;  1W63 Q;  3AZN D;  4NZ1 A;  4RQ9 A;  3CG5 A;  3IXB A;  4ESP A;  2F2A C;  4Y3I A;  4HIA A;  3ZHH A;  4DXC A;  3LEL D;  5HL6 A;  1P3K A;  5F6A A;  3IH9 A;  3KXB C;  3AZF A;  3MGR D;  1CXW A;  5AV5 B;  3CHW P;  3R7W B;  3S7P A;  3KUY A;  2JBF A;  3KS8 A;  3MQO A;  5GSU C;  1TEM A;  4RVA A;  5B1L A;  2PD7 A;  4L9G A;  3CZD A;  4OON A;  4J8W D;  3X1U B;  4QY6 A;  1P3F D;  1PFL A;  3IWI A;  5B32 A;  3AZM B;  1P3O D;  2F8N A;  1K55 A;  3CUE A;  3E2K A;  3EWK A;  5FAT A;  2PYR A;  3JPU A;  5L09 A;  1MWR A;  1OGB A;  3LJA C;  1JTG A;  1N4O A;  1P3L C;  3C1C B;  4BD1 A;  4EUV A;  4NET A;  5FA7 A;  3B6F D;  3PBO A;  3NEC A;  4WU8 A;  3F1N A;  4PM7 A;  3A6N D;  4Z66 D;  4HJ3 A;  2PYO B;  3UO9 A;  1RCJ A;  4NY2 A;  1DY6 A;  2KOI A;  3OCN A;  4QB8 A;  2J7V A;  4IHQ A;  4KHA A;  1S4S A;  3FC7 A;  3WKJ B;  3LI8 A;  4YFM A;  3N6I A;  3H0R C;  4LRZ E;  1ERO A;  2INW A;  2FJ7 B;  3W99 C;  4EO5 B;  1DP6 A;  3IBJ A;  4WM9 A;  4UAA A;  4WV4 B;  4AWL B;  2RIQ A;  1H8M A;  4QY5 A;  1IYP A;  5HDS A;  4P6Z S;  3UB5 P;  1M19 A;  2V0W A;  5B33 A;  4QWO A;  1TAF B;  4NZ4 A;  5AV8 B;  4S2I A;  4HES A;  4GD6 A;  1GPF A;  3KWQ B;  4GB7 A;  1P3M A;  2Y2K A;  3UTB D;  3G32 A;  3TE8 A;  3AV1 C;  1K56 D;  4RA7 A;  2G5H C;  4Z5T C;  1TDG A;  3BEC A;  1H3Q A;  4KGC A;  3D9Y A;  3X1T B;  3SS5 A;  2CMN A;  4R6L A;  3ZYT A;  5HZH A;  5FQ9 A;  3X1S D;  3HCY A;  1L0F A;  1PW8 A;  5FUG A;  2RCX A;  4R8P B;  1F66 B;  3L25 A;  2ZQC A;  3EOI A;  3ULF A;  2HZ5 A;  2WK0 A;  1DJB A;  1ESU A;  3E0Y A;  3KYZ A;  4WJ3 C;  4XT2 B;  1E6Z A;  1LI0 A;  1S0W A;  5GHY A;  2M1C A;  3U2A A;  1VEU A;  1XGJ A;  1GHP A;  4KUD C;  4CLC A;  4M6B A;  3H0L C;  1IOU A;  3C1B C;  3W97 B;  1PIO A;  3Q1F A;  3AZG C;  1PZP A;  3GTC A;  4YWZ A;  3TW8 A;  3AV2 A;  3AZH D;  4WL9 A;  5B40 D;  3MGP D;  5A8B A;  3AZJ B;  4F3L A;  4J8X B;  5D3O A;  3V67 A;  5AQ7 A;  5GT3 A;  2ACG A;  3F1O A;  1P3G D;  4Y13 A;  3KSF A;  3WS2 A;  5DTK A;  1VB6 A;  3MQL A;  4XZQ A;  3AN2 B;  4GDN A;  4JBF A;  1HVB A;  5KMW A;  2ARO C;  1ZLA B;  3UTA C;  5AY8 D;  4O8G A;  4PM5 A;  5KDM A;  1E6R A;  4EET B;  3Q7V A;  2ZL1 B;  1BZA A;  1TZY B;  2HUE C;  2JSS A;  3AYW C;  5F1F A;  3FKV A;  5E2G A;  3ZG0 A;  3JYI A;  1H0M A;  4LD9 B;  5AVC C;  1BH8 A;  3L28 A;  4BBV A;  3B6G A;  4HP9 A;  1EQZ C;  2P74 A;  3WA9 A;  5B2J C;  1S1Y A;  2BYM A;  4DJ3 A;  3NDE A;  1F1E A;  2BYK A;  1L0G A;  3AZN C;  3B33 A;  1BLS A;  4N9K A;  5B0Y A;  5CGS A;  3HLF A;  4H6J A;  3LZ1 D;  2HIO A;  4X23 B;  3C4P A;  1HD8 A;  5HAR A;  5G49 B;  4YM6 C;  5J4E A;  5DNN A;  2VGJ A;  1QO6 A;  5B31 B;  2E8J A;  4MB4 A;  2KLI A;  2PYP A;  2ZY3 A;  5FAP A;  2NZD B;  4CLC E;  4JXS A;  1E8B A;  3UB7 A;  1P3O C;  4GS9 A;  4NEE D;  3UDI A;  4OPR A;  3REK A;  4OJL A;  1P0Z A;  3AZI B;  4ZTK A;  1SHV A;  3DWZ A;  1KS0 A;  1JWP A;  5BNV B;  2HP9 A;  3NDG A;  2WKR A;  2D49 A;  2P7J A;  3UPN A;  2XQZ A;  1P3A B;  4QLC B;  2VA0 A;  3OPH A;  4PM8 A;  3WAA A;  3TU4 D;  1NWZ A;  3OPR A;  1H8Z A;  5AV6 C;  4MMN A;  4NZ3 A;  1U60 A;  1KX4 B;  3MKF A;  2ZM5 A;  4P6B A;  4Z2M G;  1ZTU A;  4WYY A;  4H9O B;  1D7E A;  3LEL B;  5AV5 A;  1UWN X;  3R7W A;  4ZBJ C;  4ME4 A;  1P3P B;  1PI4 A;  4H9Q B;  5HDD A;  1K57 A;  1HTA A;  3MGR B;  2EX9 A;  1FCM A;  4HME A;  3EQU A;  3X1U A;  4H9S C;  3LEZ A;  3AZM A;  2XSS A;  4IJG A;  1E3U D;  3V9R B;  4J8W B;  1OTE A;  4KZ4 A;  1P3F B;  5GXQ C;  3C1C A;  2WAD A;  2WKH A;  4OPY A;  3VE3 A;  1TS0 A;  4JXV A;  1I5Q A;  4YS3 D;  2VX8 A;  2OLV A;  2C6W B;  3O3V A;  3A3E A;  4R70 A;  1NRF A;  2PYO A;  2Z6D A;  3O5Y A;  3A6N B;  2R9X A;  4Z66 B;  3O87 A;  4OOY A;  4HH3 A;  4KUO A;  4Y0U A;  3WKJ A;  3HLD A;  1Y4O A;  3HVF A;  1PWC A;  3NCK A;  3REJ D;  2R78 A;  2CV5 C;  1ZG6 A;  4OQG A;  2FJ7 