4MB5A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag5
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 172
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb5A01
2DIEA 3QXTA 4PJDB 4HPGA 2XICA 2P8PB 3N1FC 2VITA 5IW6B 2H9GA 3L1OL 1C8YA 2IG2H 3EOBA 3QEUA 5I1JH 1WBXA 3L3OB 4BFIA 4LSDA 1OSPL 4XZUB 1FPTL 5D1ZC 2GK1B 1JE6A 1FJ1A 3ISWA 5IMKA 4M93B 3CC5B 1QA9B 1ZXQA 4JREB 2XVKA 2BVYA 3CSYA 2UWEA 1A7OL 5C0FA 3SPVA 2JCCA 4UIKL 3ARFC 2CITA 3LKOA 5D2NA 4R27A 1U3HC 4MZ2A 4UR9A 1A7RH 3EZ8A 2OXGA 5AC5A 3BPNB 4NWUH 5T1KB 3NZHH 3VFNB 3VH8B 4IPLA 4YO0A 4GUPA 1KULA 3FN9A 4C56A 5IBTL 3PV7A 5BCAA 1W1PA 4N9GB 2AEPL 4D9RD 2GUOB 2ITCA 1CICB 1GCFA 4ZTPH 5CZVL 1XSJA 4GXVL 2FWOA 3BGFC 2F54E 4QTIL 5FXCH 5DJYA 4LSQH 4ONGH 3IGAB 2R15A 4NKOA 4MA3B 4PMVA 1FP5A 2XQYK 3RFZC 1U41A 3W0WE 2H32H 3SKUD 2R1XB 4MD0A 4APQC 3QISA 3DX9A 1T7XA 3QA3A 1CD9B 4ZENA 2FGWH 4Y4KC 5DEFB 5I19L 5KJRH 3C9NB 4S1QH 2QPSA 4EN3C 3MJ9L 1OLZA 3DUHA 1MCWM 2B1AL 2YIHA 3D39E 3MCG1 2JIEA 4YIQA 3CLEH 1E43A 2WZHA 3L5XH 4FQXD 2ZOKB 4PJ5E 5CILL 1MPAH 5HDLA 1NBVH 3X11B 4TSAL 3MGTA 5AD0A 5E56A 4FQJH 4OZGB 1S9WB 1KB5A 5C1MB 1RPKA 1DBMH 4D9LH 1MFDL 4TNWK 3HUJA 1E4LA 4MJ6A 3VXNB 4RGNE 1FVDB 5I1KL 4TPRL 2VLJD 2ED7A 4HX1B 4W70A 5DJZB 3ABZA 2EDJA 5ISZA 1LQ0A 1K3IA 1CCZA 1NCAH 3OLEA 3BPOC 3PWPE 2J6EL 4G8GD 1PLGH 2AW2A 2VLRA 5DD1L 1UD2A 3GH5A 4ZUSA 1HKJA 1P53A 3D69A 4G8GB 2FYYA 4I5BB 4BH8A 2OZ4A 2IQAB 4HJ0D 5CP7A 1HWGB 4JFED 4PJ9C 4XBGB 4OD1H 3F5JA 4MNHB 1DR9A 2YBTA 4GKLA 2NY1D 5TE4H 4M1CD 5EU6D 6CGTA 1CFSA 5DSCB 2E7CA 3EYQC 4LOUD 2QKIB 4QXGH 2OWWA 1LK3L 5E9AA 3VU2A 1OW0A 1B3ZA 1BJ1H 3T3PF 2DICA 1V7NH 5HYSB 2CK0H 5TPWL 1U8JA 5EA0H 1VHPA 1KN2L 2PKDA 4NFCA 1OM0A 2F74B 4U1LA 2B1AH 3R8QA 1VBUA 1I9IL 2ZCKL 4FHBD 4AEHH 4XP4H 5L9DL 8A3HA 1IGCH 3NPZB 2C1OB 4NHUB 2HVKA 5EC2A 2F61A 3M1BB 3STLA 2G9HB 5F7YC 4PBVC 1I1AB 1XH3A 2DQEL 4GJTB 3UAJC 4OZIF 4MSWA 5C9JB 3B2VL 1FE8H 3WDJA 1A4JB 4HUVB 4PG9A 1AXTH 4XNZB 3D48R 4AISA 5FO9A 1ED3A 1W9DM 3QZWG 4U6XA 3WQVA 1UR1A 1KXTA 2GW5A 3TWCH 5CSBA 2J4GA 2F19H 4P2OC 5C0AE 3SCUA 4RL3A 1OF2B 2PBGA 4Q2ZA 3WCYA 3OAYK 4BSJA 1MY5A 5I76B 35C8L 2C8NA 2GJ6E 4LLVB 2HRLA 3FHQA 5KN5B 2JF1A 1SYSB 2OJEA 4U49A 1WKYA 2WXDM 4Y2DA 1F6AA 3WUWB 3LQMA 4JRXB 2BK8A 4CDGC 4K8RL 4L3ED 5EBLB 3MLYH 3QULA 3O3AB 1BQHB 5HGBB 3RKPA 2CBUA 4WIWA 2BC4B 3VIGA 4OTXL 4JAWA 4EANA 3QHNA 4KHTH 2VT0A 5HI3D 1JWUB 1AKJD 3IB4A 1KJ2A 3UR8A 3OB8A 5GZOC 2Y36H 1AE6H 4K7PX 4RIRB 5DUBB 3TPUA 5F1NB 2I9LA 3FB7A 5CBEB 3EOBB 1YHTA 3RWHA 5CBAB 5A6JA 1UJ3C 2G41A 4XXDB 3P4OB 5I9QB 1UT9A 2KH2B 3A6OA 1AP2B 4G8IA 1DBBH 3WUWG 4BA8A 5FUCC 4ODVL 3WJLC 1CE1L 3ZDZF 1P4BL 2YWZA 2XVLA 1SJEB 4S1SL 4OLZH 3HPLB 4C54A 3ZQ9A 4OIAA 3U0WL 1F58H 2B4CL 5IHRA 1NFDA 5DD0L 1Q94A 5E8DH 3WMSA 2OI9C 2XTJB 2CD0A 2Z93A 4XMKL 1E4XH 2WAHA 5MEPB 5F7KC 4CJ1A 2DQIL 4X9BA 1CWVA 1MJ8L 3FO9A 4P4KC 2IBZY 5C0CE 4XXCA 4LGXA 3RUGB 3KPRD 4BSVA 1S7QB 2R1WA 2XQBH 1TMQA 1CICA 3W28A 4G9FE 4ODUB 2HJKB 4NYLB 1JTPA 3LH2L 3PGDA 2CDEB 5EU4B 2QHAA 1X3DA 3INUL 1LEIB 3BGMA 3F7VA 4MA3A 4C7DA 2GCYA 4ZG1A 4Q0XH 3QCUL 4YO0B 4ACYA 1MW1A 3UO1L 4WI8A 3QHOA 4CD5A 3LS5H 5KVFL 2PYEA 3UTTA 3JWNC 4J8RB 5D7LA 3O6ML 2Y23A 1N4XH 3TV3H 3VXQA 1QNSA 5EH1A 2WC3A 4RNRB 4WHCA 5HY9A 3IJ7A 1A4KB 4HULB 4NRSA 1NGXB 1I3RA 4JJ5A 3SDAA 3GIVB 4JPVL 5E8PA 3U30B 1BFNA 4DVRH 1QNQA 4F58L 1VFMA 1YN6A 4K55A 5CJ5A 4Y19A 4G6FD 1NGPH 5ERWA 4V1DA 5JHDD 4XX1E 5T3XL 4O51A 5C0BE 1H0DA 1UB6A 3MGAA 4B7LA 1OGSA 1A21A 3UCQA 4LSPL 5INDA 3QUYC 3V5DB 1LL6A 3FB5B 1ZBWA 1ZANL 2F54B 2H41A 1LEKA 1QI2A 2VI0A 3D85A 3AVEA 2R23A 4Z7UB 2MCPL 1IAOB 4P23D 3MBEC 4N90E 1O7VA 4PJ7A 5AYQA 2WBGA 2GAZA 3MKKA 2RFXB 1XF2A 4M3JA 2WVVA 2QMKA 4PUEA 2AEQL 4X6DF 1DFBH 3OA5A 3BN3B 3D25A 4FXGA 4XWGL 1GL4B 3D39B 4HMCA 4U1NB 4LVEA 4LHUG 3W11C 2ZPKH 5KAQF 2ZKHH 3BH9B 5AWNL 4U7SA 4UFLA 4JJ5B 3SDAB 4LBEB 4OZHF 1BFOA 1MNUL 1QRNB 2JK5B 4HGWB 1I7UB 2XWJA 5IMLA 3FQRB 3BIKA 1Y0LA 3IFLL 1ZWIB 3V95A 1RD6A 2OYMA 4PGCA 2ZX8A 3G6JA 4RDQF 1X44A 1GZQB 2XWTA 2GK0A 4P57A 2PN5A 5D1QA 4KWUA 2XUCA 1ZLUK 2XNAB 5BS0B 1JGVH 1ZHLB 5I8OL 3S96B 4TUFA 4XNUL 1MJUL 3UTSB 1LO0H 3ZL4L 1P84J 1I8KA 2BSED 3GI9H 4PJIB 2EJ1A 5GJTH 1AHWA 3FQRA 4M6NL 3VWKB 2GITA 2X70B 5A1AA 4MXQC 