4MB5A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag5
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
528
structure length
528
Chain Sequence
b'GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 172
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb5A01
2EDQA 2OI9C 1YPZA 2EYTB 1KXHA 1Q6DA 5JLZB 1I3RB 4M7ZC 1BLIA 2JJTA 2XG9A 3RWJB 2ZJSL 2YD7A 1V6YA 5HPCA 5B39G 2J7FA 5T33L 2IPTH 3KPNB 3MRRB 4FQ2L 6FABH 2FB4H 1VENA 1L0PA 4H88L 4ZOCA 5TGBA 2WVSA 2YD1A 3HE7B 4RNRA 4HT1H 4IRJD 5E94B 1AI1H 1GHFH 4Z7NF 3I75A 1H9VA 4FQXC 1PSKL 3MV7E 4MJ6B 3GB7B 5CJ5A 5L9DL 3GXFA 1WBYB 4JZJC 1V0LA 5I1EL 3WEMA 3MODH 5IM7B 2B0SL 3BP7A 3O3BA 1KTKE 5FYLE 1YMMB 3AYRA 3A4XA 2BV9A 4V1DB 2ZUTA 1RJZB 2NY5L 4WDIA 2Z92B 3HC3H 5CBAB 2VLJE 2YHGA 43C9A 2CO6B 3KXFE 1B1YA 2XUCA 3GGWA 3GNML 2DM2A 5IR1A 5MENB 2PCPB 1RMFL 3IU3B 1AHWA 5HNNA 4PJ5A 1B4RA 1U8JA 2GFBA 2OM5A 2A1WL 4KXZI 5KSAC 3OG4B 5SWZB 3CLWA 1HKLH 2C5DC 1JL8A 1T7ZA 4QP0A 4LCYB 1FV1A 3SQOH 1MCSA 5SX4H 2Q87A 1A7QL 1EDQA 4FZEH 3IDNB 5F6IC 3ARPA 4N9GA 1EJOH 1HJVA 3CX5J 1GVYA 4HPGA 1HIZA 3ORJA 5CGYC 3ETBF 3ULUE 5FM5M 1JZ3A 1Z5LB 2Z31D 2OWCA 1F2QA 1S78D 3MO1B 1J87A 4V1DD 5ALCH 5JA8B 2P5EE 3UR7A 2R15A 5GS2H 1FVDA 1QFUH 2GSJA 3ZR6A 1YYLH 3MFGB 3PZNA 1RIVH 2H2PC 1ZT1A 4IRZL 5DFTA 4DCQB 2ZXDA 3FQUA 3HE6C 4JB9L 3MNZB 3MGOB 1CICA 4IJ3B 1HSBA 3VXUE 1NANI 5SWZD 1R3IL 4F7CA 4P23C 5T5NG 3PWJB 1JPST 2R4RH 2IPUG 1ZAGA 5DMIL 1JPTH 5IWLA 3G5YB 2AKRB 2VB5A 2E8YA 1TPXC 2N4IA 2FGWH 3SDAA 1Q1JL 5IFTA 1EEYA 3DO7A 1Q38A 1WZ1L 3WO4B 4X4XA 1K4CA 4OV5A 1K2DB 5IJVA 5E99L 1L7TH 4PTUA 1C5BL 1Q9WA 4D2NA 4KRUA 3KYAA 4M9PA 3AU1A 1AQKH 4MA1B 1BIHA 4N0YL 5FUOL 3WLWC 5FHBH 1CZ8H 1WWBX 4HGWB 3CMJA 5JORA 3BKJH 1DEEB 3MRMA 1J18A 3FQRA 1I8IA 4P7NA 3W37A 3N1FC 4NKDA 4WO4B 4MNGE 1JD7A 3KGRA 2PTTB 4OIAA 4KRPC 2ZICA 5F72S 1AGEA 3WKML 3WH7A 4OZHE 25C8H 4NC2B 1X5XA 3GMMB 3X17A 2B1AL 3WUWB 2WXDM 1RUQL 1FE8H 1BWMA 4ODHH 1OW0A 5D7JA 1CDYA 5E9AA 5KSUB 4E4PA 2IGFH 4G8FA 1DANU 1SYSB 4JPVH 4MAYA 1UA6L 4BH7A 1H3WM 2CSPA 4FFZL 2O61B 4I9WD 4YPGB 4TUFA 4WCYH 2H8PB 2J88H 4UTAL 3DSFH 1I1AA 4NNPL 1OHQA 4ZS6D 1FZJA 3MROB 5EBAA 2XYLA 4XWGH 3MMEA 1JF1B 3CDCA 4AIEA 4NYLB 3VOCA 4F8TA 2VITA 3RPIA 1GH7A 4U6HA 3TC9A 5CINH 4KQ4H 5K9OB 2BK8A 4OM1H 2O9RA 1LO3H 2DI7A 4JRYB 2G9HA 4O51B 5JXAH 5DF0A 1XGUB 1GUVA 3S5LB 2RB8A 1CGTA 3WMCA 1YNLL 4MAUH 2PWDA 4OKVA 4M1CC 4HOZA 3SCQA 4LNVA 4IMKC 3FOLB 2ZZUT 3EO0B 1W3HA 2RFXB 3X13A 2FYYB 3QJHA 1NDMA 4HIJA 4ORGB 4OZ4B 1D5IH 1CGSL 1I9IL 3O4LE 4O58L 5EB9A 5JOPE 4JFFA 2FX9L 1MRDL 3I3EA 1A9EA 1XCTB 3NVQA 4DZ8A 4AIZA 2RR3A 2HT2C 3F5WA 1OQOA 2NX5B 3QAZC 2WINB 4F2MB 3VINA 3QG7L 1A4JB 2CD0A 2XVNA 3QUMA 1C5DA 2X4NA 4MB4A 5D5MB 2PF0A 1TXKA 3GBLA 1L0QA 1BD2A 2F19L 5EWIL 3H3KA 1XD0A 3HZVB 1KIRB 1V3HA 2V3DA 1ISYA 5L0QB 4XNXH 3SO3B 4YHEA 4FFWC 4HXAL 4BK4A 4Z0XA 5HJ3A 2JIXB 3GRWA 3P4NB 5GGVL 5DMGC 2AGJL 1MHPH 2R0WL 2D7TH 4GAYA 1MCOH 1ONQB 1M53A 4Z7QF 1JHTA 4NJ9L 3BKYH 3RAJL 4R0LA 4FLOA 3CIVA 1ZLVK 2NX5D 1VFUA 2UZIL 3DARA 5JXED 4BUGA 1NFIA 4FF5A 1X4XA 5CILH 1D5ZB 3POCA 2WSKA 4QXUL 1PLGL 1BMGA 5D72L 1I8LA 1EX0A 1UQZA 3EDEA 4CJ0A 1KC5H 1MVFA 3DUSB 1JK8A 1I85C 4WEMB 3OXSB 2JIXD 1ZS8B 3VIMA 4FS0A 4PRBA 4JY5L 2WKLA 4GKZB 2BNRB 2C1PB 2F5BL 4BZ1L 1CCZA 3LIZH 5IUSA 3MPCA 2N7BA 4OLUH 4PRHE 4XMLH 3TGXA 2FHBA 3V6BR 2DI9A 2X1IA 1HHIA 4HS6A 1E71M 3U9UA 4ACPA 2W63A 1R24A 1GXEA 3FHAA 2IFFH 5BV7L 2DAVA 2FO4A 2HVKA 1R3JA 2L4OA 2BSTB 5BJTB 3SDXB 3FKUS 3M8OL 1MYRA 1IQDB 4S0TD 4GW1B 2VX7A 1CGXA 1LO4L 2OL3B 2ZUQB 1ZLWH 3TESA 3B9KD 4R90H 3B2VL 2WMFA 2LU7A 3BHBB 4G8GB 2MWCA 3OKNA 4L4VE 4S1RL 2CXKA 5CD3B 2BNRD 5L88H 3OR6A 5IB2B 3HUJA 3ZKXC 1S7WB 1BFVL 2JF1A 3H9ZA 1B6DA 2UVFA 4AM0A 1C16A 3LQAL 4ZDHA 3UC0H 1JYNA 4XAWL 4DFIA 1LVEA 2ADIB 1KBGH 3BDYL 4ZD3L 3VFRA 4XVJH 2ITCA 2IEPA 2ILLA 2WIIB 5I8EB 3CHCA 3ES6A 4KRPD 2ZUUA 1DJSA 2EYTA 5SV3A 3T0EB 5JUEH 1PD6A 5JLZA 1VADB 3H3PL 3MLYH 2GYSA 2VI0A 3WUGA 1QHZA 1V7ML 3EOBB 3RWJA 1JN6B 3UZVB 1U6AL 1H5VA 3LKRB 1FYTB 3KPNA 3MRRA 5D9SB 1DLFL 3BAYA 1FORL 2A73B 2RHEA 2BC4B 3HE7A 2YBTA 2XACC 5E94A 5HYSG 2CDGB 1E4LA 2YUVA 4JFQB 1HL9A 4HPOL 1XCWA 3P11H 2YC1A 5LQBL 4GAGL 1AIFA 4MJ6A 3W82A 3GB7A 3ZL4H 1WBYA 1ZEAH 1R3KB 3CDGB 2YD4A 4NQCE 2X9YA 3CVHH 2R39A 3MCLH 5K9QG 5IM7A 1MFBH 1G1YA 2WHLA 3LN5B 1QBML 3W0KA 5T3XD 2DSKA 1HJXA 3U7BA 4U1MB 3HMWH 2FATH 5KJRH 4JFUA 3IDYC 4V1DA 1CU4L 1RJZA 4YWGL 2Z92A 4K3GA 5CBAA 2EC8A 4ONFH 4XZWA 4OBRA 3MACL 5CKAA 2DMBA 3QG6B 1JFQL 1MRCL 5MENA 5FM4A 4WGWB 5T1KB 4MLIA 2PUQT 3HC0B 2W59A 4DW2L 2C7UB 3KLHD 5IJKC 3IU3A 1AKJB 3NGBC 4NQDB 1BQSA 2VQUA 1OP5K 3DVNB 2ZUMA 4GQRA 4I18C 1G9NL 5SWZA 1Q0XH 5MERB 3RVUD 3HZYB 4U6VL 4FABH 4EEEA 2IQ9H 4OZIE 4E8CA 4LCYA 4MVBC 4NFCA 3MSDA 2VXUH 2YPKB 4DTGH 2QV4A 1VDGA 1QA9B 3DUUB 1Z5LA 1AR1D 4IIQB 5CP3A 1XGRB 3MO1A 1TFVA 5E08L 2ZX6A 2HT2D 1AJ7H 1C91A 3P4OB 3FN0L 5EBWB 3SGKA 4M8UA 4AH2B 1DDHB 1FLRH 5T1KD 3UG4A 3GSRB 1Q4NX 1X5JA 4LYPA 3EYUL 1JZ8A 1IT0A 1AKJD 5FYLL 3MXWL 3MNZA 3MGOA 5CIPH 3B9DA 4PG2A 4U0RB 5DEFB 4FFWD 1UCBH 4W4OA 3PWJA 3V6ZA 