A;  1AIW A;  3GRJ A;  3AZH C;  4JJN C;  1ID3 D;  2HDR A;  2HJ9 C;  3REL C;  3WS5 A;  3FV7 A;  3MGP C;  4BL2 A;  5E5A D;  2EWW A;  1TAF A;  5G4Z A;  5AV8 A;  2G5I C;  3LIB A;  1T3U A;  3A3I A;  2VLG A;  5CTM A;  1HQ3 D;  3KWQ A;  3N3F A;  3TOI A;  4EQ1 A;  2QPN A;  1HLU P;  1K6R A;  2J8P A;  5CPI C;  1G6O A;  4JKT A;  5HWT A;  3FKW A;  3A0S A;  3MS6 A;  3UTB B;  3MXQ A;  4WUJ A;  4DE2 A;  3X1T A;  5GLA A;  5CPJ D;  2XFT A;  4GDB A;  3LIE A;  1E4D A;  2V20 A;  3WD2 A;  3HLW A;  3K3D A;  1NY0 A;  4ZUX D;  4O01 A;  4R8P A;  3KSG A;  1F66 A;  1YU4 A;  1OTI A;  5DTT A;  3BFD A;  3X1S B;  4HBT A;  2ZMF A;  5B1M C;  3PBN A;  4XT2 A;  1KDW A;  3VE4 A;  4ZBE A;  1OPX A;  5FI2 A;  3W97 A;  4I38 A;  3B3X A;  3VH5 W;  1YUE A;  3AZE D;  3V3S A;  1KU5 A;  1K54 A;  3TJZ C;  3AZJ A;  3TRC A;  5DNM D;  4J8X A;  2PT7 A;  2K7S A;  2F8N H;  2IOU A;  1WE4 A;  5B40 B;  3NQU B;  5GLB A;  1J3W A;  3UN7 A;  5IT5 A;  1TD5 A;  1N9B A;  4IBI A;  5CER A;  4ZAM A;  1KX3 C;  1SCW A;  5FAQ A;  3GVB A;  4HJ4 A;  1P3G B;  3AZL C;  5LBR A;  5B0Z C;  2ZY2 A;  4NG2 A;  1PDC A;  2FZ0 A;  2XD5 A;  3WX7 A;  3AN2 A;  2O9A A;  3L9K A;  4X1M A;  2B95 A;  3O62 C;  3R45 B;  1XXM A;  1ZLA A;  1T1B A;  1M18 B;  1Y28 A;  3QP2 A;  5B24 C;  2ZL1 A;  4PM9 A;  1TZY A;  1P97 A;  3BFE A;  5AY8 B;  5HDC A;  2EXA A;  3NOT C;  3ISG A;  5GT0 B;  3ZG8 B;  3LIF A;  4OVD A;  4LD9 A;  3W98 D;  5B2I D;  3REH D;  4KUK A;  4KQO A;  3ZDJ A;  4LV0 A;  3QP6 A;  3MNN D;  1P3M C;  4I39 A;  1S66 L;  2IWB A;  1DRM A;  4BJP A;  1XPB A;  4L9F A;  3JVU A;  2HDS A;  3UB9 A;  1BLP A;  1W8Q A;  5GHZ A;  4X23 A;  4E3O A;  5TBM B;  4KZB A;  5AQB A;  3T1X A;  3S7O A;  3KXB D;  5KIZ A;  1W7F A;  3EPJ A;  3KS4 A;  5G49 A;  2XK1 A;  1U35 B;  1MWT A;  5A90 A;  2HF6 A;  2VGL S;  5GSU D;  5B31 A;  3H82 B;  3LY3 A;  4Y2F A;  1H0G A;  4MN6 A;  2NZD A;  1WYB A;  1H3O B;  1P3L D;  4DF6 A;  3LZ0 C;  4X25 A;  3WD4 A;  1QME A;  1AWI A;  3AZI A;  4EU0 A;  3UDF A;  5BNV A;  4DKI A;  1YKD A;  4YS3 C;  5AJG A;  5CPK C;  1KVL A;  4R4S A;  2XRN A;  3Q82 A;  3LR3 A;  3VH5 T;  1P3A A;  4QLC A;  4O7D A;  1IFQ A;  3FZC A;  1ZC2 A;  4Q0I A;  1YU0 A;  3HL9 A;  1FCN A;  4KQQ A;  3TU4 B;  2V5O A;  2YFW B;  4XZQ C;  3M6B A;  1KX4 A;  1XJ4 A;  5I5L A;  3EEH A;  3S7N A;  2V2F F;  3W99 D;  4H9O A;  2QJ5 A;  3ZCZ A;  3LEL A;  1ERM A;  3WRZ A;  1P3P A;  4H9Q A;  2PRF A;  2EFU A;  4E45 A;  2ZJ9 A;  3Q07 A;  3MGR A;  1M40 A;  4LFU A;  4WZ4 A;  5FQM A;  2WAE A;  3AGD A;  4GW9 A;  1SZV A;  3HUO A;  5DF8 A;  3V9R A;  1JVJ A;  4J8W A;  5TJJ A;  1P3F A;  4Z5T D;  2DCF A;  3ZFZ A;  4HY8 A;  5HAP A;  2EWV A;  3ZQ5 A;  3MGS C;  3WRT A;  3K3C A;  3C5A A;  2OWJ A;  4WBG A;  1BYW A;  4MBF A;  4ZUX C;  3IF6 C;  4J8V D;  3L29 A;  1SDN A;  5EEC A;  5FL3 A;  3A6N A;  4O0P A;  4Z66 A;  3LCE A;  4HHD A;  4DMZ A;  3IHA A;  4J8U C;  3MGQ B;  2XRO A;  1AOI C;  4KUD D;  3K2N A;  1LLB A;  4DE1 A;  3AGF A;  3C1B D;  3AZG D;  1G68 A;  2E8I A;  3HSH A;  5TGF A;  4NE3 A;  1YMX A;  5A92 A;  4KZ6 A;  4GHI B;  5C3I C;  1ID3 B;  1FIL A;  3IWO A;  1PYY A;  5CP6 B;  3AFA B;  5FEF A;  2RVQ C;  3OBF A;  4I3A A;  1MKI A;  1HQ3 B;  3H9W A;  3UTB A;  1YLZ A;  4EES A;  3C38 A;  3WAA C;  1VET B;  1K56 A;  4Z2I A;  4M3K A;  1P34 C;  3IX3 A;  1C3B A;  4IBF A;  5EM0 A;  5CPJ B;  2ARO D;  3FDD A;  3UTA D;  1FR6 A;  1Q2P A;  3X1S A;  1LSV A;  4NYU A;  3AYW D;  3IP4 C;  1WWI A;  3LGO A;  4LEN A;  3S7Q A;  5HWW A;  5AVC D;  4EXO A;  1EW0 A;  5JRG D;  5B2I C;  3NBL A;  2V1B A;  4L0L A;  1EQZ D;  4KZA A;  5B2J D;  2ZY5 A;  2L4R A;  1KDS A;  3AZE B;  1ONH A;  5EM1 A;  5EVL A;  1VQQ A;  4IVI A;  5B40 A;  3NJA A;  3NQU A;  2IO5 C;  1SKO B;  5DNM B;  2Y91 A;  2M7V A;  3WS4 A;  1KE3 A;  1OTA A;  2PR6 A;  4G3V A;  4NXB A;  1V9Y A;  5BNX