1ORQB 2H32A 1R3KA 2ICWJ 1X9QA 4I8DA 3HMXA 1VGEL 1HINL 1IC5L 4OQTH 2XQBL 2HVJB 2HKFH 4MJIA 3U4BL 4X7TA 1MJUH 3OKNB 3IDYB 4LDEB 3H0TA 3GUTB 1TMCB 5B39G 5HGAA 2O9RA 4OCSL 3TCLB 4X4YB 3QEQE 2W60A 1IKNA 5D1ZD 3HRZA 4PJFE 2VRKA 5KS9A 3NCYS 1CEOA 2W5FA 1UR2A 4BZ1L 3DMMC 3HA0A 4WJ5B 1XD0A 3PWPD 2QQNH 2XSAA 1H15B 4RAHA 2YRLA 5FYJD 3JZ7A 4R4NC 4WEMB 2X4OA 4EDWL 5IWLC 4XNYL 1A6TB 2FBJL 4PJBE 4R96B 4TVPE 5ICYA 1KFAL 4GG8B 5HDRA 4JDTL 2ZUQB 3R8BB 3IJSA 5EBLA 3EDJA 1IGFH 1EDTA 4D6GA 3GBMH 3VWKA 5BW7C 4MD5B 2ZUYA 2NY0D 3SGDI 5IV2A 4XNZC 3RRQA 2DJ4A 2YL6A 1CXEA 3RO8A 1TJGL 4M6OH 1DDHB 5I8CA 3V4UH 2W0PA 1MHCA 4XAKD 4FP8H 3PNWA 3O41B 2HT3C 5MI0B 4U1SB 1S7UA 2GK2A 2R4RH 2IFGA 1F00I 2F74A 5E2JA 3ZT6A 3CCHB 4TVPD 5J6HA 1JFHA 4XXDA 4CU7A 4F3FA 3WUEA 1GAFH 3F5WA 1AGCB 2YJQA 4XCFH 1LEIA 1LE5A 2H3NB 3QYCA 4TRPH 4CD8A 2DQFA 3BXNB 3K81A 1F97A 4YHZL 1OAQH 2YL5A 1XAUA 1F6AB 1KPUB 2DYPD 1WAAA 3TJEH 1XF3A 4JREC 1JVKA 3P30L 5HVWA 2IFFH 1NCCL 4NKDB 4OKDA 4UI2A 1R0AL 1WUNT 4BZ2L 4MHHI 4Y5YB 3BCFA 4JG0H 3VFPB 1H0GA 3QDJA 3MA9L 1NWRA 1MHEA 4PIRF 3QPQC 1VBRA 5EOCH 4LASH 2DQJL 3CXDH 4JANA 4X4ME 4YHKH 5ESAA 5KN5A 4FQXA 2E7MA 2ZWYA 3QDGD 3LN9A 1JPTL 3D18A 1S7XB 1H0DB 1UB6B 5L2JB 3QPXL 3DIFB 1DQTA 1RZGA 1RK0B 5CSUA 5IQ7H 4Y1AE 5J6HB 3ZO9A 1FNEA 2VDKL 4G9FA 1OD7A 2YD2A 2YWYA 2BVQA 2EE6A 1NM9A 3GTNA 4HS8H 1BZ9A 1BFVH 4PRHB 4PTTB 1JWSB 3FOLA 3GJFK 2BFVH 3DX6B 4PJHA 1JGLL 1A7NL 3GNRA 1S7XA 3RWIB 4OI9A 2EIZA 4AIOA 1NFDE 4NQDA 3UETA 5IMMA 3VO0A 1WIPA 4QRRB 1NLBL 4I0PC 4PUBH 4NQXB 4F7MA 5D93C 2KZ1B 2AQ2A 2YS4A 4WUUA 5F97E 5SV3A 3P11H 2I5YH 3Q6FA 4E8DA 5DWUL 4FOMA 3WXVH 1YZZA 3SE4A 1RHHA 3H3KA 5T1KA 3VFNA 1F2QA 5EDXA 1WZ1L 5GHWL 3KLDA 4P5TC 5L7XH 4NZTL 3AIBA 1PQZB 2CETA 2F53E 2I24N 1J10A 1N64L 3QDHA 3MSPA 4D6IA 3IFPB 4QHUA 5KSAD 3KVQA 1GVIA 3QCUH 1FNHA 4I3SH 3WL9A 3QXAB 4OFDA 1A7QL 3AGVA 4P7NA 3FZUD 2QBWA 3F8UB 4IS6B 4Z7VB 1A6ZA 4UZSA 4XUYA 5JHDE 1ZHBA 5KSBB 4XMLL 3WO3B 3A6BL 4UV4H 1BGGA 4CN4A 3NCBB 3ULVD 1DANU 1I7RB 5C92A 3HI1B 1JGDB 1QBBA 1Q72H 4JKWA 4KROD 2VLKD 3DSFH 5SWZB 2RGMA 5EZIH 1BVKB 5FUOL 3X13A 3VPLA 1AY1L 1FLRH 1QI3A 4GG6E 4ODXA 4MNQA 1CDBA 1QR1A 1V0NA 1N5YH 3AREC 3FQTA 2J74A 5TE6L 2ZUVA 4LLWB 2VITB 1IGCL 1CQKA 1MRCL 4XPHH 3TYGL 3U57A 5JXED 1AO7A 5F96L 3TC9A 4X5XB 2QSCL 1ISZA 3V4PH 4KHTL 5K9OB 2DLFL 5DEZA 3RVTD 1AIFA 4ODWA 3PDDA 1H5BB 4UNTA 3EDEA 3TZVC 3NACL 4CN6A 3QO0A 5C0CD 4L8CB 4NRXA 1N3NB 5D1XB 2N4IA 1A6UH 4E5XB 1ZWIA 3DHMA 5TE4L 3WL0A 1SVCP 3CDFA 1JJUA 4R2GD 2WVVB 4KU1A 3HNTH 4FNLL 4G6KH 2OS7A 3BAKA 1D5IL 2NZIA 4TUJB 1BLIA 3LS4L 5F8RC 4MQXC 1MFVA 5TF0A 1JNLH 3MGTB 3CFEA 1ROWA 3MXWL 5DJ6B 1A6TA 3MBXH 4I2XE 5J1TC 3QRFM 4J1UB 3HS0A 1F8TL 4PG2C 2NR6C 3LZFH 1IM9D 1GJIA 3O4OB 2XNAA 5BS0A 1IAKB 1WAAF 3TO4A 1QW8A 2ADGA 4HWNA 1NGYB 1IQWL 1ZJAA 1ZT7B 4QF1A 2A3BA 4IM4A 3B8SA 3VRIA 2UY5A 2FLRT 2WM0A 2ZUUA 4GLRI 3W2DH 4JFFA 1J7VR 2QADB 5HGAB 1BAGA 2YD3A 1FNSH 1CFNA 1E55A 5IOPA 3CJJA 4NN5B 3UJJL 4HCRA 1BGXH 5IVXE 2XFFA 3R1GH 1C08A 4KK8C 1N6VA 2X1IA 3KGRA 4NQCA 5E4EC 3VFSB 4JPKL 2IANA 1SBSL 2GJ6D 2G2RA 2A73B 3GSQB 4DM2A 2DD8L 3KPSB 4UTBL 3SDAD 3QUML 5GGSY 5HPMB 3VXME 3GMQA 4OOZA 5CWSA 5E08L 4NDMB 4X99A 1QO3B 3GIZH 4I3GA 4BYHA 4L3CB 4KKCC 2PCPB 1JUFB 5JO5A 3HI6H 1A9EA 2X4RB 4DKAA 1DCLA 4PJHE 1DQJA 1HH6B 2AI0H 4KJYA 1KTKE 2J8OA 3BKMH 4F8QA 4CNIA 3MRFB 1UXSA 5C07B 2CBVA 2EE3A 2H2PC 1SBSH 5BWFA 1WT5C 1G9NC 3F7YB 2A3EA 1MI5D 1CG9B 2NY7L 4PJBF 4UOZA 5KANG 3MLTA 4TPRH 2XT1B 4TOYL 5KG9B 4KQ4L 3VIFA 1U2YA 1HKIA 5CZVH 1E6PA 2JB6A 3N11A 1PG7L 3UYPA 3C60A 1C5CH 4CGTA 3G08A 3K74B 4AIZA 5CCKL 2X4PB 3BIBX 3AYSA 2DSZA 1ES0A 4MQ7A 4HFUL 2BXYA 3TT3H 4KROB 3VGHA 3S36L 3U0TA 2X1OA 4HZ8A 1EERB 1WIOA 4A2MA 1U95A 2XG4A 5CUSH 3I02B 4J4PD 2A6DB 2P8LB 3U46A 4A6YB 4LLUA 2IGFL 3GHEH 2Z31D 3FQNB 3WFZA 2Y24A 1WAAE 4ZSOA 4XCEA 3LKOB 2O9OA 1RUKH 1CTNA 4WHYG 2OJZL 2WQRA 1D5IH 4KVNH 1WJ3A 4OCXL 3AM8A 3KJ6L 3MUZ1 4HJJL 4AL8L 3RTQA 4NNXA 4P7RA 3EJJX 1H11A 5FDWA 2XXMB 3G6JF 1S3KL 1I9JL 1BBDH 3IRZA 4L8DB 4PGEA 2QHRL 5E6ZA 5L2KD 3O3EA 4I2XA 3AFLA 4LRNL 4OI7A 3I3EA 1BVZA 1JWSA 3ARSA 1RZKH 3FOLB 5DYOB 3QWOB 5DQJA 2ZUSA 5CGYD 1A6VL 5EO9A 1UD5A 2FH6A 4HJGA 2KKQA 4I3RL 5AAWA 4DFIA 2B39A 2W4XA 3HAEA 3UZEA 3L7FB 