4MB5A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag5
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
total genus 172
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb5A01
3MOQA 5F88B 3F12A 2R2HB 3MSPA 4HUWB 3H3KA 4LQFH 2W91A 5C0DB 3OGRA 2VSDA 1WICA 4Z7OF 4LXFA 1PG7L 4H20L 5DRZB 3PE9A 3WDRA 3INUL 4F7MA 1SEQH 4IRZL 4KU1A 1XMWA 2GTZA 3VJ6A 3CMOH 4DGVH 1CU4L 3KS0H 4MJIA 4AD0A 4F15C 2VITA 3HE7B 5ADPL 4M24A 3OHXA 1PY9A 3NFSL 1ES0A 4HIEA 4JHAL 1BYAA 3EMCA 5CJOL 5FA4B 4IOIB 4X7SH 2WQ8A 1E6RA 2DLFL 3QRGL 5D6CA 4JFHD 4LLUB 5IROA 3U9PL 1KEGH 1J8HD 1SHMA 2Z93A 2A74A 3PDDA 5D7SH 1G01A 3FFDB 4HEME 2CDGA 3W0WB 3WFZA 2ATPB 3MV01 4JVUA 4HZLB 3ARZA 5GGQL 1R5VA 4IOSD 5E99L 1XF2A 2CIPA 4KKLC 1S7TA 1H3WM 3UETA 2IPUG 2DQCH 2FJGB 3P0YL 3LKSB 1K3IA 4JFQB 4K3DL 3DC0A 1R24B 3FO1A 3TTYA 5IW3A 2NZIA 1NEZA 1PG7H 1A7PL 3P73A 1WDPA 4UFIA 2IH3A 2A9NL 4ZNEA 3INUH 1HHIA 2V2WA 2PW2A 4DGIL 4GKZB 4IRZH 4AG4L 5D5MF 4HU0A 3NTCL 4PJFA 4HZ6A 4N8VG 1CU4H 3TO4A 5KTEH 2CRYA 3U9UB 3TFKD 1F90H 3CVHH 2ICWB 3NZ8A 1VSCA 5ADPH 1UC6A 3TNNA 1Z9LA 1EZVX 5CJOH 3AHTA 2X4SB 5AWNL 2DLFH 2X1WL 2XKSA 4GRWH 2JK5A 3FQWA 1EAJA 3CCHB 3U9PH 3VGFA 5J06A 2HTLD 5IDIA 3UTPD 1SQ2N 3UBXI 1N64L 3D3VE 1OL0A 3QNZA 3DGCR 1OTSC 5A6BA 4NZRH 5C0NC 3OXRB 4JFYB 4POZD 3CFKA 1HOCB 4DUWA 5GGQH 4MQXC 5E99H 4GSDH 4N5EC 3OR6B 4KDVA 5CJXC 3OLDA 3B9KA 3QEQD 3IJYB 3FN3A 2OLDA 4K3DH 4OLWL 2HJLA 1VACA 1PDKA 2EE9A 3GJFA 1Q9OA 4D2NA 3MV9B 4HCRA 1KWKA 1QBML 1MRFH 2KUTA 3W25A 1Z5LB 4Z7OE 1CCZA 2PO6C 3U7WL 3GSOB 4HMCA 3AHVA 2IANA 3OJDB 5JIHA 4YDJB 1V3MA 1CLYL 4CN1A 1OSZB 1PKOA 4FQPA 3MNWA 4C59B 1IGML 5EFIA 5DGRA 3NH7L 1SM3L 3S4SA 4L8SC 3MRIA 3AZTA 1Z0MA 4HC1L 3GZKA 4IIQC 4LAQL 1US3A 3BP5B 5LAXA 1XH2A 3WELA 2AXFA 3RWCA 4MDOA 5SX5H 5JHDD 1LDPL 1E3ZA 5FK9A 1JGIA 5E09A 4NQXB 1U8LB 3ET9F 3Q5OA 5GZND 5KVGL 1VAHA 5FOBA 2EDNA 1A4JA 4GQRA 2DT2A 4I0PD 3S2CA 4D6DA 1C5BH 1IAIL 4P2QA 4DZBB 3JWDL 4OLWH 4LIQH 4H5SB 2V2XB 1L0QA 1P7QB 2W59A 3B9DA 2W63A 1H0IA 1ISVA 3BQUB 4HMDA 2XKNA 3GSVB 1MFAL 1BQHB 3HMCA 4WUUD 2CR3A 3U7WH 4JDVB 3T0BA 1WC7A 3PWVB 1CLYH 1HINH 3VX0A 5IF0B 4JFHE 4JZJA 2XM1A 4XP9L 5D5ME 4OV5A 3FONB 1XV8A 4MD4B 4L8SB 1B4JL 4PJBB 5C7XL 3NH7H 1A3RH 4IIQB 1SM3H 1JGLL 3IS0X 4RNRB 3D85A 5ANMB 3BH9B 4AZ8A 1V5JA 4LAQH 2HTKC 1IM9A 2NW0A 4GMSL 2OMNA 3QIUA 1CLCA 5J9PA 3N0PB 3IETB 4PRNB 1HEZB 1LDPH 1AXIB 3QZWB 4OF3A 4YXLL 3MTRA 4O9HL 2GYSA 4EUPB 1ZGLM 5TH2B 5I2UA 5KVGH 1XCTA 3QCUL 3WFLA 2DQGL 4NQDA 4APQA 5D1XC 4OZFA 1ESWA 2B2XH 4YBQC 1JPGB 3JWDH 4J1UB 5B8CA 2BCKB 1DEEA 5KJRL 1GUVA 2VX6A 3AIBA 1Y6KR 3QH3A 1MW1A 5T3ZL 1MFAH 5CZVL 3KXFA 1LQSR 5GGTA 4AEIH 5FGCB 5I2IB 3M7SA 4PJIF 1HH6B 1UWRA 3NCMA 5EMYA 5F7NC 1FA2A 3LN4A 4Y5YA 1FPTH 3NIDF 3B43A 5C7XH 3BUTA 4HX1B 5I6XC 2VQTA 5D7IB 3UTSE 4DFIA 3ESUF 4YXHL 3A6BL 2CSPA 4TOYL 5ILTL 4GMSH 4PREA 4BJLA 1PPIA 4NO3A 1YEHL 4J8RA 1X5JA 3KPMB 1MHEB 4DM1A 2DJSA 1UA6L 2D2OA 3QEQE 4O9HH 4U4BA 3C08L 1D5MB 5D1XB 5BRZA 3JTTA 1YEEL 1T6WA 4GXVL 4EXPX 3WMSA 3AMDA 3UO1H 1PZ5B 4TUJB 2E5EA 2V7HB 2I9LA 4LHQB 4XBGA 4Q0XL 3VOCA 2X4PA 5JPNA 4N0UA 4LLMB 1V08A 4JFDD 3IDNA 1ZT4A 1PYWB 3O6FC 5E6IA 1BEYL 1Q9LA 5KJRH 4G6AC 3FFCE 1PVHA 4NQEA 1RFDL 2X42A 1NPUA 3HR5A 5KS9F 4RE2A 3PABA 1V3KA 3ISWA 2JF7A 3BSHA 5CZVH 2WMFA 5IJKA 4MQTB 3WEMA 2Z92A 5HPOA 1GOFA 2ARJB 4YHNB 1I3GH 2E27L 1NUDA 3MCLL 3QG6A 4NZDA 3O9WB 2JIXD 4M7LH 5HSFA 3QP3A 5I6XB 1BVNP 4PJGB 2Y9RT 2NLJA 5JHDE 3WXVL 4IM4A 4CD7A 5IKCB 3C6SA 4M43L 2VIRA 1HE7A 4JKMA 4U6HA 5SWZB 2ZE0A 4KK5D 4BH8A 4YXHH 1MCRA 3A6BH 3BGMB 1IMHC 4TOYH 5ILTH 1CFTB 3HG1A 1QLRB 1YEHH 5KOMC 3RWFA 3SDDC 3SCPA 2FYYA 5CG0A 1UA6H 3KS0J 3VXME 1AKJA 2R23A 5E5MA 2Y07L 1UXSA 1YEEH 3UBXG 4GXVH 5KSAA 4CVWA 4UQBA 3LS5H 4LHUD 2DQJL 3O6FB 4WUUE 4GFTB 1CF8L 5EWIL 1H3GA 3V7MA 5IB3A 4JFVA 5AYIA 5IB4B 1T80A 1RFDH 3ZDYF 1I1RA 1TZGH 2FSEA 4G8GD 3I6KB 4HH9A 4NN7C 4QXGL 4UR9A 3C60C 4AT6A 1BJ1H 2AOSA 2E27H 3PHOB 1Q9KB 2WZHA 4MNJA 2KZWA 4PJIE 4FQQA 1CBVL 3BKMH 4M43H 3OF6A 4Y1AD 3NIDE 4NRXA 4ZTPL 5ITFB 3SDDB 4CBPA 3GSXB 2BOCB 3C87A 2APBA 1NOUA 1CENA 2X1IA 1NBZA 4U2YA 1PG7X 1AR2A 4P9HH 2J8UB 1OQOA 1JMZA 2XYCA 3CU7A 2Y07H 3Q6FA 4L3ED 2BX5A 3DO7B 2EPNA 4JDZB 4L4TD 3HUJA 2DQJH 1CF8H 1BREA 4PR5A 4UB0L 2ITCB 3SGDI 2R0LL 1WFNA 1P2CA 2DYPB 4M7JL 4EN3B 1UZ4A 2J7BA 4NN7B 5BVJB 3OAZK 1QBAA 2O61B 1U3HA 1GZJA 2CPCA 2F2HA 1QACA 1B3XA 5KS9E 4D9QE 1UWTA 3MV8E 4YC2C 1FAIL 3DMMD 4GI9A 1M7DB 3CZFA 1VRXA 1K8IB 1BQCA 2FHBA 4I0CC 2YL8A 3DRTB 1CBVH 3SJVB 2R1YB 1A7OH 2WZPD 1YQVL 3D3AA 4PMUA 1EEZA 1D5XA 2C5DC 5FKAB 3NSMA 5A6KA 1MHCB 5LWYL 1DVFD 3QDMA 4MZ2A 1SY6L 4ZSOB 1UCTA 4ONFL 1ND0B 1DUZB 2XZAL 1Q9WB 4EUPH 5C0BE 1MXGA 3KNBA 2F54D 2DSZA 1NWRA 1DFBH 3MNZB 1LG1A 5ERWB 2CGRL 3VFSB 4FF5A 2X4RA 3KLDA 5I19L 1M53A 5B39A 4XPHL 2RHEA 4PMXA 4QF1A 4BKLB 4LGPB 3JXAA 5M5DA 5DHVB 3UR7A 5BQ7A 3CUFA 1E27B 4UB0H 1BIHA 1J1PL 2R0LH 5EBMA 2XGIA 4MJ5A 1JZ4A 5I1KL 2YN5A 3EJYC 2RGSA 1XCQB 3R1GH 3DTXB 4QT5A 2YL5A 2VZ1A 3ZDYE 2ZUYA 4YC2B 4S0TD 4OLUL 4XAKD 1FAIH 1JK8B 1INDL 2XXCB 5EZJA 4LL9A 5E6YA 5C09D 