B;  3LO7 A;  1XP4 A;  2HGV A;  4YM6 D;  2PYO C;  4X68 A;  1P3G A;  4HEF A;  1NYM A;  3S22 A;  4HJ6 A;  4OJ6 A;  1IKG A;  1RP5 A;  1BUE A;  3P98 A;  3UMD A;  1L2S A;  3KYQ A;  3R45 A;  3O86 A;  1M18 A;  2VV8 A;  1K0K A;  4Q0J A;  2ZC5 B;  4KZ7 A;  3NQJ B;  3L27 A;  2XEP A;  3IBR A;  4PPR A;  5AY8 A;  4WMC D;  2ZM0 A;  1K4E A;  2XLN A;  4JGQ A;  5DKK A;  5GT0 A;  2V8C A;  2ZC7 A;  5IS1 A;  2FFF B;  3ICY A;  1CJF A;  3W98 B;  3REH B;  4E6X A;  4WZ5 C;  5F1G A;  3M2K A;  3MNN B;  3DW0 A;  3IH8 A;  2FFY A;  4XUJ C;  2Y2L A;  5AV6 D;  1YU2 A;  4GOG A;  1KX5 C;  1YT4 A;  2W3G A;  3C8C A;  1JNU A;  4JF4 A;  5TBM A;  4FOF A;  2ZM2 A;  2F8N K;  1H8P A;  2B5R A;  4N9L A;  1F66 C;  1ES5 A;  2ZQ8 A;  3BW6 A;  2WYX A;  2OWH A;  1U35 A;  1P3B D;  5CX7 A;  2W8S A;  3EGX C;  3KXB B;  3A3F A;  3H82 A;  5GLC A;  4E3M A;  1STZ A;  4D2O A;  4UUZ B;  3KX0 X;  5GSU B;  3HLC A;  3ZVW A;  5J8X A;  4OLD A;  4KG2 A;  1H3O A;  1ACF A;  1OME A;  5GXQ D;  2GJ3 A;  3QP4 A;  1K54 C;  3T50 A;  3G4P A;  2I72 A;  3LJA B;  1W79 A;  2QYB A;  1P3L B;  2Y2P A;  3VP0 A;  4WU9 C;  5HPI A;  4Y5F A;  3BY9 A;  1D1J A;  3OZH A;  2BLS A;  5M18 A;  4J8V C;  4WF0 A;  3W4P A;  1W1Y A;  2BAS A;  1TS8 A;  4ZJ3 A;  3W8K A;  4S2M A;  5A91 A;  3AZK B;  3BQA A;  2UV0 E;  2JKR M;  3UPP A;  3BJN A;  3TU4 A;  1OT9 A;  3P5J B;  2LB9 A;  2W3F A;  1W1T A;  4JGR A;  2CV5 D;  4EUZ A;  5DJT A;  5HL1 A;  1K25 A;  4BBU A;  3M6H A;  4JJN D;  2J9P A;  2P9V B;  2OV5 A;  3REL D;  3W99 B;  3UE1 A;  3BQ8 A;  1MWU A;  2OOL A;  3IF5 A;  2XA7 M;  1G28 A;  5FQI A;  3JVV A;  2XDM A;  4OP5 A;  3CPT B;  4Z1W A;  4MEZ A;  1LHY A;  3RTY A;  5CPI D;  3X1V C;  3TG9 A;  1IYO A;  3BLM A;  3AV1 B;  1E3U A;  4UHU A;  3VP1 A;  4WEL A;  4Q8I A;  3EEA A;  1CEF A;  4FSF A;  4A5R A;  3WD3 A;  3VFF A;  3WS0 A;  3H0M C;  4HNB A;  4HBU A;  4KQD A;  2XFS A;  5B1M D;  1P3K D;  1JFI B;  3REI B;  3E2L A;  5HAI A;  3MGQ A;  3FG8 A;  3KUY D;  3ZG7 B;  1WWS A;  2W3D A;  5JRG C;  3P09 A;  2NZD C;  4MN5 A;  5HW3 A;  3C1B B;  2WKE A;  3AZG B;  2VV7 A;  2ZQ7 A;  3L2A A;  2WGW B;  5AQA A;  3SS4 A;  4GHI A;  4EEP A;  2ZY4 A;  4ZJ1 A;  1ID3 A;  5A93 A;  2NQB C;  2BTF P;  5CP6 A;  3AFA A;  3MVD B;  2J3W A;  1L3L A;  3G35 A;  1ZHH B;  3UY6 A;  4IBR A;  1HQ3 A;  4E3N A;  1KX3 D;  3N8R A;  3AZL D;  1VET A;  5B0Z D;  4EV4 A;  5AV9 C;  1FOF A;  3WD0 A;  3O62 D;  5CPJ A;  5AVB C;  5F99 C;  1ODV A;  1XFQ A;  5B24 D;  2ARO B;  3UTA B;  1G6A A;  4BWI A;  5FQJ A;  2A24 B;  3WTP B;  4OPQ A;  1DP9 A;  1IYQ A;  3AYW B;  4II7 A;  3W96 B;  3KFU G;  5AVC B;  1P3M D;  2P04 A;  4QHC A;  4P87 A;  3UT9 C;  4WN5 A;  3AZE A;  1EQZ B;  2H0T A;  3A1I A;  5B2J B;  3T1R A;  1SKO A;  5DNM A;  1MBL A;  4JLF A;  1NXY A;  2V1Z A;  2JKR I;  3AZN B;  1J7M A;  4GHL A;  5BNX A;  5M19 A;  1P3B C;  1ED7 A;  1GA9 A;  2XGN A;  1JWV A;  1MPL A;  3MXR A;  4R3A A;  4ZJ2 A;  1TF1 A;  2W3E A;  4YM6 B;  4EBL A;  3IXD A;  1BUL A;  2Y59 A;  3CAX A;  4U3T A;  4HMD A;  1T1C A;  3GQZ A;  3NQJ A;  1S32 C;  4IVK A;  4UA7 A;  3LZ0 D;  1DJC A;  1P3O B;  3NOP C;  5MC7 A;  1O7E A;  1M1A C;  1WYC A;  4GD8 A;  4MN7 A;  5EOE A;  4C6Y A;  4Z2M H;  3DAV A;  4MBK A;  1FSW A;  5CPK D;  4ARZ B;  4E3K A;  4P6Z M;  3B6F B;  4LRY C;  3HLB A;  3LIC A;  3W98 A;  3REH A;  1P3I C;  1L0D A;  1QMF A;  4OQI A;  4DRA A;  1BT5 A;  2QHK A;  5BS7 C;  5CHJ A;  3RXW A;  3SH9 A;  4HMC A;  3MNN A;  1B6W A;  3MZD A;  5GL9 A;  3NC8 A;  2KDK A;  4KEN B;  4S2N A;  1YPR A;  4XZQ D;  3AGE A;  5F83 A;  2WUQ A;  1CI8 A;  5AV6 B;  2Y2H A;  4I5S A;  1P9W A;  2Y2O A;  5EVI C;  4WZS B;  4WEJ A;  3KXB A;  2YKH A;  5F82 A;  3R4K A;  4RYE A;  2Y79 A;  4UUZ A;  4ZBJ B;  3EPK A;  1K6S A;  3KO6 A;  3F6T A;  2ZOH A;  4UQI S;  3G6O A;  5GSU A;  3AL0 C;  4E3L A;  4KG5 A;  1A0K