4DKFL 4Z18A 3FRPA 1FZOA 4PMUA 4NYLA 4QHMB 2OYPA 3V4VL 2OX5A 2DI9A 1XGQA 3VFMB 3WFCL 4GAJL 5IHUH 4HIIA 1XR8A 4GS7B 1MFCH 3KPLA 2I27N 5C0IB 4HS6B 4QHNA 3LKNB 1HNFA 1JDCA 3WFLA 3R0MA 4TSCH 1N82A 2WBJC 4L4JA 3T77B 5CPQA 4AZ6A 5I0ZA 4M7ZB 1QG3A 4EOWL 1FAIL 3TBTA 3LCYA 4MA8H 3WIIH 4YDVA 4KJQD 4MJIE 4PGEB 5T1DL 2NW0A 1OSZB 4NSKA 3L4VA 3C5ZB 2XZCH 3D69B 4P5TA 3NN8B 2IBGA 1RULL 1E6RA 4OB5H 1U8NB 1VFFA 3CD4A 4N90D 2BDNL 4LAJH 4L9DA 2C1PB 4HOWA 1MVFA 3Q6GH 1GOIA 2D7MA 1JGUL 4WW2B 3BGAA 5HGHA 2DRUA 1GGIH 4QRQB 1K6AA 4M24A 1LDPH 3QUZB 1QOXA 5D7JC 4K3DH 3ARBC 4MDIA 4LYQA 1RZFH 4XMPL 4Y16A 1FVDA 4OCSH 2FJFB 5F3BB 2YUWA 1QEWB 2A83B 1RMFL 1X5GA 2VXQL 4G8FA 3RJXA 2X1WL 2J77A 4LCWA 2ICEB 2EBNA 3QUYA 4CMMA 2Y72A 2AJSH 3N1AA 4IRSC 5GS1B 3AHVA 2EEBA 2MJWA 2EDYA 1A0QL 1WBZA 1PSKL 3FNDA 4MHHG 3U7WL 1KBBA 5BYWA 1QVOB 2DWDB 3RHWF 3I6LD 5E9DA 3O4LE 1UHVA 3IAGC 5AY7A 5F6IB 1OWRM 4YIQB 4CW1B 5FM5M 1HSAB 1NFDF 4U6YB 5K9QG 3H9SA 2DH3A 1D5ZB 3VXOB 3L9RB 2Q7YB 1I7TA 5T1LB 2B5IB 3B9VA 3OQ3B 1DL7H 3GHBL 1TR1A 1UZ8A 1ODAA 4GRMB 1PJ9A 1RZ7H 3BMVA 4UQ2B 3MMUA 1MNUH 2CIKB 1L0QA 4JHZA 1YQVL 2G9HA 5ISZB 2RFXA 2LU7A 4G9FD 5I75B 1HKFA 3BPOB 3EO0B 4B16A 3A47A 4HUVA 4JFHE 2E9IA 3T0EA 2EYSB 1F3DJ 4G43B 1JGVL 3QUYB 1BECA 2F15A 4LFHG 3OAUH 3O4LD 3KYKL 5GS1C 5A2AA 4I48B 3W53A 3PHQA 1KEGL 2NPLX 2XA8H 2BJMH 3RGVD 4OT1H 4RWYL 1B0IA 5DJ0A 2W65B 2Z91A 4I18A 5E6ID 3U1SL 3KAAA 1MCHA 2X9XA 4PG2A 1N2RA 5EOQH 1PG7X 7A3HA 4KMTH 2P7TB 2VTFA 2A6KB 4JY5H 1EV2E 2G60H 3QNXA 1C7SA 2VDRH 4M48L 3VXRB 5IF0B 4AIUA 3AS1A 4ZSOB 1F6FB 4TVPL 1JZ6A 1OARL 1ED7A 1NDGA 4RZCA 2A9NH 4RWYH 3K4DA 1E5NA 1US3A 3V4UL 1ZVSA 3HNVH 5KSAA 2BJML 3TF7C 1J8KA 1REIA 1OHQA 4ELMF 1U8KA 2XN9B 2G3IA 4PJGB 2MTPA 4OZIA 1MQKH 4NDMA 2PWHA 5IXEA 4MJIB 2QSTA 3L3DB 4AM0B 2YRZA 3QH3A 4FTVE 3QHMA 3S4SB 1LLOA 1I4FA 3I02A 3CMOH 4KAQL 1XF4A 4YDJA 1US2A 3PZOA 1BIHA 1ZVHA 5HPCA 3MLRL 5E2VH 4HDIB 4IHOB 5L6YL 1ISXA 2Z35B 4HHAB 4CD7A 3MJ7A 4I9WD 1JN6A 4JFDA 1T1ZA 1DSFL 1TVHA 4GW4B 1HE7A 1KLGB 1G9EA 1UQZA 1VFBB 1H41A 4A6YH 1TETH 3VGBA 1S8DA 1DWAM 1QSFA 5CP3H 5C0RL 4U1SA 4BK5A 2VCCA 5JORB 3EOAA 2MKWA 2QR0A 2J8FA 1KB5L 3QIWA 4YXKH 3RUGF 4EKXA 3ARTA 4F9LC 1AC6A 2C3VB 3DRQA 3MV9A 3O8XC 1NCDH 3V6FB 3CZLA 3UC0H 5CIPH 3EYUL 2V5SA 3Q0HA 5IV2B 5JXEA 1S9XA 3HZKB 4Q6YA 5EU3B 1TPXB 1JPST 1S7WB 4WRLA 3CUFA 1CR9L 1XF5B 2H26A 4D8PB 4BK4A 3ZYJA 5M95B 3NAAH 3L3JA 4ZFZA 3RPKA 1MCPL 4MVBC 4D0BA 3HUJF 4ZO8A 5DDHB 3MV11 4YXLL 3GI9L 2M1KA 4NC2B 4CAGA 5CJXA 4XPTH 3BQUA 1QPXA 2ZWZA 1PDKA 5GGRY 1I3RB 1MJ8H 2HH0L 2Q86B 2XZAH 2QL1A 1WISA 3CK0L 1KUMA 1FNGB 1RJYB 3STBA 5C2BH 2XQYG 5I1DA 3GMNA 4W84A 5DO8A 4RE4A 4PMRA 2VXSH 4RE2A 1D5MA 3SOBL 1XIWD 5F1OB 1SHMA 3HZVB 3QCVL 4K3EH 4QOKB 5HVFB 2P5WA 4RMRA 3CZGA 4LF3A 5TH2A 4H8HA 2ADFH 1J1OL 4RGND 2JB5L 2OCFD 1ZLSL 1ZU8A 5LQBL 3ZTNH 4FQ1L 3KYNA 1CFTB 4X6EB 5I1LB 5J13C 1TG7A 5LKNA 2IPTL 4BUGA 1JTTA 3LQAL 4XAKE 2TAAA 5I0DA 2HLFD 1V02E 5CG0A 2BNQE 4ZOCA 3F12A 4EN3A 3VA6A 3WQWA 4QHLB 4L29A 5IFTA 1G1YA 2J47A 2OSLA 3GB7A 4UBDD 1A4KA 2HG5B 2HKHH 4JQIL 1T2JA 3GSNH 4KQ4H 2FH8A 3MUGA 5BMFH 3AS3A 3WIJA 3C09B 1C16A 5KVEL 1Q6GA 3BWAA 4LARL 1MW2A 5ICXB 1MI5E 1VEOA 3AXLA 5KW9H 5AG9A 1LE9B 4MMZC 2AVGA 4CMMB 1FO0H 3EYFB 4UMGA 2J7CA 3ESVF 4ZUVA 3UXFA 2DQGH 5FOJA 3DX6A 4PJHB 3PHAA 2ZCKH 5JW4Q 4R7NA 2VQ1B 2Q8AL 4L9LB 4LLMA 1ZGLB 4MNMA 5CSYA 3UJTL 4M02A 2BOCA 4LYPA 2J8UA 2D9QB 4YDVB 4OZFA 1B2WL 1D2KA 2DM2A 1LO3L 2W59A 5GSVA 2YK1H 3RZCC 1V7MH 4LGSB 3SCRA 3QDMD 1FHDA 1W1TA 1YPZA 3JWDL 2HLFC 3K1DA 4UOJA 4X9IA 4LCYA 5HJ3B 4OLEA 1GHFL 5BJTB 4Z7NF 3UJJH 2Z91B 3QIUB 3CPLB 4IOIB 4GRWF 2HMID 4GZJA 4QRRD 4AZCB 4FFYH 1MRDL 4KQ3H 4P2OD 3ARBA 1J0IA 3HI1A 1FHGA 4Y16C 3UTSE 2W1NA 5CUSL 1YNKH 3CFEB 4YH6A 3DV6B 4PJIE 1E4NA 3CX5J 5A2CA 2V6HA 3RGHA 1ZHBB 5KSBA 3SQBA 5DMGC 5HGGS 3WNOA 3QUZA 15C8H 5ACMA 1FVEA 4WWKA 3P9LB 1U91A 4QNPF 5GRUH 1QNRA 1AGDB 3BHBA 3HAEG 4RSVA 3MYJB 4GKOA 4X5LA 5EU5B 1OGGA 4M8QA 3MJ9H 4H26B 4YEFA 4NOFA 5KJRL 2ZE0A 4W93A 3R1GL 3I3DA 3NGBC 1G0YR 3G6AB 1BGXL 5A6SA 3SGKC 5CAYB 3MOQA 2OMNA 5TE7L 4UQ2A 2NXYC 4U1IA 1W32A 5DMIH 3GSWA 2P43B 4NCDA 1K8IB 4F9PC 5GRUL 1OM3L 1QR4A 3L4UA 3ARDC 3KPSA 4Y88A 3V0VA 2IWGA 2EE9A 2IH1B 3ARED 4BH7B 2Z8WC 4KGJA 