3ESVF 5EG6C 1YQVH 4JFXA 4DK3A 1HJVA 4LSRL 2BVOB 3PQYA 2VUYA 5E2JA 3PP3K 4D6FA 5LWYH 1JHKL 3SE4C 5E9AA 1MAJA 2AXHA 5AY7A 1R3JB 3D48R 3S5LG 2XZAH 3WE6A 1RZ8B 3MXVH 4HLZH 4HT1L 3AXXA 3CDYA 4CVXA 3ARVA 4G80A 3EO1A 1CQYA 3GBLA 3DXAE 5D96B 4NF7A 4U1NB 1FJ1A 2ZSWA 3EYOB 4I48A 4ZUUB 3TONA 4OF5A 4XPHH 1KJVB 3BP6A 1N3NB 1D9KC 4UQ3B 4G8GE 4GAYB 1J1PH 3V8CA 2CMRL 4QRUA 1BAGA 3OGCB 3HE7D 5JZ7D 3BC9A 2VQ1A 5DVKA 2NY6B 4A3YA 1CTOA 2OMBA 4M5ZL 4QHKJ 2FHCA 2E7MA 4Y1AE 1EJOL 2VZ3A 4OLUH 5EC2A 1ZK9A 5KZCB 2EYSB 4PJ9D 1CIUA 1FGNL 5DZOA 2Q7YB 1INDH 4ZFOA 4ZUSB 1C12A 1CGVA 1DWFM 1FFNA 5K9JL 3W0WD 1A7BA 4LSRH 4OD2A 1P4BL 1JHKH 1I1YB 4L3EE 1X5LA 3ROLB 3UCQA 4L4TE 4P23A 3DGGA 3IKCA 3FZUC 3X14A 2WHLA 1F2QA 3MJ8B 3I3DA 2Z1SA 4OJFL 5GRVL 2FEDC 1D9KB 4P3CL 3BD3A 4M1DL 4J12A 1RQ5A 2DQEL 1A6ZB 2H41A 3Q0HA 3QXTA 4NCC2 4PGZA 1I7ZA 3U6RB 5CCKL 5T3ZD 3D5HA 3ROOA 5IFJA 5ESAA 4BH7A 4M5YL 5EO1B 5ACZA 4ODBD 15C8L 4F3FA 5FYJL 1YEKL 1F58L 1EJOH 5BRQA 4YGAB 7A3HA 3VPLA 5ACLA 3P30L 1FGNH 2AV1B 3G6AA 4P57A 4NKOA 4JFSA 1S5HB 2Z31A 1XC6A 2Q1EA 2G60L 4MXWH 5K9JH 1MCFA 3RTQA 1PG7W 2F54E 1FVEB 1MJUL 1P4BH 3UZEA 3RL2A 3T65B 1UUQA 4KKLD 1RZFL 4JREC 2E6QA 4LIQE 3WBEA 1UACL 4PGDB 2DWDA 3GMOA 5BJTA 1UWQA 2NY5H 4H0GA 4PJEA 4HIJA 4HWZB 3MLSL 3MV9D 4G9DA 4JGJA 2FH8A 4NZTL 5DI8B 3L7EA 2DQEH 5DJ2B 3MUGA 4OLYL 5IHBA 4Z2JA 4P0DA 4LLWA 4XCEB 5CCKH 4XAKE 3ZL4H 2Z91B 1ZANL 5I6SA 4F7PB 3OXSB 5C09E 3ARGA 5EB8A 15C8H 1E4WL 5KN5A 4C57C 1YEKH 4NKMA 4U6XB 1F58H 3V5KA 3A4WA 3IDMA 1PQZB 4JLRA 1A0QL 1NANI 4L4PA 2YA2A 3P30H 3B2UC 1RUAL 1ZLVK 5I1DB 3CO4A 5TE7L 3E2HC 2HVKB 5HGDA 2EPOA 1CDGA 1W0VA 2VDLL 4JPVH 1IFHH 1MJUH 2BDNH 4MQXD 3VGDA 5DC4B 2AXGB 4N5ED 1MVUB 1RZFH 3I50L 4MA3B 2WC7A 4OSUH 2Q6WB 3FOMB 3V52L 5EU5A 5DJDA 1BJ1J 3C2SA 2NR6D 1UACH 3UG5A 1E70M 4HDIA 4XP6L 1A64A 1RJYB 1N5YH 1FL6A 3CX5J 1NBYB 2VE6A 1P7QD 3MLSH 2R0WL 5DHVH 2Y5EA 3BQUD 5C0GA 3RKDC 1YJDC 3EGSA 4X7TA 5IMKB 5HYJE 2FEEI 5IVXA 5JMRA 1T1WB 5DF0A 3O11A 3ZDZF 2FWOA 2XA3A 5F7DA 4M8QB 1TVBB 1LO0H 3DX9B 3MRCB 3UR8A 4HLJA 3TJHC 3V4VL 3EOYG 1E4WH 1C5CH 1GOOA 2J1KA 2PUQT 5AYBA 4ZUWB 1A0QH 3DO3A 4CD6A 1VBUA 4RAVB 4QHLB 3E2HB 1RUAH 4YDLB 3WFEL 5TE7H 5BWFA 1JV5A 2D3NA 3VDBA 4GKLA 2VDLH 1HKJA 1UR0A 4PTTA 1QA9B 3OB8A 5HDRA 4WUKL 3ES6B 3I50H 3VE0A 3V52H 4WV1B 4P8WA 1TJGL 3MX0A 4XP6H 3W39A 3G5ZA 2XZZA 5GIRA 1T4KA 1U3YA 4PJBF 4Y2DA 4QHUA 3TBYB 2J6EH 2R0WH 4LGXA 4PRHB 3FO2B 1ZJAA 3L3IB 1YPZB 2YLAA 3S3SA 2CHOA 3S37L 1JFXA 4AM0A 4WTXA 4F2MA 5EA0L 1C92A 3LMJL 5DXWA 1RZJC 2HTKD 1U92B 5CBAB 2V5TA 5BO1L 4XCYB 3AUVA 3HLAA 3SKMB 2GJ6B 5J1AA 5HHNB 3OZ9H 1E6NA 4GZJA 1WF5A 4MD0B 1F4AA 1T1ZA 1PBGA 1KT2B 1MFBH 4IDLA 4M48H 5D1XD 1W9XA 3PZOA 5HJ3B 2DD8L 4YBQD 1Y6NR 3F6LA 1F6LL 4WUKH 1P5UA 5JOEA 1TJGH 3NABL 4HGMA 4CD5A 2DL9A 5GRZA 3BPLC 2AI0L 1TJIL 2E9MA 1M4KA 2ZUMA 4OUUA 4RMSA 1MCDA 3WS6A 3NA9L 2YDRA 1G7JA 4HG4J 2J7EA 1AJ7L 4CJ0A 3UJIH 2YPVL 2R2CA 4LSTL 5D7IF 1CI5A 4PYSA 4B41A 4LLQB 3S37H 4F80A 3UYRH 2CPUA 5TDOA 2B4CH 1DLFH 1OTTC 4MJIB 3IF1B 5EA0H 3LMJH 3O9WD 3ZDZE 3RHWK 2NTFB 3OHXB 4UQEA 3RWIA 5CP3A 1HCFX 3V6ZA 1DE4B 4YQXH 1JN6A 4MMZC 4LF3B 2O9RA 1MJ7H 4CN4A 4D1IA 5SWZD 5BO1H 2ZXQA 3NAAL 2A74B 4LSDA 1BIIB 5DUPH 3IU3B 5F7WC 2PNDA 2CDGB 5BS0A 2P24A 1NCWL 3QUYC 4HOXA 5H35A 4NUGL 3CFBA 2HT3C 1ZMYA 4PV9B 5JO5B 1W3JA 3AYSA 4FP8L 4AIOA 2CK2A 2DD8H 4D6HA 4NQCB 4MNQA 2AGJL 3BPLB 4V2BA 5CGMA 4M61A 4C83A 3O6FD 2ID5A 1KXVA 4M3JA 4G6AD 2AI0H 1TJIH 4FLSA 3WV0A 1BZ9A 3NA9H 1KLUA 2IH3B 4X83A 3NFPA 3PGDB 4FNLH 2VKXA 4HP5A 4L4OA 4Y7MA 2PW2B 3FQXA 4LSTH 1DLHA 4PJBE 2WKLA 1G9EA 3KLHC 3JV0A 4XBPA 1YC7A 4NWTL 3CFCL 5ANME 2NT0A 4W87A 1T2QH 4KTYA 4RFEB 3NZ8B 1G1YA 1E4KA 3LSOB 1X4YA 1LEGA 1AO7B 1GAFL 2ATKB 3C60A 4YX2H 2WBJB 3I6LD 2XUCA 4GAFB 1QPKA 2JK5B 3FQWB 3NAAH 4PCSA 3SDDD 1MVFA 2F8VA 1DQML 1WWAX 3L3HA 3QNZB 3QUYB 2C3XA 3EJZC 4NNYA 3WCYA 4B53A 5F89A 3LKNB 1ZOXA 1IGYB 2J7DA 1Z2KA 3HN3A 4FP8H 2EDWA 4I18A 2VZTA 5D1ZC 1OWRM 2LVEA 1CICA 3DX8A 4TTUA 1F4YL 5ICZA 4YFDB 3MREB 3IDXL 2OR7A 1QLFB 1YJDL 2XIBA 1OWQA 2HJLB 4W7UA 1UR1A 3GJFB 1ISYA 5A8OA 2IMNA 4BSVA 3MRHB 1MUJB 1YEJL 3SKNB 4IHOA 4KVNL 4O51B 5C86A 1G7IB 5E8OB 3QCTL 1M04A 5D7IE 4GW4A 4NWTH 1HP5A 4X0VA 3EOTL 1S9WB 3FQRA 5FYJD 4GMTL 1GAFH 2J8UF 4IISA 3SJVD 3OKNA 2A6IB 2AXJA 2N7AA 5A95A 3S35L 3MFFA 1BFSA 1DQDL 5LAXB 4PB0H 3F5LA 4DK6A 1KC5H 2AXFB 3RWCB 1G7MA 3SCMA 1DQMH 1H9VA 5FK9B 4JANA 5IMOB 2XQBL 5LG1A 3ULSB 1Q0YL 3PJSA 4ELKB 3IDJA 5D1ZB 3EOAA 2BV9A 5F21B 1AE6L 4ZYKB 4NNXB 2RJMA 3QUZC 1QHOA 3V0VB 4XP4H 4JHWL 1F4YH 3AC0A 4P2QB 3IDXH 1YJDH 5HVWA 1EJ6A 3OJVC 3GSUA 4LCIH 4BK4A 4KJQD 1CZ8L 2AJ3A 3LKPB 4ZDHA 5I9QB 5J13C 2EO7A 1YEJH 3VFOA 5DJZA 4KVNH 4HA1A 5L2KB 2J25A 3QCTH 1RZJL 5HHQA 4U1MB 4HWBA 5HPCA 3EOTH 2W07A 1UD3A 4LLYB 1DUYB 2XPKA 2EIDA 1MQKL 4GMTH 3ZT7A 2D7OA 1B4RA 1J1OL 1UWGL 3S35H 3TA3C 1IM9B 1LO5A 1DBAL 1EHLL 5J11C 3OX8A 2I5YH 1S5IL 2WAHA 5JOFA 3CUPB 3K4ZA 4KKAC 2GJXA 3MQIA 2PETA 2XQBH 1Q0YH 2W60B 3QUZB 5LGHL 3LPOA 1AE6H 4APQB 4NQDB 3AI0A 1V0KA 4GZEA 3WHXA 1O7SA 1OB1B 4JHWH 4M6NL 