4JFDB 3KYNB 2DQIH 2J47A 2ZCLL 1QPPA 3JV4A 2VXSH 2JJVA 4PUEA 4E5XB 3G5YA 2AKRA 1MW0A 4JGJA 1V3LA 2QADD 3ULVC 4U7KA 4OLWH 2E7LA 1L8NA 5F1IB 3OKLA 4F33A 3CHEA 2GI7A 4N5EC 5FKAB 1NPUA 1KGCE 4MQSB 1OSZB 2H26B 1T0PB 5DQJB 3FCTB 1I1CA 1Y6KR 1WBZB 2YPVL 4N68A 2UWEE 5D5MF 5C9KA 3ULUL 2GJ6D 3MXVH 4MNKA 3TTOA 2NY7H 2IH3B 3RY6C 5ANME 5H2BB 4HGWA 4JFDD 4XZUA 5B39B 2Y36L 2EH8H 4UV7H 1DEEA 1F8TH 4NM4H 4ZSOB 1GOGA 3FTGB 1A5FL 1DVFD 1JPFA 3TT1H 3SUTA 1CDJA 4LIQL 4NN5C 3RL1B 5BVPH 5EBLB 4WO4A 4CMMB 4FTVB 1TVNA 2PTTA 4Y4HB 3ARRA 4ZAKC 1XIWB 4DN3L 4LMQI 3GMMA 3WUWA 4UFLA 4HJGA 1K4DB 4RGNB 4E2OA 3MNWB 1MJ8H 4V2XA 4PLJC 1SYSA 5KSBB 2VSDA 2X1PA 3U83A 1P6AB 1JTOA 2VAAB 3HRPA 3MLZL 5HVWA 15C8L 4N1CA 4YPGA 2G2RB 1A1MB 5K9JL 5MEPB 1Z9SA 5KVGL 1QOKA 2VISB 4M48H 3MFFB 1HXMB 3MROA 3OR7B 3QEGH 1B0GB 1ZHLB 2VDOH 4GBXC 4G8EB 5HVGB 4DVRH 1WCBB 3JV6B 4KAQH 2X40A 4O02H 1UXWA 4HLJA 5MI0C 5C0BE 5I15H 3TEUA 1KB5H 1RUKL 3GMOB 1XIWD 3EW3B 2DD8L 3DRQB 5ABHA 5K9OA 3QEUB 4H25B 3WDJA 5KW9L 2FDBP 4RGND 2ENYA 3LS4H 1GNXA 4LPCA 3PWNB 4XP9H 4O51A 5BXSA 1XGUA 3L5HA 4Z95H 1NGYA 5D96B 1OP3H 2JB5H 3R8QA 1BQHG 4YDVB 3S5LA 5L6YH 3W29A 3S37X 3FOLA 2FSEB 5DXWA 1A6WH 2MQ0A 3SDXF 3EO0A 4RAUB 4ODVH 2FYYA 5ADPH 4OCRL 5JIWA 4ORGA 4OZ4A 4ZFOB 1K6QH 2X42A 4PRPE 4PRIE 3DUHA 1CLZL 3AY4C 1XCTA 2XY1A 3QIUC 2NX5A 4F2MA 2WINA 4I1NB 4NP4H 5JXEA 5FO9A 4M03A 5BW7A 1LF1A 1CYGA 3NFSL 5A40E 3AMGA 1CD0A 4WVRA 3WIHA 4U5KA 1TZGL 1V02E 2DMKA 3THCA 1TJGH 1FH7A 1OAZH 2XOTA 4X7CC 1XGYL 2E3ZA 4TX6A 3HZVA 2O9TA 5E8DL 2WP3O 3W9EB 1KIRA 2J1KA 3A6BL 3BXWA 1E3ZA 2WV3A 4WUKL 3CUGA 5IDIA 2W92A 3CFIC 5BWFA 1G6VK 4KKAD 2JALA 2JIXA 3V7AG 3P4NA 5GRJL 5B3JF 1I8MB 1ONQA 1U41A 4HK0B 4JZNB 4K8RC 1YJDH 1CF8L 4HZ8A 4NZCA 2VZTA 3UTTB 4RL3A 2YD2A 4XX6A 4X6DA 5TJWK 1F45A 2XKNB 4HC1H 1OAKH 1UB6B 4JFEE 4TXEA 4O9HL 2UY7A 1DP0A 2CPCA 1O7SA 3C2AH 5GGSA 3DUSA 4FQCL 1IBGL 3SDCB 3SE9H 1FDLL 1W9PA 5EUOB 1IT9H 3GJFB 1OGBA 3OXSA 3PL6D 4ZO6A 2VTFA 2R0ZL 4QXTA 1HK6A 3B9KA 4GKZA 1QBLL 2Y8KA 1CN4A 1EHAA 2GJJA 3SUSA 1JCKA 4GKSB 4HS8H 1QZ1A 2BNRA 4S1QH 1BREA 1NCWH 3UTTD 4M5ZH 3RILA 4YHLH 3LHPL 4OZFB 3R1GH 3OKEB 1N6UA 2X4QB 4PJ7E 3QB7C 1IC4H 5DZLA 4TPRH 3OGCB 2HFGH 2OQJB 4JHWL 2BSTA 4K3DL 3SDXA 3MOAL 1IQDA 4GW1A 4ALAL 1XSJA 1F6LL 1NMCB 2M26A 8FABB 2OL3A 5E0FA 1UM4H 4TULH 2HKHH 4EN3B 4G8GA 4PJGA 1GQLA 1OGSA 5CD3A 5D8WA 3C6LD 4DEPC 5IB2A 3LEYH 4G6ML 4UI2A 1YEFH 5BCAA 3WFLA 4QLRA 1RPQA 2ZWLT 2OZ4H 3U82B 1OAYL 3D9AH 2ADIA 4B5EA 5LVEA 4QNPF 1OAQL 1RULH 3PDOB 2VDKH 1KCVL 2WIIA 5I8EA 2Y07L 5CD5C 3GSNB 3T0EA 4ZAKD 3RTQD 1PKQA 1YQVL 4K7PL 4DUVA 2WCGA 2JE8A 1F90L 2PW2B 1UCTA 3WJJA 2VRJA 3EOBA 1JN6A 5E7BA 1OGTB 3RY4A 2PO6B 3SJVB 3LKRA 1FYTA 5D9SA 3O8XB 1Q9LB 3GKZA 7FABH 1KXTB 3T4YB 5D1ZC 5IBLC 2A73A 2BC4A 4LSTH 4KHTH 4QT5B 4B53A 4JFQA 2VWEE 4NNXB 1BECA 5DD1L 2Q7NA 2IF7A 3KYOB 4GBXD 4HWZA 1IJ9A 4UILL 5IP4A 3CDGA 3TTYA 4XWOD 2NY5C 5AG8A 4FMFA 2AQ2A 3B5TA 3V4UH 1NP2A 3IKCB 3LN5A 3TZVD 2VXTL 2XFFA 3DV4B 3QUKB 4KKCD 4U1MA 5ECUA 4DGIL 3Q5YA 5C07E 1F2XK 5D7IE 1EZVY 2D03L 5CS7A 3F58H 2PO6D 3EDKA 5DVKA 1WTLA 1IEBA 1RVFL 2ERJC 2ICES 5TF1H 3DVFA 4PEEA 4UZGA 5T1KA 3HC0A 2C7UA 2NTFB 4P7LA 5KSBF 1AKJA 2VXQL 4XBEL 3NCOA 2C3XA 3MSPA 3DVNA 2JELL 3C09B 5MERA 1LILA 3HZYA 4QHUA 4DKEL 4HPYL 4PLKD 1QR1B 1LDSA 3GH5A 5KVEH 2O92A 4MQTB 5FYJH 3W0WB 1UR0A 5A2KH 1QA9A 3DUUA 1X5IA 4IIQA 1JG9A 2ENSA 5GGVY 2CR6A 4B50A 3SCSA 1CD9B 4HV8B 5EBWA 4PUBH 3PG2A 2DQDH 2OSYA 3RM9A 3EJYC 1KG0B 2QHRL 4AH2A 2DRUA 3EBAA 3JVGC 3QXTA 3GSRA 1U8NA 1NL0H 2A6DB 5HI4C 1QNZL 2DKUA 1RZJH 1UKPA 4UIKH 3BRFA 2JJSA 4JKLA 5C0ND 2GJ6A 5E8EB 3STLB 4NO5A 5DEFA 1NKOA 1UJ3B 2LU3A 5C2BH 1HXJA 1C92A 4JFDA 4JL1A 3KYNA 4AMKH 4C83B 2VVNA 2X7LB 4BSJA 5JHDD 3BLPX 4WJ5B 3W0WD 1TMCB 1DVFA 3W39B 4E5XA 1BQLL 2LTQC 4MJ5B 4QRUB 3S4SG 4D1IA 3PZIA 4P48A 2E27L 2XVGA 2XZAL 3WHXB 1LDPL 5F1IA 1A0QH 1WT5C 3OPZH 4TUKL 1E73M 3L2LA 5T5NF 1KUMA 1MAKA 1H0GA 3T0DA 3FT2B 3WS6A 5FKAA 1JNLH 2VLRE 1OSZA 4RIRB 2H26A 1FOBA 5DQJA 3BAJA 1WBZA 1W9XA 1ZBKA 4KI5C 3LRSB 4YDIH 2VL5B 2IH3A 1FA2A 5JW4R 5H2BA 5B39A 1VBUA 2NY6C 1KJ2H 1ZL1A 4ZSOA 1YY9C 4U3CA 1KLFA 4LNRB 3KPMB 4Y4FD 4HXBL 3VJ6B 3RL1A 1AFVH 4ODVL 1RZKL 1E40A 2AJSH 5EBLA 5HYSB 3MMWA 1MW3A 4FTVA 2AVGA 4QRRE 1JHLL 2NY0B 4LVHB 1HH9A 1X5YA 1AQDB 1LD9B 5DD0H 1XIWA 1EQCA 1KJ3H 1A64A 4YXLL 4P7OA 1K4DA 4WTZG 4KUZH 4GI6A 4HLZG 3MNWA 5LBSH 1X44A 4XUYA 4AISA 4DM1A 5A6MA 5KSBA 3ME0A 2VAAA 3E6HB 3WF3A 4ZNCD 3AISA 1F6FB 2G2RA 2YUWA 5MEPA 1ZTXL 4PJEB 2VISA 4LCCC 3WEOA 3MFFA 1HXMA 3PGCB 5HHXH 3SGEI 3SGJC 1ULVA 3I02B 3OR7A 3B2UC 2YIHA 3GHBL 4G8EA 5EUOF 3D85B 3VA2C 2ZP0T 4OGYL 3VFUB 1MY7A 1WCBA 3JV6A 3GI8H 3RDKA 1INEH 3R06B 4XNYL 1U8PB 3GMOA 1WFTA 2O26U 3DRQA 1WAAF 5C70A 4U1HB 2P7TB 3KPSB 1NMAH 3M1BA 4IDJH 1HWHB 2CGRH 3PWNA 5BRZB 1YMHB 2HISA 1ADQL 1Q9OB 4OIIL 5CD5D 4M62L 4YDVA 5D9MA 4LKCB 1BBJB 4W6WB 3QWOA 1UWEL 2QV2A 5IEKB 1E6JL 1WEJL 2EICA 3GI9L 1KYOJ 3FB6A 1DBMH 1V05A 4RAUA 1A6PA 4NQXB 3WFDL 1RH9A 5EC2B 5JQ6H 4ZFOA 4P9HH 4YE4L 5IK3B 5L8LB 3RPMA 5J12B 3K7UA 3ZLQC 4D9RE 5I74C 1P6WA 