5EB8A 4X4XB 4S0TD 4ZFOB 1T0MB 4YQXL 5ABEA 5MHSE 4Z77B 3GK8L 1V3KA 1RJCA 3O2WL 1G6RH 2EZ0D 3G5YA 4RRPG 3QSKB 3KWWB 4C4KO 1MOEA 3NCJH 1BBJA 2FR4B 2EECA 5F7HA 5I1CL 4Q9QH 1QLRB 1QNZH 2HA1A 4NIKB 4JHBA 4YHGA 4AH2A 4LSQL 4ONGL 3KE0A 3BEVB 5D5MA 5DVKA 5FO7B 1U58B 2CYGA 4QP0A 1P6FA 4AIXA 1Z2KA 1HN1A 4X8XA 2VLKE 1FP8A 5M03A 4X0KA 3CZEA 4E0RB 5MI0C 1FDLL 2XFYA 4FRWA 3AFBA 1A3LL 3OKKA 5DK0A 5FUCE 3OIHA 1JYWA 3QNYA 5F89A 2N7BA 5B8CC 3P3YA 3OGCB 3U9UA 2CO7B 4NOBA 2O93L 3ARUA 5C0RH 4DWSC 2E7HA 2FL5A 5DFVC 2H8PB 1TTUA 5E7FA 5TF1H 2GTWA 1BD2B 4P5TD 2LAAA 1YNLH 3I2CH 1D9KD 1NJ9A 4NWTL 4F57H 1G9HA 3DUSB 4NQTA 4PJAE 1KCUH 3P2TA 1DBJH 3F5WB 2APXA 1E72M 1T3FA 3MNWA 2BRRH 4MNGA 4PGZA 4CJ0A 3BSGA 4LPTA 4QNPE 1NMCC 5D9MA 2PCPA 4G3YL 4GXPA 3BXNA 1W91A 4AEFA 3KPRE 3VFSA 5JIPA 1JHKH 3Q5YA 4XV0A 4M03A 2NZ9C 4DEPC 5I1AB 2IFFL 3OKDA 1VJSA 2FX9L 3UYRL 4HMDA 4YUEH 5L2KB 4QHLA 1U8MB 5JQ6L 2ZUXA 3HI5H 4PTWA 5CPSA 1VB9A 3AAZB 2CR3A 2XIIA 2UWEB 2ATPA 3B2UC 5D4YA 1X5IA 4TRPL 3DBXA 3LRGA 4YZFE 1T1WB 1EOMA 1O5DT 1LHZA 5TH2B 2XGBA 2VX5A 4TNVK 5F3HB 3MRFA 3S3PA 3NBNA 3GSNB 3D18B 1U9KA 3KYNB 5I1LA 3VD9A 1ZGLP 2FX8L 4PY8I 43CAA 3OB0H 4A6YA 3EO1A 5I16A 1MWAL 5ALCL 1V0KA 1MLCA 1VCAA 4PJEA 1H49A 5FFLA 2G75A 3WENA 2X09A 1JI1A 1MPAL 2WV3A 5JA8B 1XFPA 4CN1A 2YDQA 3OPZH 4QTHA 4L3EE 1HI6B 3BP7A 5TE7H 1GGYA 1TCRB 3WH8A 2QADD 2CUHA 5HI5C 2YUXA 3MLRH 1S9YA 5K9JH 1EOKA 3EAKA 4LEXH 2NY6C 1MCPH 4LCYB 3T0ED 3O11A 1HXJA 1JHTA 5D96C 3CVIH 3WUFA 3CC5A 3C2AL 2H26B 1I8IA 4PRBA 5HHQB 4MXVE 2YKLL 4OV5A 2BNRD 4X5XA 4ZS7L 5E6YA 1MCFA 4JFUA 2P45B 4X98A 2V5RA 1DLFL 5GS0C 1RUPL 1AR1C 2NQCA 1U8OA 1WLHA 3GZAA 2ZNXA 1XGPB 1SMAA 4N0CC 3AZRA 4RQQA 2Z1KA 1MRFL 1U8QA 2OP4H 2AQ3A 3GDBA 4KK6D 4DZ8A 3C09C 3ILPB 2VZUA 2OSLB 4NPYB 3ZE1E 1DHKA 3HC4H 4NFBA 2K9UA 3CDCA 5FL1A 1G84A 1XZ0A 4HP5A 3IAQA 5SWQB 4M56A 2HT2D 2AJSL 4XCNA 1KGUA 3PUCA 3LKNA 1D6VH 3TT1L 5C0IA 2FD6L 3SCNA 1UG6A 1IGFL 5ICZA 2AXHA 3RVVD 5C0JB 5EU6E 3C8KA 3LQZB 1J11A 3U7YL 1QFWL 1QI0A 4M5ZH 5JW5A 1A64A 3ROOB 1I7ZB 4YHZH 4XPAH 1M03A 2F54A 1QACA 3CFJB 2VR5A 5J89A 1IKNC 3B83A 5E70A 5A8NA 2YXFA 1VGKB 2JJSC 3GJEA 3P0GB 1DQLH 4YE4L 1ODZA 2R23B 4IMLA 1W8OA 2IANB 5A2KH 4NQEB 4K8RD 4K07A 5F9OH 2I60H 5D8ZA 1IAMA 3U7YH 2C9AA 3QEQD 3PBGA 2YHGA 2UY7A 4CL7A 3ZT7A 5EULV 1PZ5B 3KYKH 2OL3B 3QDGA 1Q6DA 4JHAL 3AIWA 1CBVL 2HYMA 1KCLA 2Q87A 1DEDA 4LSSH 4YDIL 4PREA 5I76A 4HU0A 1XSIA 3BQUD 3PWPB 4HG4J 2R2BA 4MA7L 2ZUMA 4G7YH 3SDDB 3GNML 2YA2A 3UTSA 1U6AL 2PYFB 3LPPA 1KEML 3C6LB 3IFNH 1HK6A 1T5WB 4NNYA 5E03A 5E8EA 4KRLB 1T5XB 3BRDA 2JF7A 3E8UH 3K1KC 3MMWA 3ZE1F 2CLZA 4DKDC 5C9JA 1TETL 4OT1L 4P46C 5F1IA 1CBVH 3DHJA 3ZO0A 4P5MA 3TVMA 3IKKA 3RDTC 1OGBA 1OTSC 2EC9T 5HPOA 5D5MF 3WIHH 4XBEH 1D6VL 3EKCA 4AG4H 3B8YA 2AK4B 2FEEL 4RE3A 3BT2L 3DNKA 3VXOA 3CMOL 5TQ2H 3D5HA 4IDJL 1HL8A 1JZ5A 1T21B 3GMPA 3QIUD 3HAEH 4X6FB 3OXRA 3CU1A 4R3SB 5DRWA 1PG7W 2E8ZA 4D0CB 2ZX9A 3NABL 1GZPA 1T0NB 2P24A 3HC0B 2D7TH 3GO1L 2VVNA 43CAB 4QWWC 5FO9B 4ZXLA 1INQB 3BAWA 2FJGB 1RZGB 4FK9A 2GI7A 2VXTL 4HWUA 1CXLA 3SBWC 1JMXA 4X8JA 3IJ8A 1RZKL 4L8SB 1BMGA 1A3RL 5J8OA 1NCUA 3U0PB 3HJEA 3WHE0 5LWYL 5FK9B 4J8RA 3A67L 5D7LB 4JY6A 1QFWH 2FIKB 2ZX5A 1HDMB 1IAIL 1WP6A 5B8CA 4WKHA 5IEKA 1KB9J 4DWSA 4RMVA 3RVTC 3DVNB 2EIDA 2V2XA 2CKBB 1MWAB 4PJEB 5TQ0L 2V5YA 3RX8A 1T66D 4MS8D 3WIFB 1R3IH 3W39A 3IK2A 2DL9A 1NCNA 3TFKD 3NOIA 2SEBA 4NKIL 1GOGA 1TIUA 2VDLH 3MRBB 1YEIH 3O9WA 2XZQH 3MOBH 2OQJB 4OZ4A 3LQAC 4QYOB 4ODUA 4YPJA 1QBAA 1QSEA 3HAEB 3J8F7 4QLJA 4BA0A 2VJXA 4KK5D 2HWZL 2EKSB 4PJAF 1KPVB 2VABB 4JM2D 3WIFA 5DGRA 1FH7A 2WLYA 3CZFA 3V6OE 4M6MH 3UTQB 1JZ3A 3BAXA 2CJUH 5FEBA 2MNUA 3SDCD 3QJHA 2KDGA 4P7OA 3UDWA 4U4BA 3SIMA 3G04B 3OZ9H 1MFAH 3BPLC 1OGAE 4MAYC 4GAJH 1QUNA 4APQD 4FQXB 4PLOB 2FJFA 5F3BA 5C09A 4UFKA 4EIZC 5CD3A 1DBBL 2HTKD 4XGZB 4NZUH 1YYMH 1FE8L 4I2XB 1PYWB 3O3EB 3HR5A 4MCYA 2R8SL 3T2NH 1HKMA 1U8IA 4XVUD 4GOSA 1BVLB 3CMJA 5DA4A 4E4PA 4LK4A 2HRPL 5DS8B 1FN4B 4UAOB 1ACYH 3IS0X 3NN8A 3OGSA 3TIEA 2WLZA 1KIQA 2VQUA 3T3PE 1WZAA 3KL5A 5FKAA 3S34H 2FLBT 1UM5L 3L5IA 2D0HA 3THCA 2BDNH 5JQ6H 3OR6B 4PJ8A 2CDGA 4A4AA 3HZMB 4UTBH 4X98B 3TZVA 4S1RL 1FNFA 3CHEA 2DH2A 4X5WB 3OG6B 5J7CC 3TNMB 4K7PY 4EOWH 4WENB 5EU4A 