4QLJA 2EKSA 1ACYH 5HY9B 1B2WH 2B5IC 2R29H 1TZHA 5JIKA 3HI1B 5J13B 1BX2A 4P59H 3ZKQD 5F97E 3BXWA 2CDFB 4XX1G 2UUDK 4X99A 2X7LA 2NY6D 4L9DA 4O00A 3I6LE 4LX4A 2K9UA 5KZCD 4U5IA 2HN7B 1W0WA 1X5HA 3EO0A 4R2GC 5IB1A 1JZ6A 3TA3B 4PJAA 4H41A 5EBLB 1J1OH 1UWGH 5HPMB 3PWJA 2GJRA 2J8UE 1DBAH 4IJ3C 4F33B 1EHLH 1XFPA 1R5WA 3CPLA 3RJYA 1G0DA 3QIBA 5IHRA 3U7AA 1CGUA 4WK9A 4OIBA 5BRZB 1R3HB 3GSQB 5LGHH 2J5LB 2PXYC 2B7DT 1FVDA 2BNRB 4XBGB 1LE5B 3NIYA 1ZHLA 2XY2A 2V2TA 1F8TH 1D9KD 5CIPA 5JPNB 1PBYA 3GJEB 4M6NH 4CW1A 4I8DA 1T5XA 1W1VA 1BG4A 3P4NA 1Q9LB 1E15A 3IRZA 3PABB 1CL7I 3A47A 1P4IL 3A0OA 4B50A 1E6QM 3SJVE 1T04B 3BAJA 4Z7WA 2GDVA 2EE6A 1RVFL 3WN6A 4MQ7A 2ZG3A 3BZ4B 1KG0A 2I9TA 3ZIZA 3CLFH 4OZGA 4R2GB 4ZSOE 3VXQA 1JF6A 2R4SH 5BZWB 1TNNA 3PZVA 1FLRL 2ESVA 2ZXAA 4QLLA 3TESA 2VIRB 4U6HB 2ED7A 1E4IA 4NM8L 3JVGC 5C0IA 2GUYA 4FLOA 3VXSB 1UVQA 4X7EC 3S3PA 1WZMA 1ZS8B 3BH8B 2XOTA 4GO6B 4YDIL 4V1DB 1S7XB 2A3HA 3FZUD 1RIVL 1AKJB 3N13A 1B30A 2JIWA 4OBRA 3VA2C 2LABA 2PXYB 4FMKA 1P7KA 4C56E 5DEGA 3RVWC 4XB8A 4XNQB 4OF6A 3UJJH 2PWFA 5HHMB 5KSAB 4UQAA 2FEDD 1I75A 3S37X 1A7NL 3WBDA 2MHAB 4CJ1A 3GJFH 3S88H 1WNOA 2CDEB 4HCRH 5CPTA 4ODUA 4O2EA 3QHTC 4F7CA 4PJ7B 4WVRA 4MQSB 2CXGA 1GOMA 2EDRA 4YHZH 4PLNC 2DJ4A 2P5EB 3LS4H 1P4IH 3PBGA 3QEGL 4K94C 1G0YR 3TBWB 4WIWA 1PJ9A 5I1HL 4NO2A 1SJXA 4GG8A 4NRXB 2DOCA 1FH5L 3D0LB 5I0DA 1GORA 3N50A 3JV5A 2VISB 2N56A 3BWAA 3L4YA 5DC9B 2V9RA 2AMGA 1PZ2A 4NRZA 3DYOA 4LEOA 3N06B 2NXYC 1OPGL 5I1CL 5EO0A 4YR6B 2VLJB 3O2LA 3FQUB 4MDPA 4MAYA 1A7NH 3EHBC 2A83A 4XZUB 4D6EA 4N8VA 4Q9QL 3AM8C 4LDOB 4G9FB 1YNTB 3CK0L 4QCFA 5CILL 1MW2A 1P2CB 3TTOA 2IQ9H 4W6WB 1M01A 3VIPA 4XCFL 1KCLA 3HZYB 3FB7A 5D4YA 2MSPA 2EXWD 3ZHKA 3F5WB 3H42H 5EO9A 3B2UD 3VA6A 2E7BA 3WIFA 4F8XA 1K9FA 4EBQH 1RZ7L 2BXYA 1FH5H 4YJZL 5I74C 4PJHA 4ORGB 1EAPA 5TF1L 5JW5A 5LGJA 1FG2B 2N4IA 3HS0B 2NXYB 5FD0A 2R2EA 4NN6B 3W81A 3K4AA 3OL2A 4KKNA 1OPGH 2H1PL 5I1CH 1NGQL 5D2NC 2YD1A 3MUIA 1E6ZA 2X4RB 1GOGA 4F8QA 3RKDD 4K23L 4DM2A 1CDBA 4PRHD 2YEZA 1YHTA 5FA3A 1KIUA 3HZKA 4Q9QH 4YFEA 1MFDL 4F57H 3QR2A 3CK0H 5CILH 5GGTH 1BF2A 5CBEA 4XCFH 3WIHL 3KZSA 4ZNCD 1IC4L 4TOQA 5D2LA 3I6GB 1I3UA 5IOPA 2QKIB 4PG9A 3UXFA 3HAEA 4LSVL 2YLLA 2GJ6D 1A1MA 2CKSA 1RJZA 4L8CB 3QDGB 4X5WA 1AGFA 5I74B 3PQYB 3ULVH 4LLVB 3U82B 1QSZA 4NDMA 3MO1B 1ZVSA 4L8BA 1ORSA 3LKRB 2G4FA 4CD4A 1H15A 1YPZF 4IOFD 2J3SA 2H1PH 2WHJA 5F7HA 1NGQH 1GGBH 1A3LL 1FYTA 4MS8C 1HX0A 1FJ1B 3KAAA 4KKBC 5ALCH 4JO2L 2C8NA 4S1RL 1BBDH 1UKTA 4JFOA 1AQKL 5D9NA 4MA1C 4GI8A 1HILA 1R87A 1S7SB 4FFYH 5FYLL 4UCFA 3GB7A 4MJID 3S35X 4UQDA 3BRDA 1XF4A 2HKFL 2VQ1B 2X1OA 4P5TA 4PTMA 3WIHH 3M45A 4P3DA 5AAMA 2RFXA 3NGBB 1YEDA 1IC4H 5F6HJ 4AZCA 1WT5A 1DN0B 3WFHA 4LKXB 4ZFOB 2AEWA 1JIBA 1FFNB 3DUUB 1IILE 2HWZH 3BLKA 1JTOA 3UZVB 5DMIL 3U4BL 2XVGA 3MRNA 5T5NF 5CD3B 4OCXL 4C55A 1DWJM 3T4YB 1BZ7A 4NQCD 1I8LC 1FNGA 1NGXA 3FO9B 1AGBA 4PSPA 4MNHA 2X40A 2FR4A 1A3LH 2DBJA 2F5AL 4HULB 4XCNA 2P8MA 4Z5RA 1NWSA 4UZUA 3CBWA 4JO2H 5C07A 3MOAL 3RVTD 5K9OB 4B15A 4X9YA 1AQKH 1KIPB 3DHJA 4OLXH 1OTTD 3GKZA 1I7ZB 3ZKNC 2G9HB 3GUTB 5FM5M 4OOZA 2XGBA 5F1IA 1JDAA 5E4IA 1OD7A 3OKEB 5FYLH 4K94L 5ESAB 2OTUB 1FSKC 1AO7D 1H0DA 1DDHA 2FATL 2QPSA 3SBWC 2AQ1A 3P0GB 2WBJD 2G3JA 2Z31B 1NH6A 4P7LA 3QUYD 2HT3D 5DMIH 3U4BH 4LPVA 4JAWA 1E0XA 4BQ8A 5DVNA 3KPOA 1NGYB 2YC1A 4MLSA 4OCXH 3KL3A 5MENE 3WEOA 1X5KA 5CLTA 4HK0A 2Q20A 4PRHE 4X6DB 4IPNB 2PYEA 2DWDB 6A3HA 5CINH 1LEIA 5BJTB 1YPZE 4N0FB 1Q4NX 4PJEB 3F5JA 4HIJB 1U93B 2F5AH 3S34L 1J5OL 1X7QA 2YSSA 5DMKA 3RX5A 4KDWA 5DEFA 5I1LB 5IEKB 3WUEA 2G5RA 1ADQL 4X80L 4PSRA 3MOAH 1VFUA 3KLHD 2APFA 4LLWB 4D9RD 5E70A 4LNVA 1FSKB 2YKLH 4XXDA 1B0IA 4FQXA 5L2JA 3RO8A 1F4XL 4WJ5B 2EC8A 3WXWL 4Y89A 3WO4B 4B0MM 1MCJA 1FOBA 2FATH 1OINA 3C8HA 5C0FA 3LEXA 2EYTB 3WN5A 3IDMB 3OZPA 1HH9B 2W0PA 1U8MB 4OCSL 5SX5K 2HLFC 1W2KT 5IV2B 4G42A 5HGDB 3LIZL 1UD6A 1W0VB 1YYML 5GS0H 2A1WH 5HGHA 3UBXA 4LMQE 5D1ZD 2Z8SA 3VFTB 2BZDA 4PPTA 2BOBB 3MCKB 4UDTB 3WO3B 1RK0B 5EU5B 5DJDB 4NPYA 4HDIB 4P2QD 5HDBF 4B5EA 2ADJA 4TVCA 2CD0A 2CNCA 1AIFB 4PMYA 2VE6B 1U6AL 1UQSB 4MJIE 3WF2A 3VIOA 1S3KL 4HOWA 1ADQH 4X80H 4M3KB 3SGEI 4BZ1L 1ZLWH 5L2KD 1AIWA 4RL3A 4TQEH 2FWOB 2X9YA 5DD6B 1HI6A 3GNPA 4RDQG 1F4XH 3F62A 3HI5L 5J12C 1FN4A 5L88L 4U1IA 5FEBA 4M9OA 1Z3GL 1H3XA 4NC1C 4YEEA 3QR3A 3E6FA 1IGFL 1N59B 4RWYH 5EOQH 5FV2A 1KSRA 4OCSH 5J6HA 4XMPL 4NSKB 1E72M 1S7QA 1JV5B 1IVLA 4PJXA 1YYMH 1G9MH 3GMQB 1H8SA 5I8KL 3RWDB 1QRNB 4PTTB 4UTBL 3O6AA 3QUZD 5DUML 4NQDD 4PJ8A 2BVQA 4ZNEE 1FG9C 4HS3B 4N9GB 3FHQA 3IU4H 2ZX6A 4HQQL 2FIKA 2Y4SA 4E41A 5F8RC 4JO3L 1UH2A 1TENA 5IBLC 1XGRA 2XN9A 3I75A 4WO4C 1AO7E 3VWJC 5L8KB 1MI5B 2ZUXA 4GINA 4P2OC 1K2DB 4WGVB 1NOFA 4NZUL 3SGKC 5CD5C 4X6BA 4ZS6C 3HI5H 1VERA 1E28B 3TA3D 5D4QA 2M1KA 2QHRH 5FHBH 3SUSA 3RJQB 4DEPB 1Z3GH 4CNIA 3QQ9C 3CVIH 5ISZD 1IGFH 5J1AB 2FX8L 4YFLF 4KKAD 1QNSA 3QSKB 4LRIC 2A6JA 2Q3ZA 4E0RB 3CUHA 1F4HA 1DBBH 1ORQB 1KBKA 2VDPL 2CETA 3SGJA 5I8KH 5BRZD 3WDJA 5DSCA 1SJEB 4UTBH 5DUMH 4NWUH 3VI3F 1T1XB 2BNRD 2GSGB 2LU7A 