3JTTB 2VNCA 4UDUB 5L2JB 4OD1H 3RVTC 4PJIE 1PZUB 2Y9RT 1F13A 1IGJB 2AJYL 5DZNA 2C8NA 3TPUB 1C5CH 4LSDA 5BRZD 3WLBB 1Z2KA 1N26A 1JWSB 4KY1H 4C56E 3W9EA 3QNYB 2C4FU 3NZHH 5EZJA 1LG1A 2BDNH 3P73B 3JZ7A 1MHCB 4JDTL 2R1WB 4YHPB 5HHMB 2XKSA 1CFNB 1BSIA 3IFOB 4U6XB 4WI2A 5DEZA 4A2LA 3UPRA 3AMDA 1F3DH 1MVUB 1I8MA 2ED8A 4HKBA 5EB8A 4JZNA 4HK0A 4P3WA 4CD5A 3W11C 4LKXB 3ZJ7A 3UTTA 4X6FB 3PF2A 3KPLB 5D2NE 3U0TB 4OF8A 1I3VA 3UJJH 2PXYB 3O2WL 1IQWH 3KEHA 1G0YR 3QPQC 1J8HE 3C9NB 1ACZA 2XKNA 4GAJL 5DZOA 2XXCB 3TN0B 4GXUN 1N6QL 3E2HC 3FMGL 5EUOA 1PZ5B 1TJIH 5C1MB 3GJFA 5HHNB 4HZ7A 5E2WH 3LKPA 4BFGA 5ABGA 5IT2H 4LPUA 4FQHB 1ES0B 5IFAH 3MV9E 5H8DA 3U7WL 4PMUA 3O4OB 4GKSA 3H0TB 1WAAA 4OJFH 4Z7VE 3ZDZE 1CEOA 1W3JA 3IDXH 5BV7C 4K71B 5TQ0L 4D1JA 3C2SA 4NUJB 4OZFA 3S3SA 3OKEA 4PBVC 3TOPA 1ZLVH 5IW6A 2X4QA 5CUSL 3LPGA 3TN0D 3VVGA 5I18L 2OQJA 5FKPA 1OM3L 4X9FA 3DX6A 3RTQA 1T21B 2XY2A 5IVNA 2A3EA 4OOUA 1E27B 3IJSB 2ZSVA 4XPTL 4EN3A 4IRSB 3U30C 1BQHB 4Q74A 5HHVH 4Z7OF 3IFNH 3O11B 4IPNB 3FB8B 1QLFB 4JO2L 4L4TB 1S5IH 1BFTA 5F1OB 2V5CA 5EZIL 4WK9A 2WZIA 5DSCA 2VDPL 2D23A 4W84A 3PDOA 4L8SA 3CX5K 5TFSL 1M03A 1UD4A 5AAWA 3QBTB 5DRXA 1CBVH 1MF2L 3TZVA 2NR6C 4NNYB 2PW2A 2WP3T 4WW2B 1SQ2N 1OGTA 1CE1H 2PO6A 3HG1B 3SJVA 5IHZB 4YXKH 4U5IA 3O8XA 2IMNA 4X8XA 3T4YA 1KXTA 1ZBCA 4Y19D 4IMLB 1JZ2A 4L4TD 4QT5A 4ONGH 4NNXA 2C3WA 1QSZA 3FONB 4NQEB 3KYOA 3UCRA 4ONOA 3UO1H 5A2JH 5BS0E 1AY1H 3QDJE 2OSLB 1GONA 2DSUA 4FLRA 3IKCA 5F7HA 4G3YL 3QUKA 3VGDA 4R9HA 1T1ZB 2X9WA 5DJ2B 1N5YH 3IXTB 1ORQA 2JCCA 3GBNL 2XZQH 3PXHA 1W1YA 3HG1D 2V5SA 4M6MH 3VXMB 5F9OL 1QSFB 2QQKH 4MMXC 5DC0A 4BQBA 1I9JH 3M7SA 4LEOB 1G9NC 1U91B 1BLNA 2NTFA 1KBBA 4JLRA 2O5XL 2VDQH 4ATDA 1F42A 3F7YB 3MRHA 4M43L 4YHKH 1SJEB 4NQED 4WKAA 1IAMA 4MDPA 4TVPE 5IFJB 1UD5A 3BJLA 1QR1A 5BO1L 4H26B 4PJEF 1BM3L 4OLXH 5IB1A 2E6JA 4M7LL 3W0WA 1ZHBA 3JUZA 2APFA 2EPKX 3G5ZB 3O6KH 2DT1A 4G9FB 3QQ9D 2CKBH 1FN4B 4HV8A 4JFHD 5I71C 1QSFD 4YHOH 4AZBA 3KLSA 3SKNB 1IAIH 1KG0A 1ZGLB 3HRZB 1GGTA 1OOAA 1VB9A 3BQUC 2A6DA 4LSRH 2E6QA 3GNPA 2Z8VC 1A1NA 4U1LB 3WUZA 2GJZB 5CJOH 5ESAB 5E8EA 3NACL 3STLA 5CPSA 1NLBL 2D7NA 1AQ0A 3QA3B 4D9LL 3SKMB 4FQJL 5J89A 2WC3A 4C83A 2X7LA 1OP5H 2W62A 3VXNB 3W39A 3OZ9L 4MJIB 2PI6A 4Y4FA 2YKKA 4MJ5A 4P99A 4GLRH 3B4NA 4JVUA 4EUPG 3TYGL 4NQVB 3WHXA 4G9FD 3HTLX 4YHML 4D0BB 1EHXA 3ULUC 4OZGE 1K3IA 5I6XB 4ENED 1MW2A 1IGCL 4P2QE 3Q6FB 3GNOA 4F80A 4RIRA 4KKLC 4V27A 3C08H 3S7GA 1M05A 1SJVA 2WNGA 3TPKA 2CO7B 4G7YL 4I2XA 5FDYA 3N0PB 3SUUA 3P30H 1IM3B 3CSGA 3LRSA 2VL5A 5IMOB 1MCRA 1QP1A 1WDPA 4PJHB 5CAYB 4IPLA 4QDMA 4DFHA 2HP4A 3LMJL 3U4BL 4MA8H 3VFPB 4LNRA 3PV6B 1WWAX 4MJID 5I1CL 4XH2B 3VJ6A 2QSTA 2VC2L 5HYSA 1CTNA 3S37H 1RK0A 4HWNA 3AZRA 4F58H 1AQDA 2KPNA 3VGEA 4QLLA 4ELKB 4OLZL 4R4ND 5EOCL 2VDRH 2CERA 3UMTA 4Y16C 4RZCB 4U3HA 1GQKA 2BSSB 4JM2C 5CJ8A 2R4SH 4LLQA 4UTBH 3PZGA 1RHHB 4N5UA 4FQQB 3G6JE 1U8QB 3CMOH 3LZFL 4R97C 4EIZC 5CJXA 1JXJA 3F12B 4PJEA 1JNHA 4KPHL 4G6JL 1EO8H 4XC3H 2HWZL 3PGCA 1OAXL 1MFCL 1MI5B 2WWKT 4X6CB 4LLAA 3OLDA 5FGRA 4EOWH 1YPZE 3D85A 4I4WB 1J05B 3ARBC 4LRIC 3TA3C 3VFUA 4CNIA 4K7PY 4PS4L 2J8FA 4WFHE 4OQ1A 3L3GB 1U8PA 3OMZA 4QRSB 4XP5L 2EZ0D 1EGJL 5GS0L 3AHYA 1ROWA 1NAMB 4U1HA 2W61A 3NABL 4I13B 1LO5B 2ID5A 4JHAH 1IZKA 4X7EC 4AL8H 1RIUL 1UZ6F 3VFTA 3WF4A 5BRZA 2YMXL 1H3XA 1U8OA 3GIZH 2EXWC 1Q9OA 1ZMYA 1JRHH 1NWUA 4P4KD 4LKCA 1RUPL 1BBJA 3OG6B 5DWUL 5EOTB 3QRFM 1HP4A 3CD4A 2DQXA 4JO1H 5KZCB 5HGGS 3VIKA 3D48R 1CL7L 2FWOA 4NQXA 5C6PB 5GRWA 5EMYA 4KVNL 5LAXB 4M5YL 1DSFH 3IANA 5D8ZA 5IK3A 3V4VL 2BSRA 4OM0L 3MLVL 3SHSA 5IBUB 3JTTA 4UDUA 5L2JA 4FFYL 3AM8C 3NPSB 1IGJA 4NM8L 3TPUA 3S4SB 3TBWB 4P2OC 1EMTH 4M02A 3WLBA 4U6TA 2OI9B 2I24N 4PJ5E 1JWSA 4NDMB 5HYEA 4GXVL 4KUCD 2QPUA 1E6SM 3AS3A 4M7ZB 5C6TH 5CP7B 3P73A 4ODUA 3SPVB 1MHCA 5KZCD 3QH3B 2R1WA 2EC9U 4YHPA 1CFNA 1FAIH 3IFOA 2CMRL 3CFKB 1UQYA 2C1OB 4EVNB 2Q8AL 1GOMA 4WW2F 1MVUA 3S88H 3DXAB 1WNOA 3U46B 3O2DH 4QHKJ 4LYQA 4BM7A 4LKXA 5ADOH 2UZYB 1QNSA 3NA9L 4FQXB 5IMKB 1M4KA 5F21B 3WNKA 4LCUB 3DTXB 5EBGA 2YDRA 3MMDA 3KPLA 3U0TA 1ZVHA 2PXYA 4URTB 4YFEA 4PGBB 1R5WB 3ARWA 1CGYA 3C9NA 3WENA 5B8CC 4P2RD 1KEML 2J74A 3ZHLA 3TN0A 5SWSD 2OXGA 4QGTA 3D3VD 4MXQD 3BSGA 3ZYOA 1MJUH 1PZ5A 2KZWA 3ZT5A 3KR3H 4KTYA 4HK3N 3BIBX 5DJYB 4JIEA 1N3NB 2F5AL 1ZKAA 2DM3A 4FQHA 1ES0A 5GHWH 4BZ2H 2C26A 4XXCA 3H0TA 2V3GA 4Z77A 1KJMB 4TVCA 4CVXB 3PN8A 5B22A 5DMYA 4UZUA 3WH6A 2VR4A 3BEWB 2NSXA 2A6IB 4NUJA 3VXSE 4Z7NE 4O2EB 4PIRF 1D5MB 4QRQB 3AIVA 2KUTA 5JIHA 4UT6H 1JTTA 5T3ZH 2ZUYA 3DJ9A 3SUWA 3WIFB 2WZPD 2A74B 3IJSA 2WBGA 5ILTL 2AK1H 4IRSA 4Q6IB 4OFKA 3IDJB 1G6RB 1BQHA 3KYKH 2APBA 3BSHA 3O11A 3OLIA 1BOGB 5KS9B 3NTCH 1KENL 2D9QB 4L4TA 5HHOB 1F4XH 5DR5H 3RBGA 3OGSA 5ENWB 2DSZA 4PRNB 5AYQA 2CK0L 5GRYA 1T6VN 1XZ0B 2NYYD 1INDH 3AJ7A 4O4YH 1B2WH 4JQXC 3CK0H 1EA9C 4M7KH 5D7KE 4NNYA 2MCPH 3HCVA 4FN0A 4WW2A 4N8CH 4DGYH 4KXZH 4JDZB 1B3ZA 4UQEA 3NCBB 5CPQA 3HG1A 1T1WB 5IHZA 3BESR 3ARDB 4D94A 2ZG3A 3TO4C 3RWFB 3RDTC 5C0EB 5FYKH 4G6KH 5I1IH 3CZKA 1IFHL 5HHOD 2OP4L 3OIHA 