1KBKA 3AREB 2NY4D 1L9MA 1RY7B 4F79A 1YEFH 1JHTB 1H3PH 1UENA 2GJJA 3POCA 1OD9A 4GZEA 4HEME 3BYTA 3RVWC 1ZJBA 2ITDB 3BHBB 1JDAA 2HVJA 1OTTD 4TUOB 4FZEH 1PKOA 2JJTC 1JF1A 3HZVA 2J12B 4XHQA 5TF1L 1IC4L 4QHMA 3KPQB 5E8EB 2C3GA 2IUZA 1Y18B 1XD1A 1E4WL 3VGFA 1DBJL 5E00B 5ID1A 2P49B 3GSWB 4O2FB 5J1SC 4F57L 5I1EH 5I2IA 4Z8FH 3TO4C 4K7PL 2VXUH 4XCYA 3GMRB 1VACB 1N5AB 4ZNEE 1UKPA 3A6BH 4UV4L 3L2MA 2AXJA 4G80B 1ZHNA 3OKMA 5I1CH 5BRZE 2QTEA 3F6IA 3TCLA 3SEPA 4AY0A 5EWIH 1BX2A 2KPNA 3NCOA 4KUZH 2DI8A 1LO3H 3PZGA 2VXUL 2AS5M 2E7LC 2CBJA 3VGDA 1M7IA 4Z8FL 2EDFA 5KZCB 3ROOA 2BOCB 1RHFA 3NCMA 2QADC 1QZ1A 1RUML 2ZZUT 4F15C 1F6LL 1WPCA 5EG6C 5IG7B 1PLGL 1WWWX 1H0IA 5DD1H 4DJMA 5CIPA 1UYWL 3C8DA 5GNXA 1J86A 4G8GE 5LGKA 3DECA 3X11A 2GSJA 3HS0B 2XTJE 1UB5A 1G6RL 4KQ3L 3OLDA 2APBA 1JNHA 4R97B 1BOYA 3GMMA 4AD3A 4K9EH 1C5DB 5DFAA 4OCRL 3G6JE 1PBYA 2CMRH 5D6CA 4OGZA 4JN2B 4FLSA 2BHYA 4J3WA 3BKCL 4ELMA 3HNTL 3TM6A 2IAMA 5HHVL 5EUOA 3MA7A 4WI9A 5H35A 1W1YA 1UD4A 2JIWA 2X4TB 4HS8L 4YBQD 5CEZE 3ARDD 5DJ8B 3GZKA 5E5MB 5GGUB 3X3FL 5I1IH 4HUMB 1J1OH 3P9MB 2V9TA 4M3KB 4K9EL 4WU5A 4PJ7E 2IPUK 1KN4H 2NW3B 4ETYA 4M1CC 2C7UB 4RMSA 43C9B 5IB3B 2P4AB 3S4SG 1F3JB 1JGEA 2YD5A 4NHCH 1GH7A 2XM1A 4NKMB 1QRND 3APGA 2IGFH 1HSBA 3U48A 4XTRD 1ULVA 3DUUA 4POUB 5IF0A 5DDHA 5T33L 1XIWC 1MCDA 1RU9H 1N0LA 2DM4A 2ADJB 2WBKA 2ZXBA 2AV1B 1Q6CA 4MNLA 1T0MA 2WHMA 3MNZA 3AB0B 1IM9B 4XVTH 1GQIA 2V5MA 5H94A 4XHJD 1RZKC 1HXMA 2EDDA 2G2RB 5D7JD 4EK7A 3GSNA 3OZ9L 1U8KB 2OLDA 2XN9A 4H04A 1KIUA 2NY0C 2VERN 4JN2A 1HILA 3LPWA 4Y2DB 1MYRA 1XF5A 1C8QA 3ZE2E 4HZ6A 4HPYL 1MHHA 5FO7A 2CMRL 1TFHA 1HCVA 1XGRB 4OCRH 1U8PB 4RMUA 1SJHB 1UA6L 4DTGH 1NP0A 1A7QH 2E9LA 2VABA 3JWDH 4X0KB 4EIGB 3W29A 4YGVB 1OPGL 2V7HA 1T1WA 1AQDA 1JN6B 4JFDB 2UZXB 5F7LB 4Y5VC 1JWUA 4F7CB 4Z7NE 2ATKB 4NRRA 2PNDA 3WSQL 1BQSA 4AMKL 3KPPA 4J4PA 3SBWA 3SKNB 4FP8L 1PQZA 3SUUA 1BPLB 4Q58C 5DQ9B 3SGJA 2VKWA 4UILH 1A3HA 4HT1L 3ULUE 1J1XH 2D31B 4ORZC 4GZIA 3QH3B 3PN8A 3FAXA 3AZSA 1IZJA 1MWAA 5GIRA 1IEBB 5IMOA 4DN4H 2ZUTA 5FKPA 4PJIF 1JWMA 3RWDB 2B8OT 4GKNB 5KW9L 5F70A 4JO3L 4YHNA 1W3JA 1H3XA 4NZUL 2R2CA 2VL5A 4GRWE 3V5HB 4BFBD 4RISL 3WDPP 2NY3C 3QUXB 1Y6KR 1FNSL 1R8LA 4U0QB 2A2QT 2H1PH 1AGEA 4FTVD 1HXYB 2YEZA 3BW9A 5C0CB 5ABHA 4XP6L 2WW8A 4PRIE 4NO3A 4XCCL 5EIIA 5C8JB 5BROA 1T3FB 3MNWB 1BZ9B 4PRHA 4PTTA 5H37G 4Q2ZB 5I74B 1TENA 3V6ZA 1MLBA 1R7OA 2Z4QB 3FFDB 2FEDC 3VI4F 4MAYD 1HKLL 3RWIA 4ZAKC 1WCBB 4Q9RL 5A8QA 2EPOA 1NFDB 4J23A 3DGGA 4K3EL 1FL3A 3KJ4C 4GW1B 4QRRE 5IVZA 1MELA 4NUGH 4TTUA 3BVNA 3K7UA 1NAMA 1QSEE 3FT4A 4WHDA 5MEOA 2DJUA 5HHPB 5I18H 3VIIA 3QEGH 5C7XH 4EBQL 5FB8A 1A9BA 3VFUA 1TCRA 5IVXF 4AG4L 4NGHL 1WBYB 3WIHL 3EMQA 3N1QC 4V1DD 5JHDA 4HD9A 3AMLA 4OJYA 4TQEL 3IDJB 4JHWH 3SQOL 4PMDA 5HOSA 2YD9A 2R56H 1I3VA 1U3ZA 2PO6C 5I8OH 3F5KA 4GMSL 1E4IA 5IB5A 5D9SB 3SO3C 4JFHD 5HD8C 3WQ6A 2RCSH 3RNKA 3CUPA 4WUUE 1UFUA 1G6RA 5ANMB 5FO8A 5JIHA 2Z92B 4DKEL 2ZG1A 3TN0B 3C5ZA 2P5WB 4P5TB 4BZ1H 2JE8A 4B7IA 3RWFB 1XR8B 4G7YL 5GRZA 3STZB 3O3DB 4NQSB 4MB3A 1G7LA 5HHMD 4OZFG 2WYSA 4LCCC 4LLMB 1WGOA 4X9GA 1YUHA 5KOVC 5DLMH 3IANA 5I3DA 5AD0B 5HHOD 2XV6B 1TJGH 4M6OL 2BNQD 4XPTL 1DBAL 3QUYD 4QHKJ 1HJVA 1ZS2A 3GBDA 1Q9LB 2A3AA 3L4XA 1GJWA 1XH0A 1YEJH 1C16B 3ILQD 4H26A 1A0QH 5FECA 3KDMB 1UWRA 2ZJSL 5BRZB 1FGVL 5BXSA 3QWRA 5IHZB 2ZOLB 3BT2H 5DEFA 2EDRA 5CHNB 2DSKA 1XGYL 4JPIA 3BYYA 5HJ3A 5IESL 2D1ZA 2IBZX 1ZA6A 4DWSD 2YPLE 4IIQA 3MRNB 4KZEH 5I77A 1P4IL 1GAFL 2QQNL 4PJ9B 2G60L 1XCXA 1IAII 1R24B 1W0WA 3AC0A 3QIBB 5FO8B 1NGPL 4HXBH 2Y07H 5DO2D 1BYDA 3BAJA 2R1YB 3RIAF 1WFNA 3BD5A 2CKBL 3S35X 4M5ZL 1HHIA 3G5ZA 4MJ6B 4OLVL 4HKJB 1G9NL 2XY1A 3L7EB 2EXOA 2DWDA 1V3HA 3AQUA 1KWKA 1JGEB 4KZEL 3TN0C 1E6OL 4MJID 1HINH 3MOAH 2VR4A 4OFPA 3JV4B 2HFEA 4ZPVB 4MDJA 3WE6A 4G8GA 4I5BA 4BH8B 2CDFB 2X4UA 3MJGX 5FYKH 5KG9A 4JL1A 4JEGB 1HCFX 1VFAB 5IB2B 3FKUS 1XCTB 5CEYB 3VWJB 4C83B 3RGVA 4LPXA 3VCLA 3OAUL 4OF6A 1DBAH 1QFWM 4X80H 1QI4A 3HC4L 2X05A 1U93B 5IHZA 4NO5A 4Y4KA 3UJIH 4X6DE 1K9DA 5IJVB 4PJDE 4EQ2A 5EU6A 1LVEA 1EMTH 1OAKL 2IH1A 4BH7A 3DXAA 2BHUA 1NC4A 3V0VB 1LG2A 5F9WB 3JV6B 3L6FA 4U2ZA 1S8DB 3M17B 3SJVA 4F80A 4LSPH 4P9HC 2VMFA 3Q6GL 1GJUA 2J8UF 2A38A 5JMOC 3TIDA 1E1FA 4K94H 