1JXJA 1CEOA 3EKCA 3IFPB 3U30C 4XHJC 4GUPB 5IM7A 2MMXA 3NYDA 3A3HA 5HDBE 3ARWA 3CSYB 4WO4B 4JO3H 2A77L 4QGYA 3QXVA 3U1SL 2DQDH 4BYHA 5SWQB 1E4XI 3LH2H 1IQWL 4K71C 2O93L 4P2OB 1EOMA 3L7FB 4X5LA 2D9QB 3ULVF 3O2DL 4P4KA 4Y19B 3SDXA 3TT3L 4R2GD 3RGHA 1WKYA 3TNMB 4NC2B 3REWB 1LO3L 3VMPA 4KHXH 5H37G 1QW9A 2CO6B 1NL0L 1PEWA 5I16A 4KQ3L 3MROA 3VXSD 4UTFA 5JIWA 2P1YA 3AAZB 2X70B 1HKMA 2XG4A 4V1DD 1YY9C 2VDPH 2X4UA 5H35B 4P2QE 2H2PC 4UOJA 5HYFA 2PXYD 5MEQB 4ZO6A 4UT9L 2WUBL 5JBDA 5HHMD 5KSAD 4AW7A 1EFQA 3O4LA 2QQNL 3TEUA 1I7TA 1AY1L 5JNYB 5L2KE 1QSFA 3Q3GA 3A4XA 3IJHA 1AFVL 3MOBL 5IG7A 4J3OC 1YUHB 2KBGA 3NFPB 1U33A 5A2BA 4K71B 5C0AA 3ALGA 1C7SA 4P7RA 1IQWH 2P5ED 3FN9A 5FYLD 5DQ9A 1SMOA 3NCJL 4XBPB 3U7VA 5HDLA 3SDAC 2OTPA 1GSMA 3KJ4C 4ISVA 2F9BT 3TT3H 1LEGB 1LO3H 2X4QB 3PGCB 3V95A 2YPLA 4HJJH 2NY0C 4M7ZB 4JKLA 3ILPB 2XJ7A 4KQ3H 3THDA 1NCCL 4X6CA 3ZYOA 4NNPL 4KJPD 1S78C 1H8OA 3L3HB 1AHWC 4NQDE 4R7DB 3T8XB 4RQQA 1XGPB 4NNYB 3VXTB 5F89B 4ONGL 3IFLH 4DGYH 4K68A 1UJ3C 4L3CB 3GTNA 2VLJD 2D22A 1IGCH 1ODAA 2WUBH 2BFGA 3DX8B 2QQNH 4JFFB 4TTDD 3VWKA 3VI3E 2Y5TA 35C8H 3H6JA 1AY1H 1FP5A 1AFVH 4HFUL 4G9FD 2VI0A 5EZOH 1UR9A 4IHOB 1CLXA 1Y7VA 3SDAB 1T03L 4PGEA 2WINA 3KJ4B 2V38A 1FDLH 2R4RH 5HGAB 3W27A 2BNJA 5ICYA 1B88A 1FNFA 1K4DB 4PRPA 1HQ4A 3MODH 2NW3A 3ULVE 2D49A 1Y6MR 5E5UB 4CRPA 1G6RA 5F1OB 1UWEL 1XGQA 3U0PB 1F3JA 1AHWB 2VDOL 4N8PA 5BRZE 1NCCH 1SJHA 3HUJF 1G7MB 2M8XA 1W8NA 2UZXB 4JANB 5BROA 4OQ1A 1ITBB 1OARL 2NXYD 1UJ3B 2OM5A 5JIIA 3PJSB 3DROA 5HXMA 1ECEA 3IDJB 1KPRA 3ZSSA 1UWSA 4ONGH 3EOAB 1L8NA 3ZZ1A 3V6OC 3LQMA 5EIIB 2FJHA 5AC5A 1GJUA 1EERB 3D2UA 3VH8B 5L9DH 3C5ZA 5F71A 1MELA 1OP3K 2UYLB 3AGVA 3FQNB 4P2CG 1IKNA 3D39B 3QWRD 2VYRE 4TYUA 3WF3A 2AJ3B 4Z7UB 1H5BC 4HFUH 1K5NB 4P5KB 2F74B 2VAAB 3SCUA 4ZFFA 3UERA 1YEIL 4JY4B 4DWHA 1T03H 2ZX5A 1WFUA 1R0AL 4D71A 5E56A 2ZZUT 3QDHA 4KPHL 1EDQA 1EXUA 2W0LA 1C08A 3B9AA 3K0WA 5D1QC 5J3HC 1HIZA 4HG4K 4BQ9A 2ESCA 3QDGD 1CFBA 3C6LC 4WHCA 1UWEH 1LO5B 5FUCE 3PQYD 1KNOA 4FXLA 5IESL 1HXMB 2ZUTA 3LVEA 3TM6A 4R5EA 5ID0B 3B5GA 2R0KL 2GJXB 1KYOJ 4YHPB 2VB5A 3IXTB 2ZJSL 5K9KB 3CFJB 1B31A 3BRFA 5I18L 1V6UA 1I1XA 1U8NA 1A4KA 3OAYK 4I9WD 1KXQA 5BVPL 4FQLL 4TUOB 2DN7A 2OJEB 3STLB 3NCOA 2EKSB 1RSFA 1EEYA 1H5BB 1IC5H 1EO7A 4MCZB 1KJ2B 3EYVA 2VLKB 5DJAB 1EHAA 4KK8C 1E0VA 4EI5C 3GMNB 4X99B 2O26U 1YEIH 2P4AB 1YDPA 4WEBL 1R0AH 4K9EC 1N6QL 1IC1A 1F3DJ 3FT4B 3AHYA 4OM0L 5DUBA 3C6LB 4XPFH 4UU9B 1BM3H 2K7PA 3IDIA 4NIKB 4F7TA 4RE3A 4WI8A 5IESH 4GPNA 1U8HA 2B31A 2VLJE 2B0SL 3RJXA 1QG3A 2R0KH 5A43C 1UXWB 5DDHB 5MEOA 3TN0C 3HUJE 2HFFB 1T3FA 5HYSA 4MS8D 1V0NA 1C8YA 2X4TA 5I18H 5FO7B 1WJ3A 2VJXA 3QDAA 5BVPH 2YS4A 1IAKA 4AEFA 1KV3A 3WD0A 5C08B 2D31B 3IK2A 3MO4A 4OBSA 3G6MA 2XPGA 3E3QE 2HYMA 4LU5L 3DIFA 3ZHLA 4QY8B 1ZU8A 5F9WC 4WEBH 3FTGB 3MLUH 3GZAA 4OUEA 4BFBD 1N6QH 1GPOL 3QDME 1S7WA 4OM0H 2Y1VA 4D6GA 5FGBC 2PBOA 2Z31D 2APXA 4P4RA 1CFSB 5GRYA 1ERNA 4JKKA 4DAGL 4XZWA 3I85A 3TZVC 4ETYA 2W0KA 3BEVB 1UCBH 4AC1X 3QO1B 3TN0B 4G5ZH 4ZODA 2BSRB 2B0SH 4RGOH 1UEYA 3RVVC 1AVAA 1YZZA 5FCZA 3KWWB 4OZ4A 1NCUA 1NGPH 1JE6A 1P7KB 4Q9BA 5T1DL 3PN8A 1I4FA 4G8IA 3B2VL 5GRJL 5JHLL 4FFWC 3DV4A 4UIMA 5A2FA 1DBKL 3EZ8A 2CLVB 1JXKA 5JXAL 4ODUB 3L6FA 4O2EB 4UNVA 1LJYA 2ICCA 1MQPA 1F02I 3NVQA 4Y4KA 4K2UL 3DRQA 5M3WA 3M6DA 1IZKA 1VBRA 4R0LA 5LKNA 1RULL 5F9WB 3NSXA 3FO0L 3O3BA 4ZUVA 3QDGE 1QNOA 1VKXA 2IAMC 3SCTA 4PGJA 3IVKA 3PQYE 2EKJA 1UM6L 3MRRB 3FB6B 2WM0A 4X6DF 5DJ8B 3MRQB 4QOKA 1MCHA 4ZENA 3GI8L 4GG8B 4RA0C 1MCWW 4PJEF 1I1FA 3TZVB 5EUOA 5E9DA 4DAGH 2CKBA 2Z35B 1QVOA 3D0VA 3NPZB 4J6RL 1F13A 4I9WE 4PRIB 5CEZH 1FZJA 2FDMA 2J4GA 2V3GA 1K85A 2VXTL 4LCCA 3BPNC 2HFEB 5T1DH 1Z6JT 4AK1A 3CHFA 4KDTA 4ATLA 3B2VH 2GAZB 4KJWC 5GRJH 5JHLH 5C0CB 2BC4A 2Y23A 2A83B 3S7GA 1KJ2L 3TIEA 4Y4FC 3ARDC 5FAAA 5JXAH 2HLAB 2AEIT 3AB0B 2BK8A 3KHOA 4XPAH 3ALXA 5E8PA 3PZ9A 5GJSL 4JKPH 4JRXB 4JL1A 4MXVE 1S7VA 5DJCA 1RULH 3FO0H 3S9DB 3FB7B 3P4MA 1BWWA 4PTUB 4WLCA 4U1LB 1NDMB 3WKMH 1UM6H 3WIFB 3BX7C 3RWJB 4WFHD 3GI8H 4HPOL 5DTFA 2EXYC 1K6QL 2P5WD 4KVCL 4OIAA 1QTYT 5DFVC 1YYLH 2ADFH 4PJHB 4J6RH 1QRND 2BNUB 3KLAA 4H1LG 4ZFGL 4KGLA 3MJ7B 4L4JA 3PNWB 5IVXF 4D0CA 4PMQA 3BPNB 3WDPP 2ZOKB 3QQ4B 4EIGB 1ZHBA 1XF1A 4AMKL 3WYRA 4G6JL 5DYOA 5ETUB 3F7VB 5E1AA 5I75C 4Y4FB 3ARDB 4A4AA 1KJ2H 1XGUB 5FA3B 3LDBC 5FFLA 4Z0BL 4DZ8A 4QGTA 4DWSC 1MI5D 2WIIA 3QHMA 4K9EL 4K3EL 5GJSH 1U8JB 1NFKA 5ABEA 3JUZA 4MAZA 3VWJA 4L8DB 1GZQB 1ZJBA 1ZVHA 4FG6D 1OW0A 1OAYL 2C3VA 2RIKA 1CNVA 1A1MB 3ZE0F 4I0KA 3QXAA 5IVNA 1LNUA 5I66B 1ZBKA 1K6QH 3GSNA 4KVCH 4X6DE 3A6CL 5CEXB 4C4KT 5BYWA 3PIQA 1MCNA 2DWEA 4PJEE 1ORSB 1A9BB 1WWCA 1H15B 4ZXLA 2J7GA 5EFFA 4ZFGH 2GHWB 5ENWA 5JBEA 3GH7A 1WAAF 3B6SA 3W29A 1HF6A 1MLBB 4JZOB 1MF2L 2G3NA 1OSEA 1MREL 4OKVA 5I75B 2NXZC 2C26A 4CKVX 4G6JH 5IBLD 3I02A 3PTMA 3LDBB 1U0QA 4WO4D 5K59F 4IPLA 2EDYA 5DRNA 3RWHA 1AQDA 4X6FB 3D69A 4DWSB 4GW5B 1DBML 4P2OD 4HF5L 4Z0BH 4FTVA 3VI4F 5DA4A 4LOUC 1RHHA 4K9EH 3VD3A 5CD5D 3RZCA 2DLTA 4K3EH 3TIDA 3IFOB 4Y19D 5A2JH 4QCEA 