4D6IA 3UJTH 1FC2D 3S8WA 5I76B 3LPOA 4DGVL 1KELL 1QBBA 3UESA 4PJDB 3FONA 4NQEA 2H32B 5DVNA 2A9NL 4H1LH 3SN6N 1GOIA 3WSQH 2CHNA 2CYGA 3KJ4B 2BMKB 1Y6NR 4G7VH 1T3FB 1Q6FA 4HJJL 2PTVA 1NMBH 3LSOB 1TIUA 3TO2B 5DJ2A 3IXTA 3U48A 1FFNA 3ARUA 3NPZB 2OX5A 3PJSA 3VXMA 2B1HH 1NANH 4KFZC 1QSFA 3ARDD 3MKKA 3CZGA 1Q72L 4JFFE 4NO3B 4LEOA 3CU1A 1U91A 3BC9A 4LXFA 1UM6H 3F6LA 3KPRB 3ILQD 3IB4A 4WWKD 3F7YA 1OD7A 4LCIH 1I9EA 3U1SL 3X14B 1E72M 2R0KH 4QOKB 5GNZA 1BD2E 3MR9B 3V4PH 2E5EA 3FAWA 5DLMH 2MQCA 1JV5B 4H26A 3SKUD 4NKIL 3VM5A 3H6JA 4LBEB 1KGXA 4FQIH 5I23A 3G5ZA 4JFXB 3SE4A 1V3IA 1QYGL 2NXZB 4G9FA 5GGQL 4KH2A 1FN4A 3I50L 3SKNA 4GRWB 2ZOXA 2DIJA 1ZGLA 3MLWL 3HRZA 5KVDL 5I78A 1N5AB 1MIEH 3W27A 4OTXH 4PFEA 3KPRD 3HI6H 1KTRL 4P8XA 2YKLH 3C6SB 5I5RA 4U1LA 2GJZA 3NCCB 1LP9E 5ESAA 5E4EC 5DC4B 3WMSA 4QOKD 1RY7B 4HFWB 3EYSH 1L7IL 3QA3A 4KUCF 2XA8H 3MLPA 1RJLA 2F54E 1SVZA 2ICWJ 3VXNA 4MJIA 3S96B 4R8WH 4X80H 1CDGA 1HJWA 4R4BA 4AENB 1HIML 3RNQB 4K3JL 4NQVA 4BCEA 5A2BA 2Y8VA 1CD8A 2NXZD 3FXYA 1RZ8B 5KVMC 4D0BA 3LN4B 2EIBA 4TVPL 4PTXA 5J6GB 5IGXH 3L4UA 1UKQA 5GJSH 4RA0C 4HWBA 3G6LA 5IHSA 1DL7L 4PV9B 4PJXE 3TV3H 2IPUK 5IMOA 3BGFC 1DUYB 2J6EH 4PJHA 3KL0A 4MNQB 3L5IA 1HCFX 4L3ED 3TH4T 5EO1B 3VFPA 3K74B 3RWCB 2AXGB 2ADJB 3MJ9L 3PV6A 4PV8B 4WW1B 3AHTA 1UD2A 1M71B 3F7VB 4XH2A 4QF1B 1Z3GH 1EXPA 3FFDB 3QJFB 2OCFD 3UAJC 4JVPA 1QSEB 4FLQA 3UX9B 4ELKA 2VH5L 1K9EA 2J4GA 1FZOA 1MHEB 3MJGX 4RZCA 4AG4H 4OCWL 3FO9A 2BSSA 2JB6B 3FT3A 3HUJE 1HJSA 2DWEB 3IYLW 2DLFL 2FX8H 4U1GB 3MLUL 4NBXB 4DN4L 3WKNA 5TH2B 4PCSA 1A14H 1RHHA 3P0YL 1J01A 2AK4B 4FQQA 4XPHL 1U8QA 4P4KA 4Y8DC 5GRUL 1MWAH 4RAVB 3F12A 1FBIH 1GOKA 2ARJB 3G6DL 2ZUWA 4UINH 1T03L 1MI5A 4LF3B 4X6CA 2A3HA 1KEGL 1HWGB 4I4WA 1J05A 3I6GB 3VW3L 3H2WA 5E6YA 2Q3AA 4X5XB 3L3GA 4IS6B 3ZOAA 1QSED 3JV5A 5F44A 3S88L 5GQBA 4TUOA 2ZX7A 2LAAA 2DQHH 1QKZL 4Z7QE 4HUKB 1DHKA 5FL1A 1LO5A 1I7TA 4RGOH 3VI3E 2WK2A 5AG9A 1VJZA 2ARJQ 4UR9A 2OYKA 1WDRA 1CDIA 2YD6A 3U57A 3O45B 2AK4D 4FFVD 4XPFH 3S35L 3O3UN 3P40A 3RGHA 5EOTA 4LU5L 4Z9KB 1OCWH 3VH8B 4D0CB 4LSSL 5A94A 2VRKA 3UJIH 4UT7L 1D6VL 5LAXA 2A9ML 4LOUC 1MLCB 3WEXB 3OKKB 4Z2JA 3MBXL 5HBBA 3HU7A 5A6JA 2FNBA 1UWIA 4WIWA 4V1DE 1QLEL 1KIPB 3VG9B 2J3SA 3WIIH 2MKLC 4P0DA 4W87A 1BEYL 5DUBB 5KS9F 1RV6X 1DQDH 1GZQB 3C60B 3S4SA 3MJ6A 4OLYH 5I6SA 1IC1A 2ATPA 3RVXD 2MCG1 4EUPB 1P4IL 4NJAH 4NDMA 3L3DB 4YBQD 4R26H 5SWZE 5SWSA 5CP7A 3SPVA 3QH3A 3D3VA 5KTEH 1KWGA 4XMKL 4LASH 4GG6B 5DJZB 5DHYA 1RFDL 3CFKA 1RP9A 2C1OA 4OT1L 4EVNA 2P1YA 1E4NA 1DBAL 2IQAB 4ZUSB 1LEGB 5LA0A 4P9ML 2V7HB 1MCNA 2X0YA 3G6AB 4FQXA 4X7TB 5IMKA 2COQA 2UY2A 1S7RB 3DTXA 3QCVH 3C60D 5EORH 5M5DA 3EZJB 1WAWA 1R5WA 3TNNB 1KB5B 2W67A 3BRGC 4Q0XL 3QUYC 2W9DL 4TSCL 1UEMA 3MOQA 3BPOC 4WTZA 1VESA 2CKSA 5BXFA 2V5TA 4MHHG 1PGRB 4XX1E 5E1AB 5DJYA 1ACYH 1ISVA 1ZVYA 5KOVC 1F4YH 4AT6B 1GIGL 4QRPD 1KJMA 4B41A 4L9LB 3F7PC 5JW3H 4CVXA 1L4IA 3K2UH 4JM4H 4J6RH 3BCDA 3L4WA 2ZCHL 2J4WL 1QRKA 3BEWA 3F62A 4I3RH 2A6IA 4HWEL 3GUTB 2QL1A 1W0WB 2FJGB 4O2EA 1D5MA 5JBFA 4QRQA 4I9WE 3PHOA 2D4FA 4PY8J 2PWEA 3ARGD 4OUEA 4LDLB 3ULSB 3WN5C 2DIAA 4CD4A 4R7DB 1XGQB 2KQNA 1V3MA 2NW2A 3WIFA 2A74A 4KROC 1SBBA 5EZLB 3VFWB 4LQFH 4Q6IA 5I75B 2HFFB 2YLAA 3NN8A 1B0RB 3GSQB 1PYWB 1WITA 1BOGA 4GRWF 4OCYH 3EYPA 2AERT 5HHOA 1YEJH 4GXUM 3DHUA 1J10A 4CVWA 1ZSDB 35C8H 2IANB 1LWHA 5ENWA 1RZIB 5CMAB 3Q48A 4QKXB 4PRNA 1XZ0A 5C0AB 2XSBA 3W9DB 3BGMB 4JRXB 3V0AC 4W89A 5AZEH 2YUZA 4N9OB 2VERN 1T2QH 3WKZA 5JR1H 3AZTA 3HNVH 3O81A 3TM6A 2HLFC 2R2HB 3Q6GL 1SY6H 4QTIL 4W88A 4JDZA 1T1WA 4YGAB 3ARDA 2DN7A 3BEVB 5HGHB 3RWFA 2Q1EA 5C0EA 4JPIB 2DQEL 3T65A 2JKXA 4Q6YA 4HKXB 3SCOA 4WWKA 4ODTL 3HA0A 4PJDA 1J1PL 2H32A 3ZDXF 5JHLL 4NN5B 4KDWA 1JPSL 3H9YA 5CP3H 1MPAL 4PSRA 5C0AD 4G5ZH 3BPNC 3CXHJ 5IB4B 3PWVB 4JRXD 1HI6B 5FK9B 4PMDA 4OLVL 2BMKA 2CESA 1T3FA 1TQBC 1I7UA 3KYMA 5FCUL 1NGPH 4AQ1B 5ETUB 3TO2A 3GJEB 3K4ZA 3WFBH 1AD9B 4F7EA 2ZX5A 1H3GA 5A8OA 1UR4A 3MBED 4NO3A 4NSKB 2APVA 1P6FA 3KPRA 2NX5E 1A21A 1E6OL 5GSRB 1MQPA 3X14A 5JUVA 4TTDD 3UG3A 4QOKA 1JGVL 3MR9A 4NGHH 5EFIB 4ZMAT 1KFAL 1MREL 2VWEC 3A6CL 4XVUD 1JV5A 2YPLB 5E6IC 4PGEB 3ELAT 5IVXB 5H37H 4LBEA 1UWGH 2WBKA 4U2YA 1GGCH 4YQXH 4MNJA 1YEHL 4PSPA 4JFXA 4MD0A 5C0BD 4Z2HA 2EE3A 2VZSA 2HT4C 5I2IB 4PN2A 2NXYB 4AXNA 2A77L 3P77B 4YO0B 4I3SH 3EOTL 4ZPVA 1NDGA 4K9EH 4YIQA 4X7DC 4EI5C 1NWRA 3C6SA 3U0PB 3NJ3A 4J3TA 1FO0L 4X6DE 5IQ9B 3KNBB 5J1SC 5FD0A 3DMMB 4PP2B 4YHIB 4HFWA 1DWFM 3FW6A 3OJDB 4OCSL 4G8IB 4KVCH 2X89A 2YPLD 1P4BL 3TBVB 3BFOA 5J56B 1BWWA 1N64L 5DUML 3S96A 3DC0A 4UQ2B 5LKNA 4AENA 3AIRA 3RNQA 1K9TA 1UR1A 4OSUL 3QUML 3PIQB 1RZ8A 1R86A 3A67H 1R0AH 4AZHA 3ECBB 2AABL 3LN4A 2W9EH 3O9WB 4Q9RH 2DTSA 2H6PA 5J6GA 3ESVF 2BNRE 1OARL 2ZPKL 5ICZB 3QCTH 2PNDA 4PV9A 1N7ML 4I0PB 3CX2A 3DMMD 1F6AB 3GRWL 3SCMC 1DUYA 4XPFL 1NQ6A 3QZWB 3ZO9A 4MNQA 5HPOA 2P8MB 2F53B 1PX3A 1W0YT 3VXOB 3RWCA 2AXGA 5FGCE 4PV8A 4WW1A 4LLUB 4GJTB 1M71A 3F7VA 2NY2C 4GG6F 4RFNC 2OMNA 3SDXE 3WELA 4QF1A 3QDMD 4Z76B 5B38B 1T89C 1NBZB 3FFDA 2XN9B 3QJFA 4HKZB 4RAHA 