1YEDB 3PGFH 3VWKD 4O2EA 4HGMA 3RY5A 1DQJB 1HH6A 5TFSL 3RGVB 5GGUA 4XX6A 4WY7H 5DHYB 5EZLB 3K2UH 2E0PA 3OSKA 4GMSH 3VGAC 4EDXA 4P48A 4ELMB 4I13B 5CWSB 3GMQB 4NNXB 1NQBA 3P0YH 3QGVA 5I66A 2BVPA 3KJ6H 4MAUL 3JUYA 2D4DA 2A6DA 1JWMB 3RWDA 5E4IA 3WFCH 2Q8BL 4JKLA 1KNOA 1MJ7L 5CKGA 5KVDL 5GGQH 1YNTB 3QOMA 4O02H 4V2XA 2VZ3A 3NPSB 1FNAA 4EUPG 1ZT4B 4HWZA 4HJGB 4DGIL 2WWKO 4WVRA 3BH8A 3AHXA 3LH2H 2P8LA 4MJ5A 3FAWA 2DQHL 1UZ4A 1V6WA 5T3XH 5JXAH 1VDGA 2DQUH 4U7MA 2UVFA 2VLJE 3QIWD 5JDJA 2NX5D 5JA9A 1EMTL 4L3EA 1A6WH 4OD2B 1FAKT 2Y8KA 3LKPB 4KVCL 1GORA 2JKXA 4WLCA 1W9BM 4AD5A 1A1NB 3NIDF 4HZLA 4I77L 4K7FA 1GHSA 5H2BB 1CNVA 3FO2A 4LLQB 5DJAB 1WTLA 3WMCA 4WO4B 5HHME 3AU1B 2D3VA 3TESA 3LB6C 3VOCA 1A7BA 1G6VK 2RAMA 4PSPA 3AXXA 4E41B 3LSOA 2JCCE 1LMKA 3W0WD 3W9DA 3ROLB 2QR0B 3GK8H 2AJVL 2EDKA 3SE8L 4I4WA 2APVA 1JRHH 5BXPA 5D7SH 1FP9A 5FF6B 1MY7A 4BF7A 1MUJB 1NAKH 3MUAA 3QCTH 2P8MB 5AZ2L 3ETBF 1OSEA 3VTRA 3RUGA 4BSVB 5ICZB 2Z0BA 1KLFA 1KJ2H 4UINL 3FQUA 1U3YA 3OR7A 5DMIL 1H8OA 5A43C 4M43H 2D0FA 2HJKA 3CVIL 3LKPA 3RDKA 3MYZA 3PQYD 2AEQH 4X5WA 5EUKB 1S9YB 1LP9E 4EI5D 4ONFH 4UTAH 4PN2A 4J12A 4HTYA 3HPJA 3RX5A 2R0LL 1UZ1A 2ARJA 1WFUA 4AD1A 3O45A 2FWOB 3RZCD 2DL2A 3HR5B 5ALCH 2UZIH 5EBAA 5D2LB 2BMKB 5MEOB 2XM2A 1VEPA 3S37H 2WZIA 2XWDA 2FATL 4WTWA 3CZFB 1ZBVA 3KDMA 3KPQA 1FN4A 2UY2A 1OP9A 4GQ9L 2DIAA 5A2LH 1BX2B 2G4FA 4JO4L 4PLKD 3G6DL 4M5YH 4NM4H 1AH1A 2ZOLA 1NMAL 2NR6D 5M17A 2VN7A 1X5XA 3IJHB 1A1OB 3TBTB 3THMH 4GQRA 1G7JA 5IBLD 1M71B 4Z2IA 1A2YB 1FG2A 1HHJA 4PJHF 4WTZG 4QRUB 1AD9B 1M4KA 2RJMA 1IL1B 4RAUB 3QDMA 1V7ML 1UH3A 1NFKA 2KUTA 1X5JA 2Z9TA 4G6JL 3LPOA 5ESQA 4PRPD 3O6MH 3N12A 1Q9KA 1VSCA 4Y8AA 1WEJL 1YC8A 4N9OB 2Y5TB 4F2MB 4KK8D 5BRQA 5DGQA 4QRRA 3H9SB 2CIKA 5FYLL 2OTUA 3SGEI 3CLFL 2X4OB 2IAMB 2J6EH 3VXMA 4HOXA 1UZ8B 1FV1B 4XVJL 4MA1C 2Z92A 5E2UH 5IVNA 3MV9E 3WD5L 3RQ3A 3BEWA 1VADA 3PIQA 3CFDA 4KI5E 4M7JH 5JNYB 1JNHB 4UT7H 4FQJL 2LU3A 5L2KE 5GNZA 3FY1A 2AP2A 5E9DB 3RVXC 2VURA 5E08H 3H42H 2HAZA 2B0SL 3EGSB 5I2UA 4FQLH 5C0JA 2GTZA 4L1HA 1B31A 1Z5LA 1KG0A 2YKLH 3BKCH 5T3ZL 1FV1A 3VIKA 4P2CG 3FB8B 3LKQA 3RIFF 4UIMB 4EI6B 4CADA 4ACZA 3B4NA 3PG2A 1MFNA 4XBGA 3SDYL 4LOUC 1EHLL 1IFHL 3C9NA 1N7ML 5DRNA 5I6XB 4X9HA 4HK3N 5F96H 3LEVL 3MACH 5ESQB 2ZWLT 4PJ9A 4RDQG 2BSRA 2GTWB 4QTIH 1OP3K 1EQCA 2D49A 5IEHB 2E7LA 1KPUA 2QJDA 4DN3L 2YDSA 1GZPB 1T0NA 4DGYL 1QLEH 4RGNC 4UFHA 1EUUA 1G0CA 1IGJB 2IH3B 5HYJE 2NT0A 4G6KL 4IRJA 2FECL 4FQQB 2BP3A 5F44A 2FEEI 2CPUA 3DROA 3TVMB 3BZEB 3L5XL 5C07D 1HHKB 1BIIB 2CPCA 5KEZA 3ZTJH 2XFXA 4L4TA 2EYTA 2GTZB 1MW3A 5JUEL 5BW7A 4OBSA 3T2OA 1GOHA 5H35B 1DWJM 5ANME 4U6XB 4YFLF 2PYFA 5KOMC 3VUPA 5KS9F 5D9OA 1B90A 1CECA 5IFJA 4UOW1 1MAKA 3UTQA 3AB0C 4R3SA 2PW1A 2C4FU 3QFJE 1PX8A 4XTRC 3NIGF 4OIFA 5FA4A 1SEBA 4Z7UE 1HHKA 1CZ8L 3GJFA 3DURA 2LFGA 1NAKL 3BW9B 3O9WB 2EXWC 1TQCB 5CILH 1U92B 4NZRL 3VG0L 4NN6C 1IT9L 3MREA 4E9LA 5JOPE 1FH9A 3WKML 4QRTA 3OX8B 3KPOB 4GG6A 4L3CA 4PLNC 1ONQA 3T2QA 4MVBD 1EPFA 3H7BA 4L8SA 4KK6C 4DUXA 2W0FB 3DVGB 4X4ZA 1MUJA 5DHVB 3TIEB 5B3NA 4ALAH 2CGRL 1H4PA 1MH5A 4GKZB 3B9KA 5F6HI 3WNLA 1FDLH 2R2HA 3VFGH 1OGAA 1QFOA 3AHYA 1JK8A 3MMDA 1V8HA 3QWRD 4DOHB 2YPKB 2C3VA 1WZ1H 2QSVA 5IGXL 1OARH 4FQXC 1RJZA 3MSDA 4MXWL 3GH4A 4OZHA 4ERSH 1YECL 3CTTA 1W72L 3PGCB 4TVSa 3EYFA 2OYKA 3R0NA 4AIZB 3UBXB 2XVPA 4LEOA 1BF8A 1N5YL 3P77A 3L3KB 1HWHB 3T2NL 1T1ZB 1TVHB 3T4AA 4LARH 4X6DA 3GSRB 5A6LA 3QHTC 1QKZL 2WUCH 1S7QA 2R1WB 3O6FD 4ZNCD 2EKSA 5C2BL 4FS0A 4EE9A 1XZ0B 4PJ7F 5GHWH 3ZHKA 3C5JB 1BLNB 5SWZA 4HZLB 2UV3A 3FT3A 5GSVB 1CZ1A 3CZKA 3CLEL 3ZJ6A 4XCNB 2BFVL 1CFQA 1KLUA 3QEHA 5CJ8A 3ZHLA 5BOZG 5CS7A 4YFEA 2YBRA 2P1YA 4X6DB 1S5IL 1F4WH 4Q6IC 3NAAL 2DGAA 1W0VB 4QRPD 2CRZA 2VDQH 3EYPA 5B39A 4WHYH 1LGVA 5LXGL 1Z6JT 1JBJA 4RAUA 2DI7A 3F62A 1NCAL 1OAYL 4PMXA 4WUUD 3QHFH 1KB9K 3DJ9A 2A0LD 3VFRB 4C56B 5D70H 1J8HA 2YKKA 3FT2A 5FKAB 5EZIL 4GUPB 1DWFM 1S46A 4JDVB 1CQYA 2F53B 3MRCB 2V5TA 4L29B 1G7PA 3ULVC 1P7KB 5HVHC 4W7WA 4ATDA 1I8IB 4PRBB 4PYSA 3Q48A 3BESR 1QSFE 4XCYB 5IFAH 1JFQL 4YXLH 4BKLB 1IAIH 3NIYA 4QCIA 2ID5A 4UIKH 1OGTA 4Y0GA 4YPGB 4JFSA 3BX7C 5EZJA 3FB5A 4LYRA 4JRXD 5JW4N 2OL3A 3ARGD 3BDBA 3VMNA 5LQBH 3ULVH 5KSBE 2ADFL 4ESKA 5E8PB 