2C7UA 5IQ7H 2AAVA 1YEDB 2YN3A 3BKYL 4YHKL 1F11B 1OAYH 4XGZB 1MH5A 2UZIL 3IANA 4ACYA 1CGTA 1D5IH 1CLZL 4G6ML 3MRKB 4KRUA 1CDUA 1HHJB 3PWPA 4TSCL 2CLRA 1MWAA 4OUOA 2A3BA 4V27A 3U36B 4CVZB 2L7JA 4HAGA 4XHJD 4XBEH 4LYPA 1MF2H 5EOCL 4P99A 3FQTB 1MREH 5IVXE 1J05A 3ARTA 2P8MB 5GGRB 1J0IA 4G7YL 1CK0L 5CSZA 1WWWX 1NOWA 3EDEA 5E7FA 1VADB 1ZT1B 2YD9A 3EFFA 1ZWIB 4HF5H 5F1IB 4UV7L 2X9XA 4PV8B 4UBDC 5ESVA 4OZOA 3OG4B 4WFHE 4NC0B 1DDHB 3W28A 1JGVL 3D1MC 4HPHA 3AY4C 2DQIH 1KXTA 3BKYH 4KTEL 5H2BB 4ETQA 4GXUN 2BVYA 3R4DA 4RAHA 4AEEA 4JY6A 4W4NA 1CLZH 4KWUA 1YY9D 4G6MH 2H2PD 3ZE0E 4TSCH 3U79A 1A6AA 4Z2IA 3H9SA 1JWSA 4LLAA 2QMKA 1J01A 4Z2KA 3X12A 5BW7A 4C58B 2YC1B 3OKYA 1OGTB 4BFIA 3QQ3A 1TFHA 3M1BB 1ZBVA 1B0RA 2DICA 1H3VA 4JFFD 1Q38A 4PRBA 43C9A 5F72S 4CADA 5EOCH 5T1KD 2OJZH 2YSSB 2GVYA 1FFRA 5A16B 4WW2A 2ZX7A 4Z7NF 4JPWL 1CK0H 1LGVA 3GMMA 4OGYH 3SDAD 4YAQA 1AR1C 1NGWB 4W84A 1QR1A 4NO5A 2KPNA 3Q48A 3LY6A 4U49A 4UV7H 4PLOB 2R56L 4H0IA 4X0KB 2Q86B 1UADC 3VI4E 4FQ1L 1AGCA 4QTIL 3MV7B 2ZPKL 1JGVH 3WIIL 3UDWA 1CTNA 2FGLA 1PKQA 3HPLA 3SY0A 4PP1D 1MCWM 2VABA 4KTEH 4IMLA 3CTTA 3SCQA 1NUGA 1T1YB 1OD9A 3QB7C 2D7TH 3GMLB 1WIUA 5GGRY 1LO4L 1D5BB 1VFBA 3BP4A 1BLIA 2B1AL 5CEZD 1PY4A 3A6OA 2HT2C 1ISWA 3PWLA 3CDGA 3ZT5A 3BUYA 2OBGA 1V03A 4X4YA 3AMCA 4OV6F 3D39D 5JUVA 2AW2A 3V5DA 3BYTA 2XFYA 4HIHA 4Y19E 4Z78A 4JPWH 5DS8A 4LYRA 3R8QA 1I85A 5HHOD 4EDXB 4CL7A 3TT1L 1X4XA 3F65A 2Y24A 1KUMA 1NQ6A 1I9IL 4GRMB 4M7LT 1HI6B 3V7AE 2R56H 3TBVA 4QHKI 2XWTA 3ZTNL 2FO4A 3BYYA 1DN2A 4QTIH 4U1IB 3WIIH 1FHGA 5BS0E 1LP9A 2BSTA 4F9LC 1MFCL 3E6FB 4UT7L 3MLYH 3KL5A 5J6HB 1U58A 2IALB 2Y6SC 3WNMA 5L8JB 4UV4L 4BM7A 4PJXB 3T0AA 1KCUL 4RMTA 1PX3A 4LSPH 4Z7UF 2JIEA 3QXDB 1F4WL 2DQUL 3KYOA 32C2A 2BVQB 1BVLB 4QHNA 5FOOA 1FO0B 3MR9B 1FQ9C 1ZT7A 5KW9L 3IJSA 2DEPA 4PTWA 4PJ5A 3DUSB 4PJCA 2VLKD 3QI9A 1GIGL 3DX6A 3QWOA 4F7EA 2V7NA 2XN9B 2A6KA 2GT9A 2KQMA 3I75B 4L9LA 4ZMAT 1OD8A 4WHYH 2C3WA 5D7JA 4Z7NE 2QF8A 3L3GA 3G5XB 5D1QD 5DRXA 5J3HD 3WFDL 4X6BB 4QRTB 1JWUA 3PL6C 2Y7QA 3C6LD 3WF0A 5I24A 3VRJB 1HHKB 3DI2B 5GGUA 43CAB 1MFCH 4UT7H 1T5WA 1SBBA 2AJZA 4HK3J 1T22A 4AIZA 4UV4H 1BGXL 2WMKA 4MZ3A 1NM9A 1KCUH 1TZ7A 3RI5F 1RIUL 2ICWI 4UI2A 2DQUH 2VZUA 5EBWB 3RPIA 4P46A 4OFYA 4R4BB 5CSUA 1N0LA 5IK3B 5KW9H 3HTLX 1MCBA 3CSPA 5IM7B 2VC2L 4KK8D 3CIVA 4OCYH 5C08D 1FC1A 3WDIA 2YD6A 2ARWA 3MGTA 1GIGH 1YEGL 1UR4A 4LPTA 4XMKL 4OLVL 4YIQB 4PJAF 2CIKA 2FBJL 4Y5VC 3WJLA 2EPLX 3PHSA 1Z9SA 5GXBB 4J2XA 2QLVB 4MVBC 2HVJA 3ZKXB 3BO8A 3PL6B 5J1SC 1FL5B 2DI8A 3K2UH 5DT5A 3PHQA 4MD5A 2AJUH 4MXQC 1L7IL 3FRUB 1BTCA 5TDNA 5GNZA 5I16B 5CEZE 3JUGA 4X4ZA 4OT1L 4NQSB 2IH1A 1OBAA 3VFUB 3TN0D 5C71A 2JJTC 3WH8A 3E1F1 1BGXH 1JPSL 5AUMA 2DPEA 4H26A 4YBHA 4F37K 4E2OA 3WS3B 3IYLW 2PCPB 3IAQA 1P6FA 4Z7UE 2BY0A 2G8ZA 1XZ0A 3WNLA 3GJFK 4PJDB 3WQWA 4Z7WF 4P7OA 3V6FB 5D70L 2CO7B 1RZGB 2F8QA 5AZEL 3DSFL 1QSFB 5FUZL 4Y4HC 4YNYB 3VXOA 1P7HL 1CFVL 4CGTA 4XMKH 4OLVH 1CDJA 2FCBA 5I1EL 3BHBA 5GS1C 3AXHA 3MJ9A 2FBJH 2M2DA 4NBYB 4AYSA 2ZUWA 4FZEH 4UZGA 3MRDB 3G6JA 4LVHC 5EZLB 2Z1KA 3PZNA 3WQ4A 4X9FA 2BNQD 3OG6B 4JQVC 4I4WB 1L7IH 3WH5A 2YPLB 1QRKA 3IDUA 3TZVD 4WKFA 4JFTA 1JPFA 1VFOA 1EXPA 3V6OE 4OT1H 3RVVD 2WBKA 4JN1L 4PRID 1QSEB 3ARFC 3ALWA 3R06B 1JPSH 4WNQA 5GJTL 2MWCA 2NX5B 5FCUH 2PWGA 4MJ6A 4FQ2L 4RAUA 1FO0L 5IEHA 4FFWD 1G84A 2VLKE 1M03A 5IHSA 1FE8H 1XCWA 5H8DA 3BGAA 1NCDL 5C0CD 4Y4HB 4JZ5A 5AZEH 2EIZA 3DSFH 1J1XL 3KPNB 3MNVA 5FUZH 1XH1A 3DX7A 4MHHI 3GO1H 2WIMA 1CFVH 3IS1X 4PP2B 3EBAA 4JRXD 2ZOLB 3W2DL 1QKZL 2JCCB 3BW9B 1NFDA 2A2QT 2W0FB 2EDQA 4LVHB 4NI3A 3KPPA 1R86A 4PJAE 1WE5A 3CFEA 4ZOAA 2VVSA 2X89A 2UVFA 3L3OA 2GIYA 3DECA 4CD8A 1XGQB 3ZKSD 3C5SA 1ZHNB 2DT3A 4WCYL 1F42A 1Y0LA 4Y16A 2E40A 1SJHB 8FABA 1C8XA 4AL8H 3ARFB 1JNNL 3RUGA 4JN1H 4ODVL 1V0MA 2UY3A 4D94A 2ZWLT 4QP0A 3K8KA 4K7PY 3UG3A 5GJTH 5JXEC 2VH5L 1GL4B 2DBLL 3DVFA 1X5ZA 4KJWD 1FO0H 3POCA 1VEMA 1OM0A 1MCQA 2MOVA 2DAVA 4G43A 1RUQL 3C5ZB 1NCDH 2Y06L 1JUFB 4Y4FD 3ARDD 3RDTC 1OT2A 2CLZA 2A3CA 1KIQA 1ZLVH 2XZQL 5BZDB 1A14L 2NSXA 4BQ3A 3MMWA 1J1XH 4Z7WE 3MSGA 2H6PB 1ETZA 2QPUA 1KCRH 5EN2B 5A2AA 3JV6A 3ABZA 1ED3A 3AICA 3W2DH 1QKZH 1OOAA 3WQ5A 1W0YT 1QVBA 1UWXH 1AD9B 3NDYA 2ESVE 5F7MC 4PJHF 1NAKL 5FF6A 2O5ZL 3LHPL 4PUDA 1RP9A 2QV4A 1C08B 2QQLH 3QBTB 2EXYD 2W9LA 5JW4M 5DFVD 5KSUB 4URTB 4DKAA 2IBBA 5BXFA 1FNLA 4ODHH 3H0TA 1JNDA 3N04A 3FCTB 3BAXA 1BVZA 1EVUA 4ODVH 3PWNB 4JN2A 4CCEA 1P6WA 4GRLC 2ZCLH 2DBLH 3WUWB 1U8NB 3TVMA 1HYSC 1Z9MA 3BLPX 4NKIL 4YGVB 2IUZA 1N5AA 1NFIA 2Y06H 2QL1A 4ZFZA 4FABL 4LFHD 4P2RB 3MRBB 2XZQH 1A14H 1FFOA 3KYNB 4DWSD 1KCKA 3U7YH 2E7CA 4K7PL 2O9TA 3V8OA 4KRMB 5IHZB 2OZ4L 1K8DA 5EZIL 4OAWA 1YDPB 3U0WH 3T0EA 4IRSC 4O4YL 1G7PA 4HXAH 4FFVD 1EGJA 4JGUA 4FXKA 3LHPH 4MAVA 4TNVF 3EAKA 4Q2ZA 4HEPG 4PRIE 3SKJL 4ODTL 1HQRB 2YD3A 5C3TA 2J74A 1A6WL 2R2BA 3OG2A 4M82A 1RPQA 1ZSDA 1F2XK 2WWKT 4F7TB 3U4EB 1C1EH 3T2QA 1S9YA 1P9MC 3QUXA 3WD5L 4HUVA 4JFEA 4GRLB 3AU1A 4WKHA 3CH8A 5HYSB 1BFVL 2X2YA 3UTZA 5FUOH 4Y8DC 1V7MH 2IBZY 2QSTA 4BSWA 4JRXE 4DVBA 