1QRND 1RZFL 2X8RA 2I5YL 1P5VA 1QSEA 1ITCA 5HYIA 4PJGE 3WCYA 5E7FA 3O9WD 3B5HA 1MHEA 4LSQH 5CCKH 5ID0B 3N9GH 4OAWB 1U2CA 2JB6A 3L95B 2DWEA 1DWJM 1PKOA 1TTGA 3MUGB 5TH2A 3F7QA 4ZENA 4I0PD 4HAGA 1NCBH 4WI6A 2AK4A 5BZDB 4XP4H 2J7GA 4TRPL 3FO2B 2WBJD 2AJVL 4OF3A 5GNXA 3D5OF 3IT8D 2ARJA 1E0XA 1R7AA 3B3IB 5LCVL 3W6MA 4JG0L 4XTRC 3VRIA 3T0EE 3OX8B 4S0SD 1PKQE 4YR6A 2XN9D 1VFAA 2BY2A 5T3XE 2D3VA 5CIPA 4QWWC 3VKKA 4JN1L 1QPKA 4IS6A 1HF6A 3BKCH 3IDMB 1Q0YL 1IGFH 4X99B 3SDDB 3IJHB 4K55A 4R7NA 4HQQL 3PDGA 4XCNA 5FYJD 3W26A 5BRQA 4JPWH 2UY4A 2Z8RA 1W2VA 5C9JB 1GGBH 3H3BC 2FECI 2IG2H 1ODZA 5DMKA 5D4QA 4BELD 3O45A 4DM2A 5DYOB 5DUPH 3JV0A 4OI9A 1E6XM 4PRAB 4R2GD 3DX9B 3VH8A 2P24A 4D0CA 1UB5B 4MNHB 3ZKMC 3KHQA 2PYEB 1A8JH 3TF7C 3WEXA 1LO2L 3OKKA 3RJXA 4I0KA 4TVDA 2CJUH 1RIHH 1MFAL 3OAZK 4NN6C 1XFPA 1KIPA 4JR9L 3SDDD 3DVGB 2DQJL 3EMQA 5DUBA 1YEIL 4OKDA 4QXWA 3SBWA 1GZQA 3C60A 5DTFB 4XNQB 1SHMA 4HZAA 3MLSH 1VPOL 5JNYB 3PQYB 3THML 5BXTA 5CWSB 2ZWYA 2IJ0C 3RVWD 2ADFL 1L0YA 3FRPA 4WU5B 2DBJA 4UV4L 3BZFB 2PYED 1WZLA 5F88A 4GG6A 4KZEL 2L7JA 5DJZA 1NEZG 4Y5XA 3SKOB 2CRIA 1J1OL 4K3EL 4BS0A 2IQAA 2E40A 3LPFA 3QUXB 4ZUSA 1LEGA 1MFEH 2YA1A 2V7HA 5D9PA 3G6AA 4X7TA 3T3MF 2F2HA 2DQCH 2DIBA 4YNYB 3VO0A 32C2B 1S7RA 1FFPA 3HPLB 2QHAA 3O2VL 1T5XB 3TNNA 3TBSB 1KB5A 3RY5A 5C3LD 3PQYD 2WCSA 3MSGA 4YZFE 2GJ6E 3INUH 3QYCA 5FO7A 1YNKL 3ILPB 2R56H 4XC1H 5BQ7B 4JFDE 1K8IA 2NY1C 2VXVL 4XNZC 1XSIA 5A6LA 1E43A 5E1AA 2EDNA 2ERJB 5HVHB 2VLMD 2W5FA 4UNVA 3QUXD 5A2IH 5I1GH 3MV8B 4J12A 3HB3D 4DUWA 1A47A 5LXGH 4AT6A 3AHVA 3ZM8A 3Q3GB 3L5WB 1QNPA 5JW5A 1F11B 4L9LA 5DURB 3L1OH 4JL2A 1N2RA 4N0UE 2VCAA 4GQ9H 5GGTL 4XT1C 1S9VB 4APQC 3GUTA 4E41B 4KI1A 4AD3A 1CFBA 1W0WA 2FJGA 3VE0B 5GXBB 2GJXB 3W25A 3H42L 1CLOH 5D2NC 4PJ8C 3O9NA 3Q5TA 5E8PB 1YEGH 3ALPA 4KQ3H 5D6DA 1TETL 5IVXF 1G0DA 3ULSA 5GZND 2YBRB 4ZSOE 3U4EA 3BIAX 1W9UA 1VJSA 1MUJB 4K2UH 3JWDH 4R7DA 1XGQA 5EZOL 4CD6A 3GO1H 1OTUD 1VAHA 2LABA 1F3DJ 3VA6A 2YN3A 2HFFA 1S9XB 3MV8D 5ISZB 4Q7NA 1CDCA 2R2EB 1B0RA 1XF1A 3GSQA 3WSUA 1PYWA 5DURD 1NBVL 1P7KB 2VDLL 3QRGL 3MOBH 3P0VL 3WQVA 4RGNE 1D5BB 4UU9B 1CK0L 2Z1SA 5GGRY 1MJ7L 1PVHA 3D0LB 1ZSDA 5HBFA 3WXWH 5KSBE 3N11A 3ARYA 1RZIA 5E2UH 5CMAA 2R23B 4M1GH 1JNDA 1MAMH 4YXHL 2HFEB 4J8RB 3HNSL 5C0AA 3W9DA 3BGMA 4JRXA 5C0CB 1S5HA 4DOHB 3HHRB 2WANA 1KN2L 4OF0A 4WEBH 2WAHA 1C1EL 1FHLA 4OD3H 4LSVH 2R2HA 4HC1A 2AXJA 3EHBC 5ISZD 5A6AA 1T80A 3DI3B 3UR8A 5J13B 1H09A 3FQTB 1FGVH 1F3JB 1WDQA 4KC3B 4G6AD 3HI1B 5AYUH 5HGHA 4Y2DB 3D0VB 4U1NB 1H8NA 5EU5B 4Z0BL 2P46B 1AGBB 4YDJB 3VI4F 2N7AA 4ISVB 2EDDA 3WDPP 2V2TB 2KH2B 2Z91A 4ACYA 4DWSC 4BQ3A 1DZBA 3MUHL 1V7NH 4JE4B 4Y8AA 1LO0L 1UWRA 3LD8B 1MFNA 4FG6C 1LE5A 5IB4A 3TVMD 2DYPB 2I9LB 3PWVA 5C0CD 1HI6A 3UTQA 2YUXA 5CEXB 1CR9H 1CT8B 4XHJC 1H8SA 4Y4KD 3IDGB 4POUB 3VWJC 4KMTL 2D24A 3ZE1F 1PEWA 5T1MA 1ZLUK 4ELMB 1OAUH 1E70M 5F3BB 1AD9A 3RUGE 2M2DA 2AEIT 2A0LD 1D9KB 2I60L 4NSKA 1QFWL 1CTOA 4ZXLA 3WFEH 4HGKC 4FQ1L 4UUJB 5HXMA 2ATKB 3CFBB 3QR2A 2X5PA 4OQTA 1YC8A 3ZKMD 5A2LH 5EFIA 4NRYA 5JW4N 3AS1A 1MCWM 2DSVA 1WP6A 2YPLA 4PGEA 1T2XA 1DBBH 5I8OL 5IVXA 4KJPD 3SDYH 1C8XA 2UYLB 2OZ4A 4F9DA 1U30A 4QXGL 2EJ1A 1UWUA 2JEQA 4PMVA 5I0ZA 1JYXA 1HE7A 1HHJA 2NZ9C 2G5BB 4Z7UB 3KPPB 3Q0HA 1A02N 3VFVA 1D9KD 4YO0A 4XPAH 1B4JH 2BHUA 3BMWA 3UTTE 3T04D 3K0WA 3U36B 4PG9A 1HINL 3GDBA 3U0PA 4H5SB 1MH5A 2BFVL 5IQ9A 2YL9A 3KNBA 4MXWH 3LH2L 3QUZB 5HVFB 3DMMA 4PP2A 4YHIA 5DHXB 1N4XL 1BFOA 3OJDA 3F4VA 2MTPA 1BYBA 3VFNB 4G8IA 1AGFB 2DPEA 4FMKA 5D9OA 3TBVA 1HHKB 1BVKB 3BH8B 3LV3A 2OBGA 2WBWB 4UQ2A 1MCKA 1R3HA 2WAGA 4AD2A 3PGFH 1AXSB 5FB8B 3PIQA 3RKDC 4M00A 1S7XA 2DQTL 3WIHL 5ICYB 3LMYA 5I1JL 3ECBA 3O9WA 2K7QA 4J23A 8A3HA 3OL2A 1EEQA 1WAAE 3LCYA 5CKGA 4TTUA 3SGEH 3BWUC 1G9MH 4LVNB 1GGBL 5ICZA 3AHXA 1Q6EA 3OAUL 4I0PA 3CVIL 3O0RH 3U7VA 5EPMB 3QUZD 2VLKB 5EOQL 2BNQB 3QZWA 1H8OA 2WBJA 2P8MA 3I6LD 4POZC 3HMXH 1NGXB 3VXOA 4WEUD 2GEEA 4LLUA 1RURH 1OLZA 2V17L 4Z76A 5B38A 3NMEA 1NBZA 4HKZA 2XN9A 3BW9A 2DT0A 1U92B 1UYWL 4OIFA 2EPMX 2IXVA 2B5IB 5ID0A 5ITBH 1A7RH 1J88A 3MUY1 4YUEH 3GBDA 3ZHDA 5IEHA 3L95A 2WNWA 4M8QB 1WSST 4OF7A 1IKFH 3ALGA 4XXDB 1GPOH 2VLKD 3RX7A 3E2HB 2BNQD 4GO9A 3TFKC 3FO2A 4JO4H 3O6LL 1A7PL 5FGBA 5JOEA 1NCUA 1GCFA 1P9MC 2Y5TB 3B3IA 4UAOC 4ZXBB 5TF0A 3QDAA 4NQTA 3OX8A 3VXPB 4MD5B 4IM8A 3U7YL 4DZBB 3U5YA 1OGAB 5BV7B 3DNKA 4UBDC 1J5OL 1RJCA 3RZCB 3OG2A 3IDMA 4PB9H 3VIGA 4EDXB 5DRNA 4X99A 4TSAH 1YYMH 4XMPL 5HDBF 3IJHA 3SDDA 4NUGH 3SJVE 2BNUB 3H7BB 1OPGH 2APTA 3MRNB 1PDKA 5C9JA 1GGIL 3GKWH 1E4KC 1FJ1B 2OL3L 5DYOA 2X4OB 4D8PB 1DFBH 1PZ2A 3POHA 2WCAA 2EH7H 4PRAA 3MYJB 3DX9A 1QD0A 1WJ3A 3MV01 3WQ5A 1UB5A 2VJXA 4MNHA 2R2CA 4ZXBD 1U33A 2PYEA 1N59B 1GC1L 2NQCA 5E8OB 1OGAD 2DEPA 2WUBL 3TA9A 2XQBH 2JCCE 4EXKA 3DVGA 1YECH 2FX7H 2JJTC 1R3LA 1HVQA 5L2KD 3AMCA 5DTFA 4XNQA 3Q1SH 5INDA 2O93L 1MXDA 4FG6D 2L7UA 5J3HD 5T3XL 4E42B 3PQYA 1BBDH 3LQZB 4Z7WE 4P3DA 5CWSA 3RJDA 2AJ3B 2ED7A 4Q7DA 4DQOL 7TAAA 5EC1B 4WU5A 5EU3A 4D6GA 3BZFA 3O3DB 4OIBA 5FF6B 5JHDE 4CBPA 2GQHA 3NIFE 3W0WE 2BY1A 