A;  2Y2M A;  4PKY G;  2H5S A;  1T19 A;  3WA9 D;  4GNU A;  2JHE A;  2EFX A;  2HV1 A;  3LJA A;  3MGS D;  1P3L A;  1TVF A;  5GXQ B;  3KYE A;  1Z09 A;  4HGA C;  3QNC A;  3RFB A;  3BYD A;  1K4F A;  2JC7 A;  4KZ5 A;  4R1G A;  3DWK A;  1P3K C;  4GLQ A;  4J8U D;  3AZF C;  2LY8 A;  3AZK A;  4PMA A;  3WWX A;  1AOI D;  3UE3 A;  1BLC A;  2ZQ9 A;  3KUY C;  1GHM A;  3V3R A;  2IA2 A;  5B1L C;  3MFD A;  3WS1 A;  3HJK A;  5E2E A;  4JGP A;  4HQA A;  3IQA A;  4K0X A;  3ZNY A;  5B32 C;  1K55 C;  2P9V A;  3CUE C;  2CV5 B;  3LR0 A;  1DP8 A;  5BT1 C;  3W99 A;  3AZH B;  4JJN B;  4S2O A;  2ZMA A;  3REL B;  3IHB A;  3MGP B;  4WU8 C;  4ZDX A;  4QNL A;  2RVQ D;  4Z2L A;  2YKF A;  4OJP A;  2K2N A;  2D02 A;  4MDZ A;  3KSY A;  1MWS A;  3AV1 A;  3WAA D;  5CPI B;  3HJI A;  4Y0O A;  1P34 D;  1BLH A;  2H10 A;  2HPB A;  5DFX A;  4C75 A;  4QU3 A;  4KG6 A;  5M1A A;  4FH2 A;  3VH6 W;  2GZA A;  2I9V A;  1JFI A;  2Y2Q A;  3REI A;  4IUH A;  1N1J B;  5EUA A;  1U35 C;  5B1M B;  1PNE A;  4YIN A;  2VK3 A;  4X6T A;  4GZB A;  5HWV A;  1M19 C;  4CAY B;  4UEY A;  1I2W A;  5B33 C;  1P9R A;  4DDS A;  3AZM D;  5AVE A;  3C1B A;  1O6I A;  3AZG A;  1BFM A;  4IED A;  1JTD A;  2OLU A;  2WGW A;  4WEK A;  4Y0T A;  5J3W A;  2EX8 A;  4R3J A;  3VOZ A;  5BO0 B;  4KGC C;  1YMS A;  2DQN C;  3MVD A;  1E15 A;  4HOI A;  4LV1 A;  4ZRR A;  1MY8 A;  2WGI A;  3OPL A;  4R38 A;  3ZG5 A;  2L1M A;  3BFF A;  5JA4 B;  3LZ1 B;  2PYO D;  4S2J A;  1CK7 A;  2WKQ A;  2Y2I A;  1KX3 B;  4OP8 A;  5E2H A;  3G34 A;  3G2Y A;  3AZL B;  4UPK A;  5B0Z B;  3UB6 A;  3S1Y A;  4CLC C;  3LFV A;  2WAF A;  5HX9 A;  4OQ0 A;  3NI9 A;  1FSY A;  3O62 B;  2ARO A;  3UTA A;  3AV2 C;  5BPV A;  3P7N A;  2B18 A;  2Y55 A;  5B24 B;  3BY8 A;  4IBK A;  3P01 A;  2A24 A;  1I2S A;  3WTP A;  4U0T A;  5DVA A;  1YLT A;  2ZLY A;  5AV8 D;  3AYW A;  3W96 A;  1YLP A;  4X55 A;  5AVC A;  2EXB A;  5FDH A;  5GT3 C;  1GSV A;  2Y2G A;  3M7P A;  4DRB A;  4AFI A;  2JCH A;  4G92 B;  1AXB A;  3NIA A;  3LID A;  1CI9 A;  5E43 A;  1XA1 A;  5B2J A;  4C3Q A;  3HLE A;  3IT9 A;  3X1T D;  3G30 A;  1VM1 A;  4XUJ D;  4CPK A;  2RL3 A;  1KX5 D;  3BFG A;  2J3T C;  3AZN A;  5G18 A;  2ZOI A;  2W1R A;  4Z2H A;  2WZX A;  1F66 D;  4LV3 A;  4BBT A;  3CI6 A;  4R3B A;  3E4O A;  3QP8 A;  3PXP A;  3UE0 A;  4G91 C;  1XJ2 A;  2X71 A;  1NJ4 A;  4YM6 A;  3ZNT A;  4H9R B;  3B0D C;  4MB3 A;  3GDI A;  5F68 A;  4QPR A;  3VH6 T;  3FKE A;  3B0B A;  3B6G C;  2PU4 A;  1KVM A;  3WA9 C;  2Z6C A;  1P3O A;  3E4P A;  4WMC A;  3CLO A;  3I7J A;  3F1P B;  4JXW A;  4WU9 D;  3LZ0 B;  4CJN A;  2O99 A;  4ARZ A;  4DDY A;  4JF6 A;  5AVF A;  3B6F A;  5B0Y C;  2Q9N A;  4IBD A;  2HIO C;  4E3J A;  4E04 A;  4YS3 B;  5CPK B;  5KSC A;  3RJU A;  1TS6 A;  1HTZ A;  3BWL A;  5DNN C;  5FQQ A;  5AV6 A;  3IX4 A;  4MLL A;  4XZQ B;  3LI9 A;  5KZH A;  1PRQ A;  3REJ B;  2ZMV A;  3SW1 A;  4EQI A;  4LLO B;  1CQA A;  3REK C;  2ZQD A;  2YFV B;  4NXF A;  1S67 L;  5E5A B;  1OGG A;  3WTP E;  3NOU C;  3S4X A; 
#chains in the Genus database with same CATH homology
 1PWG A;  1YU3 A;  3X1V D;  4LCM A;  1H5X A;  5U47 A;  3HRE A;  4S2K A;  5GXQ A;  1CK3 A;  1ES4 A;  1YLW A;  4H9N B;  4OH0 A;  3MGS B;  1NYY A;  3BEB A;  1Q9C A;  4ZUX B;  4IJE A;  3L26 A;  3IF6 B;  4R23 A;  1NZO A;  1HZO A;  5AV5 C;  1ONG A;  1IEL A;  1YM1 A;  1K57 C;  4J8U B;  3N8L A;  3EPH A;  1AOI B;  2XH9 A;  3A3D A;  1A7W A;  2NZD D;  3X1U C;  3AZM C;  2QZ6 A;  4U0X A;  2CV5 A;  3VSL A;  1Z2C B;  1YLJ A;  3UDX A;  3AZH A;  1L0E A;  4JJN A;  3C1C C;  2NQB D;  3MGP A;  4N92 A;  5EOO A;  3PAE A;  5C3I B;  4OOL A;  1PZR A;  4IBC A;  1Z6F A;  1IEM A;  5EPH A;  1BH9 B;  5AV9 D;  5CPI A;  4OJ5 A;  3PBS A;  5AVB D;  5F99 D;  3WKJ C;  1KX4 D;  1P34 B;  5CEB A;  1CEG A;  2GDN A;  3N8S A;  1J9M A;  2Y2J A;  1N1J A;  2FJ7 