3HMXA 5INDB 2NNAA 5CP7B 1H11A 1H1NA 1T21A 1VFAB 2XPGB 2HG5A 2XQYG 4D8PA 2VC9A 4M6AA 3SE3C 2OZ4H 4IRSB 3KE0A 5EZIH 3BSZL 1TETL 1VEOA 2J2ZA 1E4LA 1VCAA 3K81A 4PJHE 5ABFB 4WKAA 4P4RB 2MCPL 3SKJH 4B7LA 3SE9L 1KIRA 5F70A 1A6WH 1VENA 5L7XL 5FM8A 5F8QC 1DQQB 4JFPB 1OAUL 2G75B 4JFZL 2H32B 3VGHA 3M8OL 3WD5H 4OZIB 5KOVC 1ITXA 4QHMA 4NO0A 2AJYH 1D5ZA 1HSBA 4QLKA 1BFVH 5BV7B 3VGAC 1RZIB 2YDSA 5FKPA 2GJPA 4KZEH 2AK4A 2WZEA 1JNHA 1Q1JL 4OFKA 1JF1A 4A2LA 3MACH 3L4ZA 3OKDA 2P48B 3CZGA 4TVSa 1KBBA 3BN3B 1OD0A 4UBDD 4R0LB 3QDJA 3VIKA 2DTML 1FH7A 1QBBA 3BSZH 3MV7D 4LCUB 5I1IL 1VKXB 1RIHL 1TETH 2OR9L 1WQVT 4MHHG 1PZUB 4PG2C 3VCLA 3QZWG 3V4UL 2QLYA 4ZAKA 3DV6B 4CVUA 5J57B 4EUPG 1XR9B 1CD1A 3SE9H 3GSRA 5M03A 1XR8A 5FM4A 5L7XH 5ABHA 1CLOL 4AH2A 1NAMB 1JHTB 1OAUH 4KZDH 4JFZH 3L95A 3M8OH 1GOQA 4BS0A 1HXYA 4YPGB 1IQDA 1INEL 3VGAB 5F1SA 3EDDA 2IEPA 1YEFL 2ZUNA 1LK2B 4N0RA 3SQBA 1BYBA 2EDFA 2G3MA 5E1HB 1A9EA 4G6KL 3SPVB 3AOFA 2BC4B 2EDKA 4U0RC 5GSRA 3TIEB 4PBGA 1ZLWK 3WD3A 4UQ2A 4YLQT 1Q1JH 1AR1D 4PRAA 3UTSB 4TSAL 1A02N 3RGVC 2AEQL 2DLEA 3UG4A 2GSIA 1XGTB 2XZCL 1OF2A 1U2CA 5SWSA 3FY1A 2L0DA 4ZXBA 5GSVB 3P9LB 4X5XB 4XH2A 5I1IH 2OR9H 4JRYA 1GNXA 4H04A 1NLDL 4HLZG 5I76B 1SMAA 4NUJB 1QPXA 3FRPG 3FT2A 5J1TC 1CLOH 1T20A 2A0LC 3WFBL 1YECH 3FFCB 1CDHA 2ZCHL 3G5VB 3GM0A 1GPFA 2C1OB 4X9BA 4XUYA 4WJXA 5JA9A 1YEFH 4MMXC 1ZGLA 5GGSA 1GZPB 4P5MA 3WSUA 4JPIA 3IDGB 3EOBB 2C7FA 4GO9A 4U0RB 3SKOA 1V3IA 3EYPA 2DIJA 3VRIB 1XD0A 1QNZL 3MRMA 3RGVB 1CFQB 2XN9D 3D87B 5AD0B 2AEQH 4HS6A 3ARSA 1N2RB 4AD3A 2WIIB 1AP2B 3RVUC 2XZCH 2ICEB 4AZIA 4BCEA 1QZ1A 3OKKB 3NZHL 4GKSA 4PJXF 2J88L 1HKKA 3H9HA 4GBXC 4QRSB 2WWKO 4H8WC 3RNQA 3VXMB 3DARA 1MHHB 2Y6SD 5DK0B 4PN2A 2QJDA 3QXAB 1NLDH 5F9AC 1VEPA 1WP6A 1KB5A 1UM5L 2L4OA 5IFPA 1TDQA 2PYEE 4F9PC 5ID1B 3PIQB 3HRZA 3WFBH 2J77A 2H26B 5BV7L 4P9ML 1UZ8A 4HKBA 1W9UA 1EEQA 2PTTB 2AAAA 3KPSB 2X0YA 5CZKA 1J88A 2FRGP 3MLRL 3I02B 4PJIB 3BESR 1QNZH 3DHMA 4NJAH 3VXRA 3BPOB 2A9ML 1ODUA 2LE9A 3MV7E 4BQ5A 2JALA 2QADB 1IKFL 4NYLA 4HOZA 4Z76B 3PL6D 5FO8A 1HVXA 1NCTA 1WBYB 3NZHH 4EVNB 3X3GL 1NC4B 1NKOA 3EUUA 5J8OA 1E4MM 1FH9A 5IB5B 5EU6A 2SEBA 1OSPL 3CLWA 4HWNA 1WBXB 5EPMB 3V6BR 4UFKA 5DD0L 3FKUS 1NAML 1LO2L 4WI6A 1UM5H 4LCWB 1MWAB 1RK1A 2H32H 2UUDH 5E0CA 3REVB 1AGDA 4RGNC 4NT6A 2WMGA 3NBNA 5E24E 4H88L 5BV7H 4OD1L 2UWFA 2PN5A 3QFJB 3VGGA 4EQ2A 1J05B 1QSFD 1U41A 4QXWA 1D6EA 4MNGA 5CPQA 4NFCA 1HJQA 3MLRH 1G7QA 4RGMC 4HA4A 2A9MH 3THML 1I9JL 2GFBA 3M17A 1QI3A 1RMFL 5B22A 1EO8L 1RV6X 3QFDB 4EDWL 5DMYA 4JQXC 1NBQA 5ESVB 3GBDA 3RX7A 1Z32X 4EKXA 5SX4H 5C0BB 1A1NA 5J4MA 2R1WB 4MJ2A 4ZPTB 5ABGA 1OSPH 2YPLD 4PJXE 3W9EB 4OIIL 4ETQB 2Y8VA 4FQHA 4IM8A 1J11A 1CWYA 1S9XB 3W82A 1BQLL 5LA0A 5T5FL 1CDIA 2IWGA 4PJDF 1UQZA 3KPRB 2VWEE 5I15L 1NAMH 1NCBL 1QSED 1A6AB 4RGNB 1G7LA 2DKMA 1JWSB 4PUBL 2NX5D 3CUGA 1TE1A 3X11B 1J8KA 3ARBC 2NZ9C 1HL8A 4BFIB 1RI8A 1B0RB 4E8CA 1HNFA 4JPKH 3AS2A 2XN9E 43C9B 4Y4HD 3BZDA 1OGGA 1YN6A 4EXKA 3I9GH 3ARUA 4XCCH 2DDXA 3L5WA 3HC0A 5E00A 3GEWB 3MLZH 3THMH 4YAQB 4J27A 1NWUA 4X6CF 5KSVB 2Z4QB 1EO8H 1G1CA 4DKEL 5JORA 2PTVA 3VFNA 1HIML 1OGAB 2R1XA 2VL5B 1AGCB 4FS0A 4UOW1 5JIPA 3HPLB 2XTLA 3JWOH 3VFPA 3F7RA 1A5FH 5FDYA 4OIIH 3GRWA 3MGAA 3DXAB 3RHWF 2P8LA 1MCIA 4M29A 4F58H 1BQLH 4H7VA 5T5FH 3P9MA 4WW1A 1EHXA 3ARFD 3SDCA 4JJ5A 3VXUA 4R3SA 5I15H 1NCBH 4WU7A 1HK6A 2P43B 3MUZ1 1IL1B 5LCVL 4L1DA 3GKWL 2YUVA 3ARBB 1UB6A 3F7YB 1MAML 4A6YA 4O5LL 3RNKB 1T83C 3DMMC 3BUYB 3C5ZD 1WCGA 1ZBCA 5BXTA 2W66A 1T7YA 2ED9A 3T08A 3BIKB 3QHNA 3CZKA 3SDXE 1EMTL 4ZE5A 3ZE1F 1YQ2A 4J4PA 1F3RB 4X4XA 2CK0L 4X6EA 1ZLUK 1KLGA 4H8WL 2OK0L 1TVPA 4PFEA 1KTDA 1U8OA 4MA7H 2H45A 2VDMH 2XWTB 5F6HI 1HIMH 4BZYA 1VJZA 3D3VA 3QJHA 4K7FA 3E8UL 1XIWA 5F1NB 5HI5C 4PMNA 3N1AA 4YO0B 1I9EA 4QO1A 3BD4A 3L1OH 5J6GB 2F15A 3EBVA 4OFIA 3VXPB 3RPMA 3O4LE 5CMAB 5JXED 1EUTA 4PLKC 1IC7H 3KEHA 2EDTA 5LCVH 3WL1A 1P4LB 3ZR5A 4RRPA 2ZWZA 4XVUC 1QSFE 3EYUL 3KYOB 3NCBB 2RB8A 1R3LA 4ODXA 4TSBL 4O5LH 1E40A 4GXPA 1R3IH 4KRPC 5C0AE 2WV3A 3K4DA 5KVFL 4Q6IA 4P2RD 4EK7A 1QFWL 2X0HA 1SVCP 1E3XA 3CFDA 4XPGL 2IBZX 3IXAB 2EYRA 5DRWB 4OJYA 2QHAA 3QWOB 4PMDA 1EMTH 2GT9B 4JDTL 1KELH 3EYQC 1F6AB 4RX4D 4G6FD 3UZQA 4W89A 2YPLE 2OK0H 3LN5B 1WSST 4NQVB 1QFHA 5DRXB 4BF7A 4XRCA 4X6CE 1JWUB 3BXNA 1EFXB 5F93C 5IBUG 3O3DA 4FZ8H 1BBJA 3E8UH 3L3DB 4GG6A 4TTGA 1QSEE 3P77A 3BAIA 5CGYC 4NCDA 1S9VA 1DJSA 2NX5E 4LBEA 4H1LA 1XF5B 2OTWA 3HHRB 5DLML 1MWAH 5GISL 1FIGH 1GHFL 5I79A 3WNNA 5C9JB 4GRLD 3QUMB 1URLA 1NSNH 4OF7A 4TNWK 1N0XL 3GIVA 3D18A 2UZYB 3D6GA 1HYSD 3R0NA 4WWKA 1NCAH 2HRLA 2CJUL 3S6TA 4LNRA 1MY7A 4KRPB 1KEGL 1XHGA 5A2KH 3G08B 1IJ9A 2DM7A 5KVFH 5TDPA 2JLLA 1QFWH 2EDOA 1TA3B 5DK2A 1A6UH 2CUHA 1JFQL 4XWGL 5D5MA 1J8HA 4PRPE 3IFNH 4EKJA 4IRSD 2MCG1 4HGWB 1NJ9B 2DQCL 3ZE1E 4LLDA 5IHLB 1CE1L 2HT4C 4I13B 5DFTA 3ZJKA 1IEBA 5E8EA 1CS6A 4W4OA 4PYGA 2E7HA 4HHAA 5F3BA 4UFLA 2Q7NA 2H9GB 2PW1B 1M7IB 3RWEA 2IADA 5KTEL 3DVGA 3ME0A 5DLMH 1MJJB 1F90L 2A73A 5GISH 3CVHL 3C9NA 4JAMB 1GHFH 5E08L 1U2HA 5JW4R 3STBA 3PV7A 