4GMTH 3LAFA 3QUXA 2X4UB 1X4YA 2CH8A 3QHFL 3VFMB 4Z7OE 4JAMB 4KI5F 4YNYA 32C2A 4MYWB 2IPKA 3GIVB 4XNUH 1DQJB 3HPLA 5K59F 2IBBA 4KHXH 4Q97A 1T5XA 5LWYL 3TBSA 1RU9L 2D0FA 2V9QA 4F3FB 1UUQA 1CFTB 5CZXC 1AHWC 5BQ7A 4AD5A 1SYVB 1QNQA 4J3WA 1ITXA 2V2WB 1X3DA 4F9LA 3W2DL 1A6UL 1XC6A 4ELMF 3MV8A 2WHMA 1G84A 3Q3GA 1DTUA 3L5WA 3ZYIA 1F11A 4YEEA 2IBZX 3ARFD 4JFZH 3GM8A 3VWKD 2E7BA 3DETC 3GSNH 4LCWD 1S9VA 4E41A 3MV7B 4L29B 4I2XE 4RISL 3VE0A 2GJXA 1KF9B 1HILB 2BZDA 2DQUH 2ED9A 2NY4B 1A6ZB 5E8PA 4NC1E 2Z0BA 3HLAA 4LAQH 4AQOA 1S9YA 1CICC 2YBRA 3BN9C 4YHGA 2GAZA 5I71B 5B4MD 1TJHL 1MUJA 2VYRE 4WF7A 5IXEA 4D6EA 3BQUB 3JVGA 2VLJB 1S9XA 4LPYA 5ISZA 5F9AC 1MAJA 1FCGA 3KXFB 4Z7UF 3SKJL 5IWLC 2R2EA 4QY8B 2VT0A 3TBTA 3UTOA 3WF1A 4B3KA 1P7KA 3WQ4A 2DBLL 3M07A 1AP2A 4JDVA 1D5BA 4RWHA 4UU9A 2ORBH 2C3VB 2H1PL 1QG3A 3D0LA 2EDTA 4POZD 4X7SL 3EZ8A 4PMNA 2XICA 2R23A 3S36L 2HFEA 4J8RA 3DX8B 5IFHH 1OL0A 3QDGD 4PJEE 5C0CA 2Z8SA 1DQQB 5FDWB 2RGSA 1LL7A 3L4YA 4KK5D 5F70A 2DQGH 1EFXD 3U2SB 2UUDK 4P46B 1OIFA 4F57L 2FECL 3VRLF 2X70B 4GMSH 1Q6GA 1F3JA 5M7QA 2V3EA 4NZTL 3HI1A 1FAKT 4Y2DA 3D0VA 4U1NA 1FFOB 5EU5A 2CUMA 1DUZB 4L5FH 3MNVB 1AGBA 2X1QA 4YDJA 4ISVA 4UTFA 1V0KA 4J28A 5BRZE 4PYHA 3VXUB 3C5ZC 3HAEH 1OW0C 4S1DC 4MB5A 2F58H 4YFLI 2BVPB 1BF2A 2I9LA 4MAYC 1NCCH 5CEXA 5TPWH 1CT8A 2OR9L 4UIMB 1QFWM 3IDGA 1J1XH 1EGZA 4Y16B 5KZ6A 1I1AC 5IB5A 4P46D 4OGXH 5J06A 4HJ0C 4ELMA 4JM2B 2HH0L 3G5VB 5F3BA 3QHOA 1A3RL 3IJ7A 1D9KA 1YZZA 2NY3C 4N42A 5C0DB 3K4DA 4LLDB 4WHYH 3BGAA 1JFHA 4GW5B 1JZ7A 4UUJA 5BZWB 4W70A 5HYJB 3L9RB 3SGJA 2QJDA 2I26N 3CFBA 2B7DT 3RX8A 2VSCA 3TA3B 3UBXI 1T7VA 2OSXA 1AO7B 3NIGE 2RCSL 4KK6C 3U9PL 1BPVA 2UYLA 5CJQH 3BUYB 4MNGB 5DMJB 2PWHA 4IM4A 2X6MA 4OZHB 2G5BA 4Z7UA 2GK0B 4UFKA 3KPPA 3NCJL 4MQ7B 3P2TA 2NNAA 5T3ZD 3U36A 5ID1B 2HTKC 4HZ6A 4FZ8H 4H5SA 3J8F7 1LJYA 3QUZA 3Q5OA 1BGXL 3BKML 3VFNA 1FIGL 1AGFA 3TJEL 1AO7D 2VR5A 5JIIA 1C93A 1BVKA 4WKHA 2X0HA 3BVNB 3BH8A 3GXIA 5F9WB 4MQXC 5F7UA 2XZCH 3VFGL 5D1XD 1EO5A 1U3HB 2BX5A 2ZKHH 3HC4L 1T7YA 4AEHL 5ICYA 3RL2B 3I6KB 2VR9A 4P2OB 1EERB 4WI8A 2YSSA 1KB3A 1FG9C 2PR4H 4LP4A 1NLDH 1CPUA 3N85L 1K8DB 4XCFH 3CLEL 1UZ6E 2OJEB 3RM8A 4R0LC 1J0YA 1BAFL 1I3UA 2VLKA 1JNJA 3VGHA 2BNQA 4D72A 2K7PA 2RJMA 1IARB 3BXNB 1HYRC 1NGWB 4JFSA 4YHZL 3EO1B 4OFVA 1NGXA 3ZE2E 5FYKD 1TA3B 1UFUA 3RGVB 4E9LA 5DJCB 4KJQD 1E4JA 4RWYH 4HK3J 2CKRA 1BFSA 1I8LC 4U31A 1U3HD 5IQ7L 2VO5A 3O4LB 2FEEI 1ISXA 5CSUA 1TVHB 3V0WH 2OSWA 1SM3L 4CCCA 2XTJB 2OYLA 2N56A 2NCMA 1SMAA 1MNUL 3KWWB 5E5MB 5ACLA 4NN7C 3NIDF 3JUYA 4TNVF 4Y19E 4BQ8A 2OK0L 1WC7A 3LN9A 4L4TE 3VG0H 4XXDA 3GMQB 4TNWF 1KCRH 1CICD 1J86A 3LS5L 2A6KA 5GS1B 1T5WB 1H1NA 3RGVD 5FGSA 2Y1VA 4KMLB 4ZXBA 3RP1A 3L6FB 2P47B 2FLBT 4UQBA 3VXPA 4MD5A 5J9PB 4DZBA 1BOYA 2VE6B 1L0XA 3KLDA 1OGAA 1QI0A 4XPBH 2NW0A 1P84J 5I1AB 3SDAD 3RZCA 2XZZA 4EDXA 2XRAL 3HG1E 2XTJD 1T83A 1HH6B 2Z9TA 1HJQA 3H7BA 1H0IA 4RRPA 5LA1A 3MRNA 1E4IA 3W4RA 3RVVD 4D8PA 4NQEE 2DJSA 1U93B 1T20B 2X09A 3QULB 1I9RH 3HFML 3BD5A 1KCSH 4D0DB 1FSKC 4JO3L 3VMPA 2P43B 1NCAH 1LK3H 2IAMB 1N59A 3L3OA 3I9GH 4PBXA 5FCSH 3TCLB 1JF5A 2WWMD 1DQML 5EU7E 2JEPA 3U5UA 1PJ9A 1ZHNB 2R29H 2VDMH 5JOFB 3VXME 3L3IB 3KPQB 4JFHE 1QSFE 4PRHB 5SX4I 1PG7W 4JG1L 2ZNWA 2C9AA 4KTEH 3GSUA 5ESVB 3E6FB 2APWA 5D7JD 4S1DD 5F7KC 1U2HA 2BJML 4H8WH 1CXFA 3VGAB 1A6VH 3KL3A 5EA0L 2PBOA 3OGOE 3LQZA 4P4RB 1HVXA 1ZXQA 1KR1A 3L3HB 1FGNH 3N12A 5GNYA 4H41A 2AJ3A 2AI0L 5EC1A 3CXDL 3MS8A 3VD5A 3O3DA 5FF6A 4EQ2A 3D87B 1BX2B 1LEKB 3ULUF 1DEDA 3UYRL 2OJZH 4ZFMA 2QQLH 1TLKA 3RDTB 1DE4A 5DEGB 3MLTA 4L4VB 5DK0B 2X4UA 1FVEB 4G9FE 2GW5A 1MWAB 2VZUA 5D7SH 1HX0A 3VFMA 3PZQA 4B16A 1H15B 2FCBA 4JAMA 1JHKL 2VOTA 3CH1B 3ARFA 12E8H 1FNSH 1S78C 3OAZH 4WGVB 3ZJ6A 2M8XA 4LSUH 3VWKA 3V95A 3GIVA 4MXVE 4CU6A 1DQJA 3GYCA 2HT3C 5FA3B 3N1PC 4F3FA 4NHCH 2GVYA 3JWOH 2MFNA 1CFTA 3KJ6H 2BY3A 3RA7H 3THDA 1SYVA 4CU7A 3VIJA 5DD5H 3HNTH 4ZTPL 3WD5L 2V2WA 4MJIE 2AEPL 5GISL 5LGHL 4K94H 4LRNH 5E00B 1E5JA 2DM7A 4M1DL 3O6FB 3RWGA 4DK6A 5I19L 2EDXA 4PTMA 4JM2F 3L7EB 3MA9L 3LDBC 1ZA6A 5GRZA 3PZMA 4NZRL 4F7PB 4M6NL 3SCVA 5DD3L 3T2NL 4OCMC 5D1QB 1EOMA 4DAGL 2VDNH 3SGKC 5E95B 2EQDA 1E28B 3MV7A 3EBVA 3H7LA 3ZR5A 3CXHK 1V3JA 1HILA 4GSDH 4K23H 3O3EB 3WFCH 3CC5B 3WD4A 1A6ZA 4HSQA 4KRNA 4PJHE 2PTUA 5T1LB 4TSBH 3QDGA 5ALBH 4PG2C 3REVB 1HT6A 3TIDB 3IJYB 2CRMA 2AJZB 3K2MC 2PYFB 4W4OC 5DT1L 3FNDA 1RZ7L 4PTWA 3EO9H 3CFCH 1IRAY 3O6FD 5IF0B 4OZHF 3KXFA 1VFFA 4N0FB 3CSBA 2Y06L 4QY8A 1KQZA 1UADC 2FBJL 1MEXH 3VMOA 2J62A 1RUAL 3BIKB 5E4EB 5A6SA 3GK8H 4D3CL 2E7LC 3E8UH 3B8SA 4BQCA 1PG7X 5D1QD 4M56A 2C3VA 1S7SB 3L7FB 4JHBA 2CHOA 5GGSY 1SEBB 1UH4A 4X0KB 3GMLB 4PJ9B 4Q9BA 3QI9B 2QLVB 3UXFA 3DX8A 3CZEA 1DQQA 2WKGA 5CZVH 5FDWA 2J7CA 4RE4A 1EO7A 4X6CE 1S3KL 2F9BT 5EFDA 1FNFA 3HPJB 3U2SA 4WHTB 4P46A 2Y7QA 2X70A 5FOBB 4ZG1A 3WH9A 1BQUA 1VGEH 3RHWF 2D4DA 4LK4A 1FFOA 3CGTA 1DUZA 3BGFB 1DQLH 3MNVA 2XWBB 1KN4H 3L2MA 1XGZA 4MADA 3TT3H 3VXUA 4Z8FL 4PJ9D 3QI9D 3V52H 3PZ9A 4GRLB 1KCUL 4MDIB 1GOHA 2BVPA 3TH2T 4OB5L 1MQRA 3FHQA 2JIEA 