4K8RC 5D1QB 3RAJL 2WVSA 1A7NH 2AXFA 1XCQA 2XN9E 5LVEA 4Z76A 1G7PB 2VRJA 5EIVA 3EJZC 4HU8A 2ITDA 5E95B 4HUWB 4YNYA 2FEDD 1R5WB 4FTVB 2FGZA 1TVDA 1FVEB 2DQTL 2AJYL 1ECEA 2P47B 5AZEL 4LCWD 1WCQA 2X4UB 4JB9H 5J1AB 3CH1B 3IETB 2GJXA 3ARFB 1U8LB 5E7BA 3SE8H 1OAXH 3OMZA 4OKVB 3QNZA 1CXFA 4RRPA 4LLWA 1LJYA 4YHOL 3PTKA 3C08H 4KRPC 1QFPA 4OUUB 2OR8A 3LOWA 3U1SH 4LSVH 3QI9D 3KL3A 2F58L 1LO4L 3SGDH 1A3RH 4CW1A 4MADA 2XG5A 1T04A 3DPBA 1JNEA 5A6MA 4OFVA 1T1YB 1IAOA 4KTDH 4PFEA 3MR9B 1AXIB 2FSEA 3GBML 1LO0L 3BD3A 2XRAH 1ADQL 1BAFH 5K9QI 1IEAB 1E4KA 1I9EA 5ERWB 1YMMB 1CLXA 1AHWC 1G7MA 5EC1A 3LRSA 5GGVY 3G6JB 4JFPA 3UTSD 2P24B 1MCSA 2VLRB 1Z5LB 1EJOL 2X7LA 1HT6A 4K3JH 2VLRD 2J6EA 1LO4H 4KH2A 5JBEA 4NQCB 1QNOA 3B3IB 3G5XA 3JTTA 4H25A 4JFEA 4LHQB 4RMTA 3CFDB 5HYQA 5J12B 4PJFB 3G6LA 1XF2B 1BQHG 3WNMA 3EGSA 3RWEB 4Q97A 2A77L 4PGDA 1UZ6E 4WI6A 2OSXA 4W88A 2NMSA 3QBTB 4HG4K 1VAHA 4PS4H 3VRIB 4G6FB 1CS6A 2F5AH 1KCVL 1TVBA 3BMWA 2W9DL 2ZG3A 1IGJA 2IH3A 3OX8A 3FB6A 4EBQH 3SE3C 4CCCA 2WMIA 2F8VA 4IJ3B 5I18L 4POYA 5KBNC 4EDWH 3DUSA 5FD0A 1JV5B 1D9KC 3G5ZB 4L4OA 3W6LA 1FORH 2F58H 2F5BL 1C12B 2IQ9H 2J7GA 3EO9H 3KPSE 4PGDB 1UWQA 3AXHA 4M9PA 3QG7L 3GSOB 1FSKB 3O9WC 2YPVL 2MQCA 2AMGA 3GMLA 1NEZG 2XFXB 4L4TB 1O6IA 3NJ3A 1JPSH 4KY1L 4QLLA 3GO1H 2EH7H 1K8DB 2W60B 1YEDA 5I79A 4Y5XA 2CO6B 5EB9A 3BJLA 1QFUH 1RUPH 4D6FA 5A8PA 4XCCH 5L88H 4C7GA 2HJLB 4GRLB 1HYSD 1I9JH 1WT5A 7FABH 4FQQA 5HYEA 2Z1SA 3ZMRA 3QAZB 2O61B 5DQJB 1K5NA 1BIIA 2WMPA 2DKUA 4HC1H 2VDPH 4WI4A 3BUYB 4JE4B 2ZG2A 1WE5A 3GH7A 3W38A 4TXEA 3D0LA 5ADPH 2J7HA 1DDHA 5I8CB 5DJ2B 3OF6A 5IVZB 4GMTH 3L3HA 4H8VA 12E8L 1MF2L 3F5LA 4F8XA 1RK1B 4YLQT 3O3AA 3PDGA 3ZL4H 4FFVC 3V9FA 1A47A 4PRPA 3MRQB 5C2UB 4MXVF 1DBKL 2EH8H 3MV9B 3VW3H 4G6AD 1EO5A 1CD8A 1JGUH 2QQLH 3BUYA 3JUGA 3DX8A 4UV7L 2NCMA 3FTGA 3U0TB 5A69A 2DQFB 2GYSA 1E9LA 4D6JA 1QLFB 1U92A 1IARB 3GGWB 3JVGA 4BJLA 5GRVK 3U46B 1AGCA 1YEGL 4HBCL 2DDQH 4P9ML 4XRCA 1WNOA 2NY4B 2Z31A 4TSCL 1AGBB 4MNGE 3LIZH 3MLPA 3MROA 1LWJA 3LB6D 1W0YT 2O5XL 1UACL 4XB8A 5DR5H 4HUUB 1AQDB 1J0ZA 5J11C 3A3HA 1ZSDA 3D0VA 4YUEL 1U0QA 1Y6MR 3GBEA 3IRPX 1F2XK 1FVCA 2AXGB 4S1DC 4P8XA 3BE1H 5E99H 3H3PL 4Z0XB 2Y6SC 5GGTL 3RPIB 4P2QA 5IB1A 2GDUA 5DZLA 3FO1B 2L0DA 1HYRC 4K3DL 3FW6A 4M7LH 4F8TA 4GINA 4XBPB 2WKLA 2DLHA 5HYJB 4K2UH 3ZYIA 4IISA 4M7ZC 4LEOB 3ARPA 3SCMC 5EO9B 1R3LA 3RVWD 1CK0H 2YMXL 1EAJA 3SE9L 1X4YA 2X1XR 1JDDA 5LBSL 3NIGE 3VXUB 2FNBA 4ZPTA 4TTDD 3CAFA 2G5BA 2GUOA 3QQ3A 1KPRB 2ITCB 4QXTB 3GMNB 5HDQH 3T0EE 4P2RE 3ZE0E 3BFOA 5JOFA 1GIGL 2WIIA 1HXYA 2YEZB 4B9ZA 5FIEA 1QA9A 4FQCH 1Q9OA 3PJSA 5IMKB 4O58L 3F58H 2XXCB 3KR3L 3MXVH 2VCBA 1FZJA 4DAGH 1WDRA 4DZBA 1KCSL 2CNCA 4NJAL 3W24A 3BH4A 2CLRB 5C0EB 5C6TH 1AQHA 4HK3J 3D1MC 3QHZL 4NRYB 4KPHH 2NNAB 2DKMA 2O5ZH 5FHAL 1B0WA 1SEQL 4AD4A 3OZPA 3O45B 1VIWA 3RKDC 4D9QD 4LX4A 4R4FL 4R0LA 4NJ9L 3BQUB 5EFFA 4U2YA 2BVTA 4QKXB 2LTQB 3RU8H 1XR9A 5D7JA 4FMFA 2YLLA 5D2LA 4MTVA 4P8UA 4MWFB 2DBLL 3LRHA 3P40A 2LTQC 2F8XC 4TOQA 4NZRH 3BEWB 3VG0H 3EFFB 4UAOC 3P4MA 2AXFB 1SYVA 2DTMH 4KI1A 3ZE2F 2XWTB 2BSSA 4ZAKD 4UFIA 5B3JE 4Z7QE 3ILPA 1AKJA 4WEUD 1MCJA 3CU7A 1OAZL 1NLDH 1SY6H 4P99A 4YR6B 4XC1L 4S1QL 3GXMA 5DUML 4BQ9A 3HKFA 4KVNL 4DOHE 5H37H 5F9AC 3GIVA 1H5BA 3NYDA 3ZDYE 2QSCH 3HR6A 4OV6F 4PGCB 2N1KA 4L4PA 5F9JA 1B3XA 1DE4A 4HS3B 3I2CL 3GEWB 1Z9OA 2C7UA 4HX1A 3SDDA 1J1XL 5ACLA 2CK2A 4XPFL 1SYTA 1S5HA 4CVXA 5IJVA 1IQWH 3MV01 2D3LA 5I1KH 5IJKA 5KAQG 2V38A 2C26A 3MRMB 1CZ8H 3WN5C 5IT2H 3WF3A 1N5AA 4HFUH 4Y7EA 1IKFH 4NWUL 3PZTA 4C59B 4HKJA 4XC3H 3T0WA 4WUKL 1ZKAA 4X6BA 3HZYA 1P7QA 2ILLA 3P4MB 3S7GA 3VFTB 5ABDE 1N2RB 4XPFH 4MJ2A 3UPAA 2FECI 2ADGB 1HKKA 4HA3A 3TO4B 2BERA 4N1EA 3CZJA 4GQQA 4OOUA 2IAMD 1KCKA 1CWYA 3IU4L 5JR1L 1E27B 1ZA3A 4GAYB 1X5AA 3TBWA 1SEQH 4L3EB 1N8ZA 1K85A 4IRSA 3F65A 5C6WH 2APFA 2R1YA 4LFHD 2HT4C 4RFOL 1K3ZA 3O4LA 4QRPA 2VX4A 5IQ7L 2PW1B 1NSNH 1OBAA 4GQPH 1QPKA 1MREH 4HA1A 3QUMB 3OHXA 1CDIA 3T08A 5DK3A 2Q8AH 3MRDB 4P2RB 2P7TA 1EA9C 1EFXA 3S4SA 1DVFD 4FQIL 4JAMA 1JK8B 1TJIL 3IT8D 4MYWB 4OGAC 4LGRB 1GNXA 4XH2A 4ZUWB 5HGBA 4X4XA 5SX5H 5CXPA 4O5LL 4N5ED 1Q9WB 1U3JA 4D9LL 5IFHH 2VYRE 1DQQB 3AIUA 3HMXH 3BZEA 5CJBA 3TBSA 3MRIB 3ULUD 2BSRB 1MREL 