5HYJB 2FIRT 1N0XH 2J8FA 4YPJA 3JBG7 3RWGA 5CWSA 3QULB 2CJUH 4ODSH 5FB8B 2IPKA 1BVKB 2ARJQ 4JZNA 3ZR6A 1QO3A 4KGJA 4AMCA 2D20A 3JV4B 5EFDA 2XFRA 3OMZA 3L3KB 2CUIA 3VXOB 1JFQH 4NZRL 1UA7A 2GCYB 4XWGH 1WTLA 3BHBB 3AXLB 3OKOA 1INQB 4GSDL 2H8PA 4L29B 3V2AR 5ADOH 2GTWB 2OWCA 1OAKL 2E9BA 4OB5H 2QV2A 2D7PA 1HKIA 1CE1H 4OQTA 4OZIF 2RQ8A 1G6VK 4X4MA 5IXEA 2FZ3A 3U5UA 1MRFL 4KXZH 3U46B 1W72A 2XRAH 2V3DA 6FABL 2DM3A 2NYYD 5HDQL 5ESQA 1P1ZB 1JPFB 1VFMA 3KYKL 3ZO0A 4IS6A 5DT7A 1MPAL 3GNOA 4PMOA 1ZA3B 4HIIB 5JOPD 2NY4C 1SJVA 1KPUB 1KXQE 3LD8B 1ZEAL 5E08H 3MFGB 4HKJA 1U8KB 3P3YA 4W8BA 4MJ6B 4P2RE 3QO0A 5IW6B 4KROC 1KPVA 1XSKA 3OKMA 1Y18A 2EH8L 1EK3A 2YIHA 1LMKA 3GGWA 5ITBL 4ONHA 4JRWA 3UTSD 2JJSC 2PR4L 1MCCA 3DX7B 2EDDA 1Z0NA 3IGAA 4JIEA 1Q94A 5JHDA 1QYGL 2BVDA 4P9HC 1C5BL 1BGAA 3CFEB 1R5IA 3WQVA 1OAKH 4LIQL 1YY8B 2ADGB 4ZQKB 1JNLL 2NR6C 3R0MA 4AENA 5B38B 2G41A 4YFLI 5DJYA 3L3OB 4PS4L 1GOIA 1WCBA 2VZOA 4I0PA 4KY1L 5DWUL 1V0LA 6FABH 3BQUC 5HDQH 4J3UA 2FJFB 2NY4B 3KYKH 4ELMA 3NJ3A 1MPAH 1HINL 4D6IA 3FFCD 3QUML 1C7TA 5DVMA 1ZEAH 3HC4L 1IGTA 5EC1B 1A3RL 1E56A 4KROB 3PWUA 4WUUA 3DURB 5T5NG 4RISH 5T3XL 3N1QC 3QPXL 2EH8H 1MLCB 3QRFM 1O6IA 3RI5K 1TG7A 1KIQB 3RGVD 5ITBH 2QSCH 1ZKAA 3RILA 2PR4H 1V02A 3TPUA 5FDWB 1L7TL 3CHEA 2B2XL 1QYGH 4YHIB 1IEAA 1IGJB 4M62H 3VINA 2XA8L 3VXMD 2UWEB 1KWGA 2X4OB 4HJGA 1JNLH 3MA7B 3T0WA 4X7FC 4PS4H 2UV3A 3H9ZA 5DWUH 4KY1H 2VLLB 5GNXA 4OZIE 3SCVA 5IMMB 4FA8A 3DVNB 2A0LD 3KYMA 4AEIL 4PGCB 3Q5TA 1ZHKB 4U1HA 3H0TB 5BRPA 3QUMH 2GUOA 1JTPA 2WCGA 3X13A 1MW3A 2C3HA 1FPTL 1NGZA 3HC4H 4JN2B 1NEZG 2C4FU 4Z8FL 1T66C 2YL6A 3VUPA 2W65A 3PDOA 5T3XH 3KPSD 3TVMB 5JDSB 2PF6A 3QPXH 3SOBL 3N1PC 1RJLA 4HS8L 5AG9A 4TUFA 5LBSL 4U3XA 2BMKA 2DB8A 3QEUA 4JM2A 3CGTA 5IR1A 3F58L 3RVUD 4NHUA 3QUKA 5EIQA 5KS9A 3PZGA 1I1AC 4W6XB 2QADD 2VCAA 4MJ4A 3T77A 4MCYA 1L7TH 1H3PL 3UO1L 3E6HA 1K8DB 4GBXD 4OAWB 1GQKA 4LRNL 1NC4D 4QOKE 1WBZB 3L5XH 4HH8A 3WH9A 5HYQA 1G7PB 2XA8H 4ACZB 3RKPA 2YKKA 1L4IA 1TMQA 4E5XB 3LKQB 5IBTH 5JOPE 2R9HC 3V5HA 3EDFA 4JO1H 3TH3T 3OA5A 2R2BB 1UM4H 5DR5H 1LD9B 3FT3B 4JFDA 4LCWD 12E8L 1I3GL 4G8EA 1C16B 3QUXB 2CQVA 1KJMB 4M7LL 4MGXA 3AU1B 3VFVB 1FHDA 1CXKA 2YBRB 4Z8FH 3O9WC 4OLEA 3AHZA 1M6OA 4NKDB 3QFJD 3UEZA 3RM8A 3WQ6A 5F44A 4D9QD 3MV8D 3TYGL 3SOBH 2CIIA 4JE4B 3NPSC 2GK1B 4HS8H 5C8JB 2JIXA 2BXZA 2PYFA 5LBSH 2P44B 1I1AB 1ZLSL 3CZ8A 1I7RA 4EI6A 3F58H 4QXTA 1KACB 5CKAA 3MJ9H 4JY5H 3S4SG 4POYA 4GW1A 1H3PH 4IMKA 1TVHB 4U1KA 4U3CA 2CERA 3SCWA 3LS5L 4LRNH 3O2VL 4LKCA 5C0BD 4GKNA 4M8VA 4XXCC 2C1PA 2YZ8A 1JGEA 4PRDB 3FN0H 4WEMB 3GHBH 1QOKA 3HZVB 4U1SB 1TZGL 3KPRD 5EU4B 3FNDA 4LHUA 4XWOC 2EEBA 4RGND 3MRGA 1IAOA 3T0VA 12E8H 1L0XA 4BSJA 3SCSA 3LB6D 4M6ML 1ACZA 1OM3L 5IW1A 4QHMB 3MXWL 3LQZA 5A94A 4ZUTB 2Q8AL 3BKML 4RZCA 1YNLL 4G8GA 2XKUA 3P4OB 3NPSB 3TYGH 4WTZG 1YN7A 2AK4B 1QD0A 1DQJA 4MSWB 5TGBB 3PV6B 4UDUB 1C5DA 1ZLSH 2W9EH 2WKGA 1H3UA 3HE6C 4P9HL 2ZSVA 5HI3C 5T1MB 3U2SB 3WIJA 3QDJB 5FIEA 2OYLA 5FL1A 3T3PF 1OGAD 5EUKA 1DZBA 3O2VH 5DJ0A 2NY5C 3BPCB 1LG2A 4NRSA 3DXAD 5DZNA 4DN3H 3DYMA 1KGCE 4L3EA 1B3YA 5I1AA 4QYOA 4L4TA 5DQJA 4LPYA 4EN3C 5A69A 4B9ZA 4XNMA 3LRSA 4HUNB 1HN1A 2ZXBA 3ARBD 2NZ9D 4M6MH 1WTGT 3KPSE 1W9PA 1OM3H 4Z77B 3MGOA 3MXWH 5A8QA 1FNEA 2WBWB 1A2YA 2Q8AH 2I07B 4S3KA 1A7OL 1YNLH 5E95B 2O9PA 4H25A 4YDVB 3CZJA 4FTVE 2ED8A 4FMFA 2WWDA 1DTUA 2WWCA 4UQ2B 3HE6B 3L4VA 2P7TA 1BFOA 2BRQA 2GITB 4O2CA 1DFBL 3O8XC 1OF2B 4QRQA 1DVFA 1X1NA 3AMKA 4E4PA 4U7SA 1ONQA 1TZIB 4XH2B 3HPJA 5D7LB 3PWPE 1VHPA 1FL3B 3AREA 1YMHB 3KVQA 4LCWE 2F54A 5I8EA 1CFNB 4KJQC 2WMJA 3SHSA 2MFNA 4Y5XA 4YBLB 4UILL 3FT2B 1PIFA 3R1GL 4IRJC 1NDGB 4TNVK 3K74B 3WF4A 3HNVH 2GJZA 1WB0A 1JWMA 3C8KA 3QFJE 2PBGA 2BJML 3NCYS 4HKZA 1HT6A 2F53B 3QIWC 1E71M 5DD3L 3T1FA 1U91A 4P5MB 4XC3L 2J8HA 3MRJB 1RUKL 5KG9B 5IWLA 1NP2A 1HDMB 3WMCA 3H2WA 3MRMB 4HC1A 3MRPA 1FP8A 3MXVL 1LP9F 5C09A 3O8XB 4M1CC 1NC2D 4WGWB 4JQIL 3LPFA 4HBQA 1QEWB 4X9HA 3NDZA 2D3LA 4GKSB 3VFWA 1EGJH 1EFXD 1NMBH 5D96C 5HI5D 3STZB 4GQPH 3KPRE 3KR3H 3EMQA 3MMEB 4HUUB 4C56B 2R2HA 4RGNE 4HUWA 3T3PE 1OP3H 2NPLX 4M93B 3BFOA 1XGYH 4IRJB 3BMWA 4PLKD 4UILH 3VXNB 1R3KA 5DRZA 3GBNH 5FYKU 4P49A 4PJCF 4XVUD 2NY6C 1BFTA 3QIWB 4OD3H 2BJMH 2H2SD 1PSKL 4KRPD 1IT9L 3EDJA 4OFYD 5DD3H 2AK1L 3HE7A 5T3XD 4HKBB 5E2UL 5K33A 1T89A 4U1GC 4XC3H 4R97B 4Q97A 1RUKH 1UD2A 3HMXH 2DKUA 5FA4A 1KEMH 2IJ0C 4IOIA 5DGQA 2UY4A 4QWWC 3WJJA 3L9RB 5C9KA 3EYQD 3RIFK 3NIGF 4LLUA 4PJ9A 3AYRA 3MZTA 3HRPA 3FFDA 1OGAE 3AIRA 5JLZB 3W0WA 4JQIH 2ATPA 4NGHL 4NYLB 2EICA 2CXKA 4HZLA 4C54A 3E0GA 4KJYA 3OAYH 1T0MB 2RTSA 3P4LA 5CGYD 1HJWA 2XM2A 2ZIDA 2SEBB 3UAJC 3T09A 3UTQB 4HXBL 2FJGA 4JFQA 3LKSA 1UEMA 1R24A 3JTSB 1MEXL 1ZE3C 1UG6A 1LE9B 2IQAA 4FXGB 5DEZA 2OQJB 4RWHA 3AZRA 1EIBA 3HFML 3AFLA 1SVZA 5AZ2L 2B4CC 5TD4A 5HYJD 1A7RL 4NT6B 3FMGL 1N6VA 2VCBA 4HV8A 3VNYA 1PSKH 4U1GB 1IT9H 4LARL 3U9UA 1C93A 2V5CA 3VILA 2AK1H 2ICWA 2KZ1B 5E2UH 4MXWL 1E73M 4KK9C 5L8LB 1IT0A 1D6EB 2VXUH 2X4SA 4LCYB 1G7QB 4PRWA 3CCHA 1E6SM 3O3AB 5AG8A 2GFBB 1G7HA 