5E2VL 4UIMA 4YBLC 3WNLA 5HI5C 2DDQH 1DBJL 4Y16A 1IC7H 3CU7A 2B4CH 1EXUB 3O6MH 3BSZL 2UY5A 1W72L 3BISA 4JM2A 1FPTL 2FJFB 4A6YL 4HFUH 4HBCH 1XGTB 4HCRH 1FFQA 5M95B 2HFTA 2Q8BH 2E9WA 2ZCKH 1UWSA 1BGAA 4JY6B 5C0DA 4U7SA 4LLDA 2JK5A 5DC9B 5BZWA 4PBWD 5HYJA 4X5WB 5D6CB 4BQ4A 2FD6L 4GRLD 4KDVA 5ANMB 4QLJA 4Z2KA 4P2RE 3N13A 2CLZA 3NH7H 4M6OL 2XVLA 4UNTA 1GGYA 1AO7A 5SWSE 3SE8H 4EZMA 3D3VE 4AZ8A 5KVFH 1MQKL 2MJWA 3BUYA 3ZTNL 3GHEL 3IFLL 1YUHB 5D1XA 4LARH 4HWBH 4ZTOL 4XVTH 4PJCB 1ZVSB 2GK0A 1H4PA 4MQ7A 2WW5A 3DYOA 1C08B 1ZLUH 2CDFB 2AJUH 1X5AA 3IETA 5ID1A 1E4MM 4JFPB 2F8OA 4KK8D 3HE7D 4H20L 4P5TB 4XP1H 4GAFB 1DBKH 3BYYA 4PREB 5JXEC 5C8BB 1UACH 3FT4B 1ZLSL 3RWIB 3S2CA 1RUML 2CUHA 4DWHA 1ZT7B 3BVNA 1LL6A 3N1MC 3SCPA 3CFEA 1NGQL 1U3HA 1E3XA 5L0QC 1YMMD 2AEQL 5A95A 1F58H 3ARZA 4MA7L 3U0WH 3GTNA 3RL2A 2GTZB 4H1LA 4Z2IA 3I6KA 4F15B 4P2OA 3WDQA 1MIML 4I77H 2W65B 2HG5A 3DROB 2QKIB 2HT3D 4QRTB 5AWNH 3QO1B 4UB0L 4PLOB 3LEVL 5MEND 4TOYH 2CDEB 2OJEA 4P5TD 4XCCL 1HJUA 4JFYB 1NGWA 4NKMB 1VFMA 3BOVA 1YHTA 1OTTD 3PNWB 1S9WB 4YFDB 2CBUA 1XR9B 1TA3A 3UCQA 3RGVA 5DJCA 3ZYZA 2XWTA 1NAMH 2ZUNA 4C57C 4JFVA 5F7NC 5T5FH 4PRIB 3NFNA 3ZKND 3O4LA 3IGAB 4JPKL 1AXTL 4KTDH 1TVHA 2O5ZH 2VKWA 3I3DA 4FQLL 5C7XH 3WUBA 4P59H 1JI1A 4DK3A 3VFSB 3B9KC 2D0HA 4YAQB 5E5MA 2VUYA 3TWCH 3WMBA 3WEZA 3PWUB 4HF5H 3BPOB 4KK9D 5HHOE 1NARA 1LWRA 3D2UB 1PPIA 3GMQA 4Y7MA 1K3ZA 2WUCL 1C90A 5F9JB 5GS1A 4AD4A 1NH6A 4V28A 1T5WA 1UT9A 1FNHA 4WSJA 3N06B 1W0VB 5LA2A 3U7AA 1BZ9B 3L6FA 1NCDL 4EDWH 3I2CH 5HD8C 5J9PA 3WD3A 1CXIA 2VE6A 3VXQB 4U7MA 4FP8H 1NAKL 5I1AA 3D1MC 2LV4A 2HJFB 5TDPB 2DLTA 2IC2A 4EKJA 5IESL 4MAVA 5I24A 3MLXL 2ICWI 3MLRH 1HH6A 4CN4A 1GAFL 4UT9L 1V5JA 1IL1B 3QHZL 4Y5VC 3WN5B 3QXWA 4JFEB 1GC1C 1YY8A 4PJDE 4U6YB 3X11B 1DCLA 3MRKB 5E2TH 3GZAA 3QULA 4KROB 3VNYA 3IF1B 4ZFGL 2C3GA 4D0DA 2G3MA 1HXYB 4FQPA 5JPMB 5F93C 1T1YB 1FRGH 3LY6A 4XVSL 2IAMA 3FQXB 4AEIH 3X3FL 5D7LB 1B3JA 3TCLA 3VD7A 1TZ7A 4NI3A 2JF7A 4WO4D 1EHLH 4NHUB 3MU7A 5KG9B 1EPFA 2AJXH 2J6EA 3T0EC 1ZHNA 5HGDB 5JOFA 3L3IA 2EDKA 3KPQA 5FCZA 1VFBB 5I8KL 2Q86A 3WJJC 1OWWA 5ESVA 4N8PA 3E6FA 4PGDB 1MY5A 3KPRE 4HLZH 5IHUH 3CHDA 2VDNL 5FM8A 3KWXA 1YEEH 4ERSH 4P4RA 3IKKA 3L3HA 4QOKE 3MQIA 3NZ8B 2AEWA 3EFDH 3KLHC 5HI5D 5C0FB 1YEKL 2IH1A 1YQ2A 1M7IB 2XGIA 1BX2A 3C5JB 5D7LD 3RVUC 3RWEA 2WLZA 3RDTA 1SEQH 4RMUA 2F74A 5DK0A 3LOWA 1FVEA 1MWAA 1I7RA 5DJ0B 3N50A 4Q9QL 3APGA 1H15A 5DJDB 4BH8B 4GRWE 4HKJB 1NWTA 1AR1C 3ABZA 5BMFH 3D39B 2X1OA 5CSZB 2R0LL 3BPNB 4UOJA 3S3JA 4JRYD 5D8JH 5F7EH 5FA3A 4POYA 1GQIA 3IJ9A 1FG2B 5E0CA 1QBAA 4OV6F 4Y7EA 1OSPH 2VLLB 1G6RH 3BDXA 5MEQA 4L3EE 5A8QA 2EDEA 1JGUL 4WU7B 3WXVL 3NAAL 3O6FA 4S3JA 1AE6L 1KIQB 3L7EA 4EBQH 1A3LL 3A6OA 5JZ7D 2R1YA 3FO0L 1QSVA 2QADC 4XBGB 4HIXL 2Y25A 4F7PA 3BE1H 2VZ3A 3GBML 1IGMH 3IU4L 4IIQC 4KZDL 5D1QA 2R69L 4NZUH 3AHZA 2UWEF 5E6IB 3QCUH 1E28A 4P3CH 1BJMA 3MUJA 3CC5A 2FEEL 5T1LA 3N9KA 4L8DB 3I3BA 4HU0A 3REVA 2X4TB 3TIDA 3IJYA 3VIPA 2KKQA 2AJZA 2PYFA 5I2UA 5D7IB 4WI9A 5IF0A 5J6HB 3OLGA 4PJCF 1DVFC 4M24A 1QSEE 2H32H 5BVJB 1JNEA 1E4XH 3WH5A 3LKSB 3BIKA 2IPTL 3BT2H 6FABL 1T04A 2FB4L 2HLAB 3ZSTA 2W9LA 1IGYB 1S7SA 1UWXK 3L7FA 4WNQB 4HT1L 1U8IB 1SEBA 3HAEG 1AI1L 1P7HL 4PRWA 3GMLA 2G60H 1GHFL 1UXSB 3WS6C 3EMCA 4PJ9A 3QI9A 4NC0B 2AK4E 3MRPA 1A2YB 5IBTH 1VGKB 2ZXQA 3MODL 3UPAA 1LQSR 2YK1H 1GW1A 4F9PA 4WHTA 1H3UA 5GJTH 1QTYT 1JDDA 4C54A 5A16A 1JZ5A 4N0CD 5FOBA 5TQ2H 2HMID 2WMIB 1UD3A 1V8HA 3HC3L 3PZUA 5C08B 4WHYG 4W8AA 4JQIH 4Q22A 1C7SA 1K5NB 1XIWC 2EO9A 5D70H 3ET9F 2XWBA 4EI6A 1EQPA 4FXKB 4WSKA 3GZKA 2NLJB 4RGNC 5TE7H 2NY2B 4RFNB 4GRLA 2VKXA 3QNXB 5FHAH 4MDIA 5HD8D 4F66A 1HKLL 3SO5A 1IGIH 4GRWH 3SQOL 5HTSA 4FZEL 5F71A 4DKFH 1EJOL 3FO1B 1EXUA 4X9HA 1G9MC 1I3RA 4AZ5A 1TR1A 3CUPB 3IDUA 2FJFA 5EU6B 1QEWB 4BJLA 1J0JA 1XGTA 4G8GD 5ALCL 4ACZB 2YLLA 2UUDH 5C08D 4JQVC 2VLRB 4JY6A 1QFUL 4N1EA 1NOWA 1YYLL 5CZKA 1RIVL 4LPVA 3QQNA 1RI8A 4X5WA 4LFHD 5D6CA 2EXYD 1NGZB 3Q2CA 2YL8A 1FCCA 4FK9A 5H94B 5CEZE 2FHCA 3KLAB 1ZANH 2R4RL 3V8OA 1HZHH 5D96C 1VRXA 4GG6E 3T0ED 3IFPB 1ADQA 1JPTL 3DIFB 3O3AB 4FNLH 4QRRB 1YUHA 1UA7A 1YMMA 4S11A 2DTMH 2FGWL 4PJCA 4PY7B 1JUFB 1ZVSA 5T1DH 3N17A 4KKAC 4KKBC 1FH5H 1JDAA 1C08A 1JWMB 1FYTD 4QRPE 3EOAB 4ZS7H 1I3GH 2CDFA 3RZWA 1XH2A 2HN7B 1QW8A 1L7TL 1OT2A 2E3VA 4JFPA 1TG7A 3NDYA 2PCPA 2BRRH 1WWCA 4P5TA 1F4WH 5GS0D 1SY6A 1AQKL 5M03A 4PREA 2EC9T 4OGZA 4MS8D 5FHBL 1CZ8L 5JPNB 1NSNH 3FT4A 4GZJA 3RWIA 5ELIA 1EZVX 3ZTJG 1ZT7A 3BKJL 5AYIA 1RSFA 4MPKA 3IDNA 1QI4A 1WKYA 1EAPB 3HZKB 3QPXH 5A3ID 1E6PA 25C8L 3PL6C 1ZA3B 2W65A 3DROA 4GKNB 2QKIA 2ADGB 2EEBA 2X2YA 4QRTA 3QO1A 1FE8L 4ODHL 3QIWB 5F96H 5DJ6B 4PJFB 1G7PB 2CDEA 1LHZA 2IGFL 1MVYA 3VDAA 4DCQA 1TQCC 2GJPA 4JPVL 4NQDD 4LSPH 1FQ9C 4PJ7F 1VKXB 4JFYA 4NKMA 2F8VA 4UOW1 3PNWA 3CNKA 1S9WA 4WCYL 2J88L 5C0GB 3A47A 3FFCB 1UA3A 3DSFL 2ZWZA 3KS0H 4XP6H 4WENB 4G80B 2EDWA 4XWGL 1OBAA 1X5ZA 4PRIA 2WVVB 1SBSH 4C7GA 3IGAA 3L3JB 3QEQB 2XWJB 1TUXA 3SOBH 4F7MB 2AV1B 2W07A 1SVCP 5CINL 2Z1KA 4PJIB 4KQ4L 1K2DA 4OM1L 2BVEA 3VFSA 1F4HA 1ERNA 4YAQA 3QIWD 1UM5H 1KLGB 3QIBB 1IC5H 3EJJX 3PWUA 1CFVH 1LO3L 3C6LC 1FP8A 4C56B 3AXLB 2NY1B 5I1KH 4JCLA 4XNZB 3LEXB 5JXAL 5F9JA 1CDUA 4H0HB 5F3HB 1ISWA 1VEPA 1W0VA 4TNVK 4CMHB 3FFCD 1YN6B 4MAUL 1MFVA 5C0AE 1NOUA 4DKAA 3STBA 4JRXE 1BZ9A 1XF3B 4TNWK 3FQNB 1B3YA 1A7OH 1N0XH 3KDMB 3VXQA 1UZ8B 3HKFA 5F8QC 4EUPH 3QT2A 4MDJB 1D5IL 1XF5B 3RTQC 3VIFA 4APQB 4UMGA 4C4KO 3PUCA 5I73B 1NMCC 3RNKB 2WMGA 5CEZH 3PP3K 3V6FB 2D1ZA 1L6XA 2I07B 4R4FH 4EN3C 3VNZA 3QIBD 5KSUA 3P4MB 5FA4B 1J8HB 5J7CC 3OZPA 4BQ2A 4U6YA 3BH4A 2O61A 4PMQA 1JVKA 3VGFA 3MRKA 2H8PA 3QQ3B 2IUZA 5D71H 2WC7A 2QSCH 1HXYA 1UD6A 5JPMA 1T1YA 1CIDA 4XNXL 3D5HA 3FQXA 5DQDH 2MOVA 5D7LA 2KQMA 4FXLA 4L8SC 2G3JA 1JF1A 4WRLA 3MV9B 2XGBA 5HDLA 3AICA 5D7IF 2G75B 4FTVD 4NHUA 4XWOC 4NRZB 4Y4HD 4NYLA 4W7VA 3ZQ9A 1MHPL 4CW1B 2D7TL 3TZVC 3ECQA 1MCOL 3RBSA 4KKCC 3BKYL 4HAFA 4QHLB 1S7UB 4KDTC 5HGAB 4PGDA 2PO6C 2VIRB 1PW3A 2EDHA 4JRYA 3KAAA 5CILL 3ALFA 4AIUA 2WQRA 4F7TB 4JKPH 1UR2A 3NZ8A 3MJ8B 2ZOLB 4FHBD 2YPLE 4GUPB 2FH8A 5IVXE 2CUIA 1M7IA 4I8DA 1KC5L 4HUNB 1NWSA 1CVRA 3MX0A 2RFXA 4YX2H 4PLKC 1VBRA 4YHYB 3GSOB 5DJ0A 1FYHB 3HR6A 4BH8A 5AZ2H 3L5XH 3PWPB 3C87A 3LIZL 3D39A 5FUZH 4OLUL 1QHOA 5CSZA 4XMLL 1A4JA 4LGXA 2OLHA 1GHRA 1FG2A 5D5MA 3WHE1 1PG7H 2X44D 3SGDH 1G7MB 2VLLA 4AYSA 5DJ8B 2IFFL 3VWJB 2AV7B 3B9VA 5HI3D 5C0NC 4HP5A 3C09C 4KV5E 4WU7A 3QDME 4KKBD 1KIQA 3RIAF 1QRNE 4R90L 2GDUA 1TTFA 1URLA 1RP8A 4HUUB 1FP9A 3PWPD 3ULVH 5L88L 4JQIL 2CQVA 3W5MA 3VI4E 1PY4A 1EDGA 3UC0L 1D5ZA 4NWTH 5DGRA 1DWGM 1MCPH 1ZBWA 4ATLA 5CLTA 5BS0B 5DI8B 1KBGL 2YD3A 4XVJL 1E6RA 3DYMA 1A7NH 4L8DA 3PV7A 1TZIB 3IRPX 2H41A 4I3GA 4XPGH 5JUEL 1KJVB 4LDEB 5JW4Q 5D7IA 1EH9A 5J6HA 2XN9E 1ZS8A 3MLYL 4LLYB 4YPJA 4Y0GA 4LL9A 1YN7B 4K68A 4Y4FC 2OMBA 1QVBA 3L4XA 3LKSA 1QVOB 2C1PA 1NUFA 1WDSA 2HLAA 5FYJE 2V5DA 1AXIB 1U8IA 1UXSA 3P11L 4AY0A 4JREC 5GZOD 3IS1X 4LEXH 2EDOA 4PLNC 1XD1A 3ZL4L 1A2YA 3IAPA 1T66D 1ZEAL 1VGKA 5L7XH 5F97E 2X41A 3CVHL 3MCLL 3SDCD 5BJTA 4U49A 4S1SH 1MFBL 4NC1C 4WY7H 4PJBB 3HMWL 2FATL 3PTMA 5KJRL 3BHBA 2WMIA 4OQTH 3G5XB 4LHQB 1X5KA 4ONFL 2JF6A 5C08A 2NY0C 4OCXH 3FB5B 1WFUA 2BFGA 3EYQC 4P7QA 1CBGA 5C0IB 1S7WA 2H45A 4O5LH 1K5NA 4PJFF 1ZS2A 1D6EB 4FXKA 2VC9A 4WKFA 3S34H 2NLJA 1SFSA 3RHWK 4W8LA 4KRMB 3QNXA 3AUVA 4TQEH 4PP1C 1NSNL 1Q0XL 1U8MB 5JQHC 4FABL 2IQ9L 5D93C 2WMKA 3OXRB 3WNNA 4ORZC 2VXUL 1Y7VA 2PYEE 3AREB 5CJXC 2CKNA 3FO1A 4DTGL 5DQ9B 5KAQG 1D5XB 1VADA 3CUPA 5EU6A 1QEWA 4EN3D 2FLRT 1JGLH 1BG9A 1EIBA 4ACZA 1AJ7L 4WI5A 4PJIF 3S98A 4LDOB 2QSVA 4ODSH 1FLRL 1HHHB 2AAVA 2VCBA 3VIOA 4TUJB 1OP9A 2CDGA 4UAOB 1EGJA 4YH6A 3RJYA 4LYRA 2DT2A 5C6WH 1HKFA 3PQYE 4X9YA 5ESQB 5JO5B 4D6FA 5H94A 2J7HA 4AW7A 1UCBL 3KLAA 4AEEA 1MFDH 1R3KA 1GJUA 1BVZA 2DQIL 1ZB5A 1CNVA 4NRSA 3ARED 5ERWB 2VXSL 3IFPA 3O3AA 3DIFA 4ZFZB 1E6ZA 1BVNP 4N90D 4WWID 4RE2A 2VLME 4PY7A 4OLWL 1JUFA 1CLYH 5CSGA 4CD8A 2DH2A 1BTCA 3SJVD 5IROA 4J3OC 1JWMA 1YNTB 3EOAA 3O8XD 1CL7I 3QWRD 2HN7A 1VA9A 3QG6A 5GSVB 1E4WH 1N0LA 3IXAB 1IKNC 5J12C 2XIDA 2WWKO 5EBMB 4PB0H 1T0NB 3G6JB 4K8RH 4NQDA 3MXVL 6TAAA 5C0RH 5JPNA 3F5KA 2NY7L 4HMDA 1ED3B 2E8ZA 1GPFA 4UV7L 2EH8L 4RE3A 1F8TL 4NM4L 1P84K 5CQ1A 1R87A 2YPKA 1XH1A 5BROA 5MP6H 3TT1L 5BVPL 1EAPA 3BAEH 3HZKA 1RZGB 3HAEB 1MRFH 3HR5B 4GKOA 1JMZA 3AVEA 1XGRA 4JKWA 4QHMB 3ZDZF 4X98B 4LP5A 1BJ1J 3MV8E 3PP4H 3P4OA 4HUMB 1ZA3A 4GKNA 1SJXA 2MNUA 5HDBE 4OUOA 3X3GH 3UEQA 2ADGA 3LVEA 4PMYA 1G7QB 2BOBB 3T0XA 3QIWA 3MRDB 1DDHA 5DJ6A 4PJFA 2QQNH 5I1HH 1MJ8L 4WFED 3BPCB 3I75B 5HDQH 2AS5M 1NFDB 3OSKA 2UY3A 1VKXA 1W1TA 4IDLA 4NKQB 4RFOH 2BP3A 5E2JA 2BVOB 4U33A 2OTPA 4GO8A 5C0GA 2OXHA 3NSXA 3FFCA 5DO2C 1K6AA 4M48L 1WZAA 5D2LB 4H04A 4JFOB 3QEGL 4M7JH 2VDOL 4G80A 2P5WB 3TN0C 4DVRL 2MPAH 4KAQL 2Y23A 2WVVA 4O02L 3QEQA 2JLLA 3OJMB 4M9OA 3HI5H 4H8WC 2AV1A 2O5YH 1KB5L 4F7MA 5I15L 5ISZE 5TE4H 4GRMB 1HKJA 2RTSA 2DL9A 3PTQA 4YDKH 2R8SH 3T3PE 2N1KA 3RU8H 3LS4L 3QIBA 4XXCC 3FCTA 4W85A 2FGZA 1OD9A 4CL7A 1U8JB 4P8VA 1KXQE 1CXHA 2B2XH 2Q6WB 3AXLA 4XP9L 2HKFH 3LEXA 4K71C 4ZOEA 1GRWA 4Z95L 3WE6B 1V6WA 5F3HA 2JB5L 5L6YL 4NWUH 1YN6A 3L4ZA 5C0CE 3FTGA 4N9GB 4DOHE 1A6WL 3FQNA 1J9YA 2P5WD 3KDMA 1UZ8A 5ADPL 4CMMA 2ZJSH 3BYTA 3S5LG 1K6QL 4Y4HA 4MDJA 3T2PA 1XF5A 5JIKA 4APQA 5T33H 4FQ2H 2YRPA 1P69B 1OVZA 3RNKA 2CBIA 4PUDA 5E09A 4H88H 3SCWA 2I07A 2XWEA 1ZT1B 4NP4L 4RMTA 1OD8A 3BWAB 5FA4A 5FKYA 1J8HA 1E1FA 1PSKH 3CFDB 4JN2B 3LB6D 1TJGL 5L9DH 1OAZL 1ETZB 4K94C 1H49A 1A1MA 3EAKA 3MZTA 4H0IA 5I1EH 2J7EA 4WJXA 3QQ3A 5EUKB 2B0SH 3W81A 5SV4A 1B0GA 1ZHLA 4HOXA 2J5LC 3MV9A 2G75A 1G7JB 2NY0D 4NRZA 2NY5H 3EYQD 4AC1X 4CW1A 4X4XB 1K4CB 1KR0A 2I27N 3AXXA 3HMXA 3GNMH 3QEUA 4H25A 1MCJA 4PTUB 3NCEB 4WW2C 1YJDL 1S7UA 5HGAA 2EIEA 4TVUA 1RMFH 3VXSB 2VIRA 2KDGA 4PP1D 1EK3A 2VX4A 9CGTA 1ECEA 1W2KT 5DRZB 1WQVT 2HYMA 4K7PX 4GZEA 4GI9A 4HC1L 1IAII 1OAKL 2D3NA 2ZOLA 1A7QH 2P42B 1I8IB 3SCUA 2FSEA 1KT2B 3C2AL 3SE9L 4NKDB 5E70A 3D85D 3BCFA 1IT9L 1X9QA 1LL4A 4PJBF 4J27A 2Q76B 2WMPA 3GSOA 4Z7UE 3BD4A 4JZ5A 4HS8L 3PWPA 3C5ZB 4S1QL 5EU7C 1NCWL 3KPSD 3QQ9C 4GLRI 4M5ZL