C;  4EO5 C;  4OQH A;  4AWL C;  1PZO A;  5B1M A;  1XA7 A;  2IWC A;  1P3P D;  4CAY A;  2HP5 A;  1FR1 A;  3RXX A;  5AV8 C;  3IWQ A;  4P0M A;  3KWQ C;  4FD8 A;  3ZGA B;  4E3I A;  3VP3 A;  5B2I B;  3UT9 D;  5CHM A;  4CSR B;  5BO0 A;  3C7V A;  5DTS A;  3X1T C;  3VSK A;  2ZC3 B;  2IO5 B;  3FWL A;  4R8P C;  5CTN A;  2IWD A;  5JA4 A;  3LZ1 A;  4KZ9 A;  4R0Q A;  3V50 A;  4LV2 A;  1KX3 A;  1JWZ A;  3A1K A;  3AZK C;  3VFH A;  3MZF A;  5KSH A;  3MZE A;  3AZL A;  4OOM A;  5B0Z A;  4BLM A;  3W97 C;  4NZ5 A;  3O62 A;  1S32 D;  5TR7 A;  5B24 A;  3AZJ C;  1M1A D;  4J8X C;  1K38 A;  3FYZ A;  5CGX A;  3BFC A;  1LI9 A;  4NK3 A;  4JXG A;  4KZ3 A;  4PM6 A;  1P3I D;  1XKZ A;  3Q81 A;  2HP6 A;  2R9W A;  2YFW A;  3MXS A;  3AN2 C;  4XUJ B;  1KX5 B;  1ZLA C;  3HUM A;  5EVI D;  4XXR A;  4GH9 A;  4IBE A;  3REI C;  1KE4 A;  1TZY C;  2DF4 C;  2A49 A;  3D4F A;  4H9R A;  4LD9 C;  5AQ9 A;  1IKI A;  1FQG A;  1MXO A;  4B4Z A;  1DJA A;  5CGW A;  2UWX A;  1W8Y A;  3GMW A;  5GLD A;  1ES3 A;  3G31 A;  4LG2 A;  4Z5T B;  3LZ0 A;  5TFQ A;  4QJG A;  3MVD C;  4X23 C;  4WU9 B;  4YS3 A;  5CPK A;  5GHX A;  2Z2L B;  1PWD A;  4EWF A;  3AZF D;  4DXB A;  4J8V B;  3Q7Z A;  4Z9Q A;  5B31 C;  3QHY A;  5B31 G;  5B1L D;  2WGV A;  3VH5 A;  4IBB A;  1M18 D;  4KUD B;  5B32 D;  2F8N D;  3REJ A;  5BT1 D;  3VOY A;  5GT0 D;  2YFV A;  3BLS A;  3AZI C;  2DNS A;  5E5A A;  3WTP C;  4WU8 D;  1M6K A;  2PBY A;  3W96 C;  4OPZ A;  2Y2N A;  1P3A C;  4QLC C;  2H0Y A;  1W2E A;  5E2F A;  5JYP A;  3X1V B;  3W4O A;  4K0W A;  4RX3 A;  4H9N A;  3MGS A;  4RX2 A;  4IBJ A;  3VH6 A;  3PAG A;  1KX4 C;  4IBG A;  4ZUX A;  3IF6 A;  3SOI A;  3BRM A;  3VMA A;  1U35 D;  3LEL C;  1LL5 A;  4NYY A;  2ZM8 A;  4KQR A;  1P3P C;  1M19 D;  2HUE B;  4FCF A;  5B33 D;  4J8U A;  5L2F A;  5CHU A;  3MGR C;  3N4I A;  4OJO A;  1AOI A;  1KGF A;  3ITA A;  4FH4 A;  4K91 A;  5JRG B;  4P85 A;  1E25 A;  4J8W C;  1P3F C;  3A3J A;  2X02 A;  3EQV A;  3GSG A;  5IHV A;  4KGC D;  3N7W A;  4WNN B;  5FAO A;  1ALQ A;  2NQB B;  1ESI A;  3B6F C;  1XGI A;  3A6N C;  1BH9 A;  4Z66 C;  4X56 A;  2HDQ A;  2OSU A;  4GHA A;  3OPP A;  1KE0 A;  5AV9 B;  4IBX A;  4S2L A;  1P34 A;  4Y7P A;  3M2J A;  1BTL A;  5AVB B;  5F99 B;  3AV2 D;  1KGE A;  3DTM A;  5FSR A;  4GKU A;  3PBR A;  2PU2 A;  2ZD8 A;  4N1X A;  5GT3 D;  5B2I A;  4CSR A;  1H8Y A;  3UTB C;  3UT9 B;  3NY4 A;  3V5M A;  5CXW A;  3X1S C;  1BSG A;  3HON A;  3CMZ A;  4UA6 A;  4BEN A;  3MGQ D;  1P3B B;  4B88 A;  1O07 A;  1Y54 A;  3B6G D;  3OC2 A;  4H9P B;  3HUN A;  5CED A;  1S32 B;  3W4Q A;  4BD0 A;  3MBZ A;  3MKE A;  5B40 C;  5CP6 D;  1R4V A;  2XF3 A;  3AFA D;  1M1A B;  3ITB A;  5B0Y D;  4EBN A;  2HIO D;  5CHL B;  2L5A A;  4X69 A;  4OLG A;  1P3I B;  2G2W A;  3SH7 A;  5DNN D;  4WZ5 A;  1P3G C;  2EX6 A;  2CC1 A;  3QNB A;  3EG5 B;  1KGG A;  2G2U A;  1YQS A;  4XUJ A;  2WZZ A;  1KX5 A;  1M18 C;  3UPO A;  3IXH A;  5B32 G;  2F8N G;  3G2Z A;  5AY8 C;  5EVI B;  3B0C W;  3REK D;  4DE0 A;  5GT0 C;  5FI6 A;  5FQK A;  3C7U A;  3PTE A;  4OKP A;  4UA9 A;  1GCE A;  2VQR A;  2ZQA A;  2J8Y A;  3GR2 A;  4Z5T A;  4X53 A;  4XUZ A;  4DQY B;  1SKF A;  4WU9 A;  1ZKJ A;  4HGA B;  1GHI A;  3LZ1 C;  4R4R A;  4J8V A;  3BM6 A;  5FI7 A;  5AV5 D;  1P3K B;  3AZF B;  2VGK A;  5CRF A;  3O88 A;  2J9O A;  3KUY B;  3X1U D;  5HFO A;  2CWE A;  4KUD A;  5B1L B;  4N1H A;  1FCO A;  4NE5 A;  5B32 B;  3C1C D;  2F8N B;  2ZC6 B;  4E6W A;  3ZG9 B;  4DE3 A;  3C4O A;  4S2P A;  1LL9 A;  2ZC4 B;  3HLG A;  4F94 A;  1XX2 A;  4WU8 B;  1SDE A;  4G92 C;  3X1V A;  1ERQ A;  5BOH A;  2JE5 A;  5DF9 A;  3WKJ D;  3TU4 C;  3ZVT A;  5FAS A;  4IJF A;  2DRW A;  4QD4 A;  4KHA B;  2X01 A;  3V39 A;  5EE8 A;  3PBQ A;  2FJ7 D;  4ID4 A;  4LCL A;  2XD1 A;  4BQM A;  2A3U A;  2XR0 A;  1TDL A;  1M19 B;  3KWQ D;  1YU1 A;  5B33 