2XWJB 3W24A 2DQTL 2HT4D 1LP9E 4NGHH 2G2RB 2NY5L 1I8MA 2ZX9A 3OTTA 3OXRA 3CU1A 3OKLB 2V3FA 4AD2A 5JQHC 3WSQH 4LEXL 3OR6A 4KAQL 1ZBWA 4HXBH 1BD2B 2JTDA 1IAMA 1MEXH 3TBSB 3ZL4L 1E6PA 4NRYB 2OSXA 1FCGA 4E42B 3MV9A 3QEHA 3HFMH 4QCIB 1G7LB 1SYSB 3VVGA 2WNWA 5AZ2H 1TPXC 1A7RH 2O5XH 2ZOXA 3GSOA 3MBEC 3FMGH 3FHAA 2OI9B 4PJCE 4YDJA 1P84J 2J47A 1OSZA 1KULA 1VFFA 4LARH 2YD5A 4Q74A 2KL6A 1X6NA 5JPMB 3P9WB 2VZVA 1QHZA 3BZEB 1BGGA 4N1HB 1YN6B 2HFGH 5IBUB 3B9EA 1CT8A 4JPVL 1IFHL 3MMUA 3VM5A 2BDNL 5E2TH 4R8WH 4OCMC 5E00B 1EX0A 4OSUL 4PY7B 3NIGE 4XVJL 4YHEA 2Z8VC 1XH3B 3G6LA 2DQTH 1AI1L 4NQXA 1U8LA 2ZUVA 2CEQA 1N5YL 5JORB 1VESA 1KTRL 3N85H 2MANA 2RCSL 3VFNB 4P8UA 5A1AA 3NFNB 4RMVA 1WEJH 5CJXA 3NCCB 1AQMA 1G5AA 2YD2A 4LEXH 4KAQH 4QRRA 2P8LB 3MLVH 2NY4D 1GJIA 1ZA6B 4H5SA 2V2XA 4WW1B 1W9VA 1CG9B 1GVYA 5M17A 4JJ5B 1P7QA 1NMCB 1ZV5A 3WUFA 1TPXB 3BQUA 2PO6A 3GSVA 4EIZC 5T3XE 3MBEB 1LO0L 1BQHA 4KROD 3SURA 1C5CL 4JDVA 2X41A 2YA1A 4DN4H 4CMMA 4FRWA 2EXWC 5IF0A 3MRFA 3WLBB 1G9NH 1NFDF 3VDHA 4WDIB 4QRPB 3FONA 4MD4A 4L8SA 1A22B 4IIQA 4LHJB 5ICXA 1E6XM 4YDLC 3BH9A 2A3EA 3VDCA 1UENA 2YPKB 1UWXK 2WP3T 1S7RB 5B4MD 4W93A 4PRNA 4XVJH 2E8YA 5F1KC 1AI1H 3TA9A 1KTDB 1BOGA 4WV1C 3RUGF 2V5MA 5TH2A 2RCSH 1EDGA 5F7EL 2J6EL 3Q6GL 4PCTA 2OP4L 4U0QB 1BECA 1W1YA 1JPGA 3MLWL 5DO2C 5D6DC 3KPQB 2DIBA 4J1UA 1W2VA 2BCKA 4JB9L 2NQCA 4HIXL 2Q76B 1NBVL 2OL3B 1J12A 1DBJL 1N8ZB 2FL5B 4OGXL 2VRAA 1JDDA 1J18A 1FNSL 3TVMD 2C9AA 3OZ9L 3P0VL 3DBXB 4G7VL 2UWEF 2XSBA 5HD8C 1CD9B 4HX1A 2Y2WA 5CJ8A 1E1EA 3L4XA 1MFBL 3G04B 3QA3A 4M48L 1BMGA 1FFPB 4M1RA 3B4NA 1JGDB 1P53A 1CGYA 3KPMA 1MHEA 1SY6A 4IOFC 3MA9L 5T1LB 2ITDB 2ZNWA 1MCSA 3OGVA 1OCWL 4XRCB 1JMXA 5MENB 1D5MA 1O5DT 3BXNB 5D1XA 3O3EB 5F7EH 3O3DB 4OGZA 3Q6GH 2EXOA 3RJDA 2RGMA 2OP4H 5I17B 2XTJE 2MKWA 3MJ6A 3UJIL 4TUJA 2NW2B 2V7HA 2XXMB 3O9NA 3MLWH 4LLMA 4DCQA 3UYRL 2B4CL 1DLFL 1XF3A 5E8NB 1PYWA 1EQPA 2VX7A 1GOHA 4JB9H 2HJKB 3QUXD 4HIXH 1NBVH 1T66D 2A38A 1US2A 1SEBB 1DBJH 3D18B 4YQXL 4OGXH 1MJ7L 4WWKB 2LTQB 1S46A 3HCVA 4YHNA 2ZCKL 1FNSH 1S8DB 5DUPL 5IROC 3P0VH 5FCSH 4G7VH 3LV3B 4PJGA 1NFDE 1PFCA 1I1AD 4JG1L 5DK2B 1WDRA 1BQSA 1FZMB 5IKCA 4QXUH 1EGZA 4WHDA 4Q7NA 5SWZA 1D3CA 1J8HB 1W3LA 3QAZC 2G5BA 3MLXL 1CFTA 3RL1A 2AP2A 3F12B 3ZOAA 1W32A 3MA9H 4NFDA 1OCWH 2R9HD 5E8EB 3HC3L 1DQLL 1U95A 4FNLL 3RUGE 4ZG1A 4HHAB 5F3BB 4F9JA 4F7MB 1QFWM 3O6FA 3RVTC 2GTZB 3VJ6B 3RWEB 3WDQA 1H5VA 5GGVH 1T2QL 2VITB 4N0YH 3TO4C 3PZIA 3HNSL 1PX4A 5IB4A 4TULH 1ES0B 4HIEB 1JI1A 3ZHDA 2FGWH 5GQBA 4YX2L 5CWSB 3I6KA 5D6CB 3WL0A 2VXVL 2ZCKH 1BLNA 2Z93B 2WBJC 1Q0XL 2AK4D 5JR1L 3PHOA 1QO3B 4CDHA 1R85A 3N12A 2X1XR 5KSBA 4Z6AT 5I1JL 3NUKA 3U57A 4XVSH 4JG1H 3QAZB 3LCYA 2UWEE 2LVCA 5ITFA 1R5VB 4M7KL 1ZTXL 3SDDA 1XF2B 3OKOB 3QDJD 3MLXH 4YUEL 3FXYA 1S7TB 2AEPH 2DDQH 2BOCA 1BYCA 1RUML 1NKRA 1VGKA 3B9KC 3FO1B 2J8UA 3PTKA 4JKWA 1NEZB 4UIKH 3HC3H 5C6TL 3P73B 1DQLH 3GRWH 4XWOD 1HHIB 2V2WB 1MNUH 2IG2L 5D9SA 4L1HA 2OL3L 4OZHA 4PJFB 2VXQH 3TO4B 3V79C 1P5VA 1RZKC 3Q5YA 4HUXA 3HNSH 1AD0A 2VT0A 5MERA 3ARXA 3TNNB 4A6YH 5BVJA 3LQAC 3TPKA 2MKLC 3ARYA 4PB0L 1EBPA 2VXVH 1KC5L 1BAFL 1Q0XH 5JR1H 3OJ2C 5C6PB 1DQTA 1K8IA 3HE6D 5I1JH 5C0RH 3T0EE 5HI3D 3SJVA 2R1YA 5GS2H 5FKAA 3CFKB 4DW2L 3ZJ6A 4ZSOA 4M7KH 1ZTXH 5JMOC 4YUEH 1ND0A 1DUZA 4XP4L 1Q9WA 3B9KB 1RUMH 5D7LD 4LCIL 2HKHH 4O02L 1VACB 1Q9OB 5ERWA 1IRAY 5C6TH 3VFSA 2J75A 1WCBB 4I0PB 3GXDA 2DYPD 4EN3D 4JFEE 3ZKMC 4BQ6A 3QXWA 4OF0A 5I9QC 4BKLA 2IANB 2IG2H 5FYKE 4ZTOH 2F19L 2OL3H 1E27A 3AMGA 3MNWB 1ROWA 5EFIB 5A8PA 1M1SA 4JZJC 2WMHA 2F53D 4KUZL 1M7XA 1RY7B 3S4SB 3PWUB 4YHLH 3MRIB 1XCQA 3DTXA 4V28A 4WY7L 2PKDA 3NOIA 4KI5C 3RMEA 2I5YL 1BAFH 1N4XH 4BUGA 2X1PA 1JK8A 3QIUC 1PAMA 3ALPA 4U7KA 4LYQA 3O8XD 5C3LD 7CGTA 3UJTL 5FOBB 4DW2H 1A4JB 2CR6A 1OVZA 4M4PA 1E55A 3V7AG 1R3JA 3DPBA 5ECJE 4APQC 1FGVH 1ACYL 1B2WL 3UMTA 2R29L 4YK4C 4C56D 3KL0A 4O02H 4UAOB 1MCEA 1H4PA 4P59L 5B8CC 2XKNB 4U1NA 4IRJD 3EYOA 1BWMA 1I3RA 5C1MB 2GKIA 2AS5M 1KJVA 1WC7B 3CD4A 2YBTA 1JF5A 2XWDA 3P2TA 4U1HB 2F19H 2WK2A 4UQ3A 3T3MF 4GAYA 4JZJB 1XYZA 3QIWD 1SFSA 4OV5B 2AJSL 2AK4E 4YHMH 1Q6CA 1WV7T 4KUZH 2VN4A 4NM4L 1QFUL 3TGXA 4Y5YC 3D85B 2ENYA 3TLRA 1RD6A 4WY7H 4D6CA 4HD9A 4DFHA 4EZMA 2VDNH 4XHQA 3VFRA 3QIUB 3HR6A 5J9PB 2EYSA 4JG0L 3QEUB 3QDJE 4JM2B 2Q7YA 4M1CD 1FHLA 3ULVC 4NHUB 3P11L 2BSSA 3BT2L 1XCTB 3SE4A 3AS0A 3T77B 3UJTH 4P7NA 4AZHA 2YOCA 1I1YA 4OZFB 4RBPH 2J5LC 1F8TL 4YK4B 4R90L 1A21A 2QQKL 5B8CB 1OP5K 1DEEB 1QNRA 1BPLB 3QH3B 5E6IC 3V5HB 2WMIA 3MJ8A 3GIZL 1L9MA 1D9KA 4AD5A 1UYWL 3KXFB 3V0WH 1FIEA 3QJFA 1A6ZA 5IJKC 4MX7A 3CLFL 3H3PL 3U6RA 4ZOBA 2AJSH 3HA0A 3LN4B 4Y5YB 2R4SL 4NM4H 1QFUH 1MJ8L 4QWWD 1H0GA 2DM2A 4PREB 4NO3B 5SWSE 4J8RB 4QLRA 4JG0H 2AV1A 4R4ND 1S5HA 1I7RB 4QXTB 3P11H 5D7LE 1K9TA 5B3NA 3BT2H 2DT0A 2MJWA 5FUCC 3VIMA 3JTTB 3UJJL 1DP0A 2VTFA 4GW1B 4U1KB 2YBUA 3T65A 2I9LB 3UAJD 4LKCB 4RSVA 2X4PB 5KSAC 3AISA 4N0UB 1ZXQA 4R90H 3WL9A 3S88L 3IDNB 1ZT4B 3JZ7A 4HCRL 5E6IB 2QQKH 1MYRA 4PGDA 1W72H 3KJ6L 1A3HA 4I3RL 4NQEB 1BD2D 4H8HA 4HWZA 1RZKL