B;  3HBR A;  5JRG A;  5HAQ A;  1EQZ A;  1P3M B;  3SH8 A;  3B0C T;  3LJA D;  4XUX A;  4WNN A;  2NQB A;  4KGC B;  4NE6 A;  4R8P D;  1B67 A;  3VP4 A;  5FUG B;  1YLY A;  3AZK D;  3MGQ C;  3LY4 A;  1RGY A;  5AV9 A;  4MNR A;  3W97 D;  4DRT A;  5F99 A;  5AVB A;  4E44 A;  1NZU A;  1ZG4 A;  3REJ C;  3AZJ D;  4J8X D;  3UNW A;  3AV2 B;  4JF5 A;  1ID3 C;  3OCL A;  5CP6 C;  1S6R A;  5E5A C;  3AFA C;  4B4X A;  2QMI A;  2Z2M B;  2HDU A;  5GT3 B;  1HQ3 C;  3AV1 D;  5I94 A;  3UT9 A;  1GA0 A;  2Y4A A;  2C5W B;  4BL3 A;  3AN2 D;  5CPJ C;  1ZLA D;  1EWZ A;  2BG1 A;  3REI D;  1TZY D;  1ES2 A;  4KZ8 A;  5KDM B;  3SS3 A;  4G91 B;  1P3B A;  3Q7V B;  4LD9 D;  1IYS A;  3B0D B;  4H9S A;  4H9P A;  1BH8 B;  1PI5 A;  1S32 A;  1PW1 A;  3B6G B;  4MBH A;  3AZE C;  3WA9 B;  4OUI A;  1M1A A;  3MVD D;  5DNM C;  2BYM B;  3CJM A;  2BYK B;  4X23 D;  5JYO A;  5B0Y B;  1P3I A;  2HIO B;  4GN2 A;  5BS7 A;  3VP2 A;  4JPM A;  5B31 D;  1ULY A;  5DNN B;  4EBP A;  2WKI A;  1Q2Q A;  5CEC A;  2Q9M A;  5EVI A;  4H8R A;  1RGZ A;  3REL A;  3AZI D;  3GV9 A;  2EX2 A;  3WTP D;  4NFT A;  3W96 D;  3REK B;  3PBT A;  1P3A D;  4QLC D;  5DF7 A;  3W98 C;  3REH C;  3EPL A;  1W5D A;  3MNN C;  3TSG A;  3IXG A;  3WAA B;  4S2N C;  1EI5 A;  3AZN D;  4NZ1 A;  3CG5 A;  3IXB A;  2F2A C;  3ZHH A;  4DXC A;  3LEL D;  1P3K A;  3IH9 A;  3KXB C;  3AZF A;  3MGR D;  5AV5 B;  3KUY A;  2JBF A;  3KS8 A;  5GSU C;  1TEM A;  4RVA A;  5B1L A;  3CZD A;  4OON A;  4J8W D;  3X1U B;  4QY6 A;  1P3F D;  3IWI A;  5B32 A;  3AZM B;  1P3O D;  2F8N A;  1K55 A;  5FAT A;  3E2K A;  1MWR A;  3LJA C;  1JTG A;  1N4O A;  1P3L C;  3C1C B;  4BD1 A;  4NET A;  5FA7 A;  3B6F D;  3PBO A;  4WU8 A;  4PM7 A;  3A6N D;  4Z66 D;  2PYO B;  3UO9 A;  1RCJ A;  4NY2 A;  1DY6 A;  3OCN A;  4QB8 A;  2J7V A;  4KHA A;  3WKJ B;  4YFM A;  3N6I A;  3H0R C;  1ERO A;  2FJ7 B;  3W99 C;  4EO5 B;  4WM9 A;  4UAA A;  4WV4 B;  4AWL B;  2RIQ A;  4QY5 A;  1IYP A;  1M19 A;  5B33 A;  1TAF B;  4NZ4 A;  5AV8 B;  4S2I A;  4HES A;  4GD6 A;  3KWQ B;  4GB7 A;  1P3M A;  2Y2K A;  3UTB D;  3G32 A;  3AV1 C;  1K56 D;  4RA7 A;  2G5H C;  4Z5T C;  1TDG A;  3BEC A;  4KGC A;  3X1T B;  3SS5 A;  5FQ9 A;  3X1S D;  1L0F A;  1PW8 A;  5FUG A;  2RCX A;  4R8P B;  1F66 B;  3L25 A;  2ZQC A;  2WK0 A;  1DJB A;  1ESU A;  4WJ3 C;  1LI0 A;  1S0W A;  5GHY A;  1XGJ A;  1GHP A;  4KUD C;  4M6B A;  3H0L C;  3C1B C;  3W97 B;  1PIO A;  3Q1F A;  3AZG C;  1PZP A;  3GTC A;  3AV2 A;  3AZH D;  5B40 D;  3MGP D;  3AZJ B;  4J8X B;  5D3O A;  5AQ7 A;  5GT3 A;  1P3G D;  3WS2 A;  5DTK A;  4XZQ A;  3AN2 B;  4GDN A;  4JBF A;  1HVB A;  5KMW A;  2ARO C;  1ZLA B;  3UTA C;  5AY8 D;  4PM5 A;  5KDM A;  3Q7V A;  1BZA A;  1TZY B;  2HUE C;  2JSS A;  3AYW C;  5F1F A;  3FKV A;  5E2G A;  3ZG0 A;  3JYI A;  4LD9 B;  5AVC C;  1BH8 A;  3L28 A;  3B6G A;  1EQZ C;  2P74 A;  3WA9 A;  5B2J C;  2BYM A;  3NDE A;  1F1E A;  2BYK A;  1L0G A;  3AZN C;  1BLS A;  4N9K A;  5B0Y A;  5CGS A;  3HLF A;  3LZ1 D;  2HIO A;  4X23 B;  3C4P A;  1HD8 A;  5HAR A;  5G49 B;  4YM6 C;  5DNN A;  2VGJ A;  5B31 B;  2ZY3 A;  5FAP A;  2NZD B;  4JXS A;  1P3O C;  3UDI A;  4OPR A;  3REK A;  4OJL A;  3AZI B;  4ZTK A;  1SHV A;  3DWZ A;  1JWP A;  5BNV B;  2HP9 A;  3NDG A;  3UPN A;  2XQZ A;  1P3A B;  4QLC B;  3OPH A;  4PM8 A;  3WAA A;  3TU4 D;  3OPR A;  1H8Z A;  5AV6 C;  4NZ3 A;  1U60 A;  1KX4 B;  3MKF A;  2ZM5 A;  4P6B A;  4Z2M G;  4WYY A;  4H9O B;  3LEL B;  5AV5 A;  4ZBJ C;  1P3P B;  1PI4 A;  4H9Q B;  1K57 A;  1HTA A;  3MGR B;  2EX9 A;  1FCM A;  3EQU A;  3X1U A;  4H9S C;  3LEZ A;  3AZM A;  1E3U D;  3V9R B;  4J8W B;  4KZ4 A;  1P3F B;  5GXQ C;  3C1C A;  2WAD A;  2WKH A;  4OPY A;  4JXV A;  1I5Q A;  4YS3 D;  2OLV A;  2C6W B;  3O3V A;  3A3E A;  1NRF A;  2PYO A;  3A6N B;  2R9X A;  4Z66 B;  3O87 A;  4OOY A;  4Y0U A;  3WKJ A;  3HLD A;  3HVF A;  1PWC A;  3NCK A;  3REJ D;  2CV5 C;  1ZG6 A;  4OQG A;  2FJ7 A;  3GRJ A;  3AZH C;  4JJN C;  1ID3 D;  2HDR A;  3REL C;  3WS5 A;  3FV7 A;  3MGP C;  4BL2 A;  5E5A D;  1TAF A;  5AV8 A;  2G5I C;  1T3U A;  3A3I A;  5CTM A;  1HQ3 D;  3KWQ A;  3N3F A;  3TOI A;  2QPN A;  1K6R A;  2J8P A;  5CPI C;  4JKT A;  3FKW A;  4DE2 A;  3UTB B;  3X1T A;  5GLA A;  5CPJ D;  2XFT A;  4GDB A;  1E4D A;  2V20 A;  3HLW A;  1NY0 A;  4ZUX D;  4R8P A;  1F66 A;  1YU4 A;  5DTT A;  3BFD A;  3X1S B;  4HBT A;  5B1M C;  3PBN A;  1KDW A;  4ZBE A;  5FI2 A;  3W97 A;  3B3X A;  3VH5 W;  1YUE A;  3AZE D;  3V3S A;  1KU5 A;  1K54 A;  3AZJ A;  5DNM D;  4J8X A;  2F8N H;  2IOU A;  1WE4 A;  5B40 B;  3NQU B;  5GLB A;  3UN7 A;  1N9B A;  4IBI A;  5CER A;  4ZAM A;  1KX3 C;  1SCW A;  5FAQ A;  3GVB A;  1P3G B;  3AZL C;  5B0Z C;  2ZY2 A;  2XD5 A;  3WX7 A;  3AN2 A;  3O62 C;  3R45 B;  1XXM A;  1ZLA A;  1M18 B;  5B24 C;  4PM9 A;  1TZY A;  3BFE A;  5AY8 B;  2EXA A;  3ISG A;  5GT0 B;  3ZG8 B;  4OVD A;  4LD9 A;  3W98 D;  5B2I D;  3REH D;  4KQO A;  3ZDJ A;  4LV0 A;  3MNN D;  1P3M C;  2IWB A;  4BJP A;  1XPB A;  2HDS A;  1BLP A;  1W8Q A;  5GHZ A;  4X23 A;  4E3O A;  4KZB A;  5AQB A;  3KXB D;  1W7F A;  3EPJ A;  3KS4 A;  5G49 A;  2XK1 A;  1U35 B;  1MWT A;  5A90 A;  5GSU D;  5B31 A;  3LY3 A;  2NZD A;  1WYB A;  1H3O B;  1P3L D;  4DF6 A;  3LZ0 C;  1QME A;  3AZI A;  3UDF A;  5BNV A;  4DKI A;  4YS3 C;  5CPK C;  1KVL A;  4R4S A;  3Q82 A;  3VH5 T;  1P3A A;  4QLC A;  4O7D A;  3FZC A;  1ZC2 A;  1YU0 A;  3HL9 A;  1FCN A;  4KQQ A;  3TU4 B;  2YFW B;  4XZQ C;  3M6B A;  1KX4 A;  2V2F F;  3W99 D;  4H9O A;  3ZCZ A;  3LEL A;  1ERM A;  3WRZ A;  1P3P A;  4H9Q A;  2EFU A;  4E45 A;  2ZJ9 A;  3Q07 A;  3MGR A;  1M40 A;  4WZ4 A;  5FQM A;  2WAE A;  3AGD A;  3HUO A;  5DF8 A;  3V9R A;  1JVJ A;  4J8W A;  1P3F A;  4Z5T D;  2DCF A;  3ZFZ A;  5HAP A;  3MGS C;  3WRT A;  3C5A A;  4WBG A;  4MBF A;  4ZUX C;  3IF6 C;  4J8V D;  3L29 A;  1SDN A;  5EEC A;  3A6N A;  4Z66 A;  3LCE A;  3IHA A;  4J8U C;  3MGQ B;  1AOI C;  4KUD D;  1LLB A;  4DE1 A;  3AGF A;  3C1B D;  3AZG D;  1G68 A;  2E8I A;  3HSH A;  5TGF A;  4NE3 A;  1YMX A;  5A92 A;  4KZ6 A;  5C3I C;  1ID3 B;  3IWO A;  1PYY A;  5CP6 B;  3AFA B;  2RVQ C;  1MKI A;  1HQ3 B;  3UTB A;  1YLZ A;  3WAA C;  1K56 A;  4M3K A;  1P34 C;  1C3B A;  4IBF A;  5CPJ B;  2ARO D;  3FDD A;  3UTA D;  1FR6 A;  1Q2P A;  3X1S A;  4NYU A;  3AYW D;  3IP4 C;  1WWI A;  4LEN A;  5AVC D;  5JRG D;  5B2I C;  3NBL A;  4L0L A;  1EQZ D;  4KZA A;  5B2J D;  2ZY5 A;  1KDS A;  3AZE B;  1ONH A;  5EVL A;  1VQQ A;  4IVI A;  5B40 A;  3NQU A;  2IO5 C;  5DNM B;  2Y91 A;  3WS4 A;  1KE3 A;  5BNX B;  3LO7 A;  1XP4 A;  4YM6 D;  2PYO C;  4X68 A;  1P3G A;  4HEF A;  1NYM A;  3S22 A;  4OJ6 A;  1IKG A;  1RP5 A;  1BUE A;  3P98 A;  1L2S A;  3R45 A;  3O86 A;  1M18 A;  2ZC5 B;  4KZ7 A;  3NQJ B;  2XEP A;  3L27 A;  4PPR A;  5AY8 A;  4WMC D;  2ZM0 A;  1K4E A;  2XLN A;  5GT0 A;  2ZC7 A;  2FFF B;  3W98 B;  3REH B;  4E6X A;  4WZ5 C;  5F1G A;  3M2K A;  3MNN B;  3DW0 A;  3IH8 A;  2FFY A;  4XUJ C;  2Y2L A;  5AV6 D;  1YU2 A;  4GOG A;  1KX5 C;  1YT4 A;  4JF4 A;  2ZM2 A;  2F8N K;  2B5R A;  4N9L A;  1F66 C;  1ES5 A;  2ZQ8 A;  2WYX A;  1U35 A;  1P3B D;  2W8S A;  3KXB B;  3A3F A;  5GLC A;  4E3M A;  4D2O A;  4UUZ B;  5GSU B;  3HLC A;  3ZVW A;  5J8X A;  4OLD A;  4KG2 A;  1H3O A;  1OME A;  5GXQ D;  1K54 C;  3G4P A;  2I72 A;  3LJA B;  1W79 A;  1P3L B;  2Y2P A;  3VP0 A;  4WU9 C;  3OZH A;  2BLS A;  5M18 A;  4J8V C;  3W4P A;  4ZJ3 A;  3W8K A;  4S2M A;  5A91 A;  3AZK B;  3UPP A;  3TU4 A;  3P5J B;  2CV5 D;  4EUZ A;  5HL1 A;  1K25 A;  3M6H A;  4JJN D;  2J9P A;  2P9V B;  2OV5 A;  3REL D;  3W99 B;  3UE1 A;  1MWU A;  3IF5 A;  5FQI A;  2XDM A;  4OP5 A;  4MEZ A;  1LHY A;  5CPI D;  3X1V C;  3TG9 A;  1IYO A;  3BLM A;  3AV1 B;  1E3U A;  4UHU A;  3VP1 A;  4WEL A;  4Q8I A;  1CEF A;  4FSF A;  4A5R A;  3VFF A;  3WS0 A;  3H0M C;  4HBU A;  2XFS A;  5B1M D;  1P3K D;  1JFI B;  3REI B;  3E2L A;  5HAI A;  3MGQ A;  3KUY D;  3ZG7 B;  1WWS A;  5JRG C;  3P09 A;  2NZD C;  5HW3 A;  3C1B B;  2WKE A;  3AZG B;  2ZQ7 A;  3L2A A;  2WGW B;  5AQA A;  3SS4 A;  2ZY4 A;  4ZJ1 A;  1ID3 A;  5A93 A;  2NQB C;  5CP6 A;  3AFA A;  3MVD B;  3G35 A;  3UY6 A;  4IBR A;  1HQ3 A;  4E3N A;  1KX3 D;  3N8R A;  3AZL D;  5B0Z D;  4EV4 A;  5AV9 C;  1FOF A;  3O62 D;  5CPJ A;  5AVB C;  5F99 C;  5B24 D;  2ARO B;  3UTA B;  1G6A A;  5FQJ A;  3WTP B;  4OPQ A;  1IYQ A;  3AYW B;  3W96 B;  3KFU G;  5AVC B;  1P3M D;  4QHC A;  4P87 A;  3UT9 C;  3AZE A;  1EQZ B;  2H0T A;  3A1I A;  5B2J B;  5DNM A;  1MBL A;  4JLF A;  1NXY A;  2V1Z A;  3AZN B;  4GHL A;  5BNX A;  5M19 A;  1P3B C;  2XGN A;  1GA9 A;  4ZJ2 A;  1JWV A;  1MPL A;  3MXR A;  4YM6 B;  4EBL A;  3IXD A;  1BUL A;  2Y59 A;  4U3T A;  3GQZ A;  3NQJ A;  1S32 C;  4IVK A;  4UA7 A;  3LZ0 D;  1DJC A;  1P3O B;  1O7E A;  1M1A C;  1WYC A;  4GD8 A;  5EOE A;  4C6Y A;  4Z2M H;  4MBK A;  1FSW A;  5CPK D;  4E3K A;  3B6F B;  3HLB A;  3W98 A;  3REH A;  1P3I C;  1L0D A;  1QMF A;  4OQI A;  4DRA A;  1BT5 A;  5BS7 C;  5CHJ A;  3RXW A;  3SH9 A;  3MNN A;  1B6W A;  3MZD A;  5GL9 A;  3NC8 A;  4KEN B;  4S2N A;  4XZQ D;  3AGE A;  5F83 A;  2WUQ A;  1CI8 A;  5AV6 B;  2Y2H A;  2Y2O A;  5EVI C;  4WZS B;  4WEJ A;  3KXB A;  5F82 A;  4RYE A;  4UUZ A;  4ZBJ B;  3EPK A;  1K6S A;  3F6T A;  5GSU A;  3AL0 C;  4E3L A;  4KG5 A;  2Y2M A;  2H5S A;  3WA9 D;  4GNU A;  2EFX A;  3LJA A;  3MGS D;  1P3L A;  1TVF A;  5GXQ B;  4HGA C;  3QNC A;  3BYD A;  1K4F A;  2JC7 A;  4KZ5 A;  4R1G A;  3DWK A;  1P3K C;  4J8U D;  3AZF C;  2LY8 A;  3AZK A;  4PMA A;  3WWX A;  1AOI D;  3UE3 A;  1BLC A;  2ZQ9 A;  3KUY C;  1GHM A;  3V3R A;  5B1L C;  3MFD A;  3WS1 A;  5E2E A;  3IQA A;  4K0X A;  3ZNY A;  5B32 C;  1K55 C;  2P9V A;  2CV5 B;  5BT1 C;  3W99 A;  3AZH B;  4JJN B;  4S2O A;  2ZMA A;  3REL B;  3IHB A;  3MGP B;  4WU8 C;  4ZDX A;  4QNL A;  2RVQ D;  4OJP A;  3KSY A;  1MWS A;  3AV1 A;  3WAA D;  5CPI B;  4Y0O A;  1P34 D;  1BLH A;  2H10 A;  2HPB A;  4C75 A;  4QU3 A;  4KG6 A;  5M1A A;  4FH2 A;  3VH6 W;  1JFI A;  2Y2Q A;  3REI A;  1N1J B;  5EUA A;  1U35 C;  5B1M B;  4YIN A;  4X6T A;  4GZB A;  1M19 C;  4CAY B;  1I2W A;  5B33 C;  4DDS A;  3AZM D;  3C1B A;  3AZG A;  1BFM A;  4IED A;  1JTD A;  2OLU A;  2WGW A;  4WEK A;  4Y0T A;  2EX8 A;  4R3J A;  3VOZ A;  5BO0 B;  4KGC C;  1YMS A;  2DQN C;  3MVD A;  4LV1 A;  1MY8 A;  2WGI A;  3OPL A;  3ZG5 A;  3BFF A;  5JA4 B;  3LZ1 B;  2PYO D;  4S2J A;  2Y2I A;  1KX3 B;  4OP8 A;  5E2H A;  3G34 A;  3G2Y A;  3AZL B;  4UPK A;  5B0Z B;  3S1Y A;  2WAF A;  5HX9 A;  4OQ0 A;  3NI9 A;  1FSY A;  3O62 B;  2ARO A;  3UTA A;  3AV2 C;  5BPV A;  2Y55 A;  5B24 B;  4IBK A;  1I2S A;  3WTP A;  4U0T A;  5DVA A;  1YLT A;  2ZLY A;  5AV8 D;  3AYW A;  3W96 A;  1YLP A;  4X55 A;  5AVC A;  2EXB A;  5FDH A;  5GT3 C;  2Y2G A;  4DRB A;  2JCH A;  4G92 B;  1AXB A;  3NIA A;  1CI9 A;  5E43 A;  1XA1 A;  5B2J A;  4C3Q A;  3HLE A;  3IT9 A;  3X1T D;  3G30 A;  1VM1 A;  4XUJ D;  4CPK A;  2RL3 A;  1KX5 D;  3BFG A;  3AZN A;  5G18 A;  2WZX A;  1F66 D;  4LV3 A;  4R3B A;  3UE0 A;  4G91 C;  2X71 A;  1NJ4 A;  4YM6 A;  3ZNT A;  4H9R B;  3B0D C;  3VH6 T;  3FKE A;  3B0B A;  3B6G C;  2PU4 A;  1KVM A;  3WA9 C;  1P3O A;  4WMC A;  3I7J A;  4JXW A;  4WU9 D;  3LZ0 B;  4CJN A;  4DDY A;  4JF6 A;  3B6F A;  5B0Y C;  2Q9N A;  4IBD A;  2HIO C;  4E3J A;  4YS3 B;  5CPK B;  5KSC A;  3RJU A;  1HTZ A;  5DNN C;  5FQQ A;  5AV6 A;  4MLL A;  4XZQ B;  5KZH A;  3REJ B;  4EQI A;  3REK C;  2ZQD A;  2YFV B;  5E5A B;  3WTP E;  3S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...