2OJEB 3TNNA 3C5ZD 1D9KA 1T22A 3TA3B 1NH6A 4F7TA 5A6KA 3FO2B 4LLQA 4P2QB 3KPTA 2Y2WA 4M7JL 5EZOL 1PEZA 2VLJB 1KYOK 3NZ8B 3LN4B 1KGCE 3VDAA 1RVFL 1S7VB 4MPKA 3LKRA 3QCVH 4DCQB 4W89A 3GJFB 4LIQH 5MERB 4WW1B 3CPUA 3C60C 1GGBH 4U3AA 1KJ2B 2WSKA 3LY6A 2AXGA 2X0YA 3B9DA 4IPNB 4V27A 1IGIH 4WUKH 1RK0A 1BYBA 2DYPA 3D9AL 4OGYL 2ICES 3RWHB 3WD0A 2V2TA 1V6YA 3KYMB 5BZWB 3BAIA 4JFVA 1CIUA 1CE6A 2DWEB 2E6JA 2VB5A 1SJEA 3G5YB 1DUYB 5IKCA 1II4E 5IR1B 5EU7E 3UZQA 1KNOB 5GJSH 4JPWL 4MNGB 1CLZH 1SYSA 3DGCR 5J3HC 2CEQA 4FA8A 3G5VB 3UX9B 3S88H 4FXKB 2W9EH 1T2XA 1NUFA 4MCZB 2XYCA 1QP1A 3B9KB 4GT7A 4QYOA 1NMAH 2NY2C 3LV3B 1NBZA 3SCTA 3O81A 1L4IA 3L3HB 4E2OA 1T6VN 3KPLB 2AJUL 1RPQA 1IL1A 1BFVL 3WQ4A 4LVOB 2E8YA 3DI2B 5L7XL 1SM3L 2FDMA 5SV4A 5IDIA 1IC7H 3S3SA 3SGEH 4O58H 3DRTA 1KJ2L 2ZSVA 3RWCB 5HD8D 1OT2A 4WFFE 4O4YL 1WTGT 3QUXA 4M61B 2MOVA 1K4DA 1RIUH 4Z5RB 2D24A 2VXVH 1TZGL 1CL7L 2VL5B 5D7IA 1XYZA 4HKXA 5HY9B 4GXUN 3PZNA 2WUBH 4ONFL 3AU1A 3VNZA 5FA3B 4HJ0C 5FYJL 1A1OA 4HCRL 3K2MC 1CYGA 3QIWC 5I30H 3K3QA 2IALB 1KPVA 3NFSH 1YPZE 3CSYB 5C0FB 4TUOA 4UQ3B 4AT6B 2AABH 4M80A 1Q0YH 3GXFA 2R1XA 4MD0B 1N0XL 4X4MA 4JGMA 1LNUA 4WO4C 1IGML 4GSDH 1INEH 4M1GL 4LDOB 1EEYB 2YA0A 1JYNA 1KWGA 1ZBKA 1N64H 3WDRA 5D9SA 4HSQA 5GGVH 4YK4C 3ILQC 3MNVB 5EUOF 1JPGB 3HZMA 4XPHL 3TYGH 5LGHH 5D1XC 1ACYL 3AS2A 5HHNA 1UCBH 1WBYA 4CVWA 2EH7L 1DN0A 1S9KC 3PL6B 1JPSL 2FX7H 4KY1H 2OTWA 5IQ9A 2OK0H 5EUKA 5D72H 3E6FA 5LA2A 1UYQA 4NBZB 4HW6A 4D6HA 3I50L 4PJ5A 5FDWB 1SJXA 3LQZA 2BNQA 3BDYL 3WBDA 4QO1A 1ZOXA 3L3IA 2WKGA 1FG2B 1HHJB 2VDLL 4HXAH 4R90L 3MCKB 4N1HB 4P9HH 1AHWB 4RA0C 1NOWA 4JCLA 2VLKA 2J5LC 1N6QL 3MRMA 4UQ3A 1SBBA 3N13A 1GGUA 1GOFA 2VDNL 4KGLA 4APQB 1FBIL 4PS4L 3OF6D 4Z2KA 1ADQH 4PMOA 4WI3A 3WLBB 2PXYC 2BOBA 3ZSTA 2IANE 2NYYC 3QIUC 3QUMA 4OSUL 4ZD3L 2W66A 1M7DA 4BSWB 1UXWB 1TUXA 1M6OB 3THML 4XWOC 5MP6L 1A7PH 5KSUA 3CUJA 5DJYB 3RMEA 2BNRB 1N8ZB 3ARGB 2VR9A 3SUWA 1WB0A 3RDTB 3WV0A 1CD0A 1UOKA 4FN0A 1TXKA 3V6OA 5M7QA 3ECBA 4GRMA 5HHOE 3IU3B 1I8MB 4H0HB 3WN5B 4ZS6D 2BNJA 1KIRB 2D7TL 2DLEA 2ORBL 4WWKD 3EMZA 3IS1X 2JLLA 2RIKA 4HKBB 4XH2B 5H8DA 4AXNA 2XIBA 3SGKA 4KKAC 5MP6H 1T5WA 4M1GH 4KRPB 4QOKE 2PTTA 1YQVH 3ES6B 1LILA 3I75A 2B5IC 3QR2A 2CLZB 4JLRA 3GSQA 5KS9B 4J2XA 1HHIB 2DS4A 2X4QA 2W62A 3O41A 5CGYC 3FQXA 3VI3E 1OAKH 4WWID 5DJDA 1KC5H 1ITBB 1HNYA 3PQYA 4OCNC 4JY4A 3ALXA 2Q1EA 4I18C 4WJXA 4P8WA 2CKRA 3MA7B 4C4KT 3QT2A 2QQLL 4UDUA 1DUZA 4OQTL 4NUJA 2D23A 2GSIA 4HIXH 1JNDA 4D6EA 2AQ1A 3BKYH 1TFVA 1P7HL 1XC6A 2HTLD 3LEXB 5EZLA 4JDTH 1HILB 2WWDA 1UM6L 1YEKL 4WWKC 1C5DA 3KJ4B 2Y7QB 4LSUL 3GMOA 3Q2CA 3L3KA 4POZC 4GMTL 4XI5C 1UWXH 4Z2LA 2UWEF 3OKEA 4OQ1A 3VFWB 6TAAA 1KGCD 1AGEB 3MMEB 2FJHB 1GOMA 3W82A 3QIWB 4WNQB 1H2JA 3VDCA 2AV1A 3PF2A 2O9PA 4CMHB 2YD4A 4Y7MA 4GRLC 4LHJB 4PRID 1GGIL 3JWDC 1L0XA 4PY7A 2GJZA 5CEXA 4K71B 4HUUA 3MJ7B 4BQCA 4HHAA 2J88H 1EFXB 1ZE3C 1O0VA 2O5YH 1IVLA 2JFEX 5DEGA 3L3JB 3RJDA 2XOTA 4PV9B 5DZOA 1OD0A 2MHAB 4R4BB 1DEEA 4HCRH 4LNRB 4HIJA 1ZT1A 3QG7H 4LCIH 4NN6B 4NNYB 4PJAA 4XWGH 3T1WA 1BQUA 3B2UD 2DB8A 1JL8A 1PBGA 2EQDA 3LN4A 3QDJB 4K23L 5BVJB 4YGVA 3QIBD 1BLNA 2R2EB 3RM4A 2VZTA 3UESA 3MLVL 3C6SA 3UYRH 1KXHA 3L3GA 1ZANH 4ZMAT 3OXSB 1INEL 1V3JA 2XWBA 3WO4C 4EQ3A 4D3CH 5I75C 4RGOL 1X4XA 2C4FT 4O2CA 3HU7A 5KZ6A 2AEIT 4F7EA 1FOBA 4F7PA 1G9MC 2H3NA 4U1JB 1YEKH 2H1PL 1RJZB 4UB0L 4W5UA 4X7CC 5GS0L 3MRLA 2NY6D 3O11B 2LAGB 4MGXA 5E1AA 4RNRA 1QBMH 4DGVL 2VZ1A 5D72L 3NVQA 5A2JH 5E94A 5CQ1A 3PHOA 1NCWH 3Q5TA 4OV5B 4G6MH 1OGAB 3Q5OA 2AAAA 3VDBA 3U4BH 3HMWL 4XX1G 5D70L 3MLUL 1JD7A 1A6ZB 1PG7H 5GGVL 4TULL 5DFVD 5KS9E 1HHGA 4ODSL 3BP7B 1MFEL 4GI9A 3TYFB 4GKNA 1FCGA 3ARZA 2XPKA 4BQ5A 1FVCB 4KHXL 4IIQB 5FAAA 1ZSDB 2H2PD 3QG6A 3ZKMD 2J7BA 4XP9H 5FB8B 2BNRA 5A6AA 3PWLB 1HZHH 4XGZA 4DFHA 1GONA 3CDGB 4FQIH 1Q9LA 3BI9X 5IFAL 3DETD 3OLGA 1Q94B 2BVOA 7CGTA 4Z5RA 1IE5A 1EEZB 3MV8D 2BOBB 4QXGL 2CKBH 5J13B 2ZCHL 4S1SH 3KPMA 2VUYA 4O5LH 3U9PL 4HKXB 2B2XH 1HH9A 3MU7A 1CGWA 1G7IB 4RWHA 1J9CT 3AOFA 5FYJE 4NBYB 4JVWA 4F37F 4NHCL 1E5JA 2GITB 2X70A 4IMKC 4BUHA 4HWEL 5IBUB 5JUEH 3NUKA 3M45A 1FL6A 2NX5B 3M7SA 2DEPA 3VFVA 4JKPH 4GFTB 3KWXA 4G6AC 2YOCA 1P1ZA 3MJ8B 4CVZB 3S5LA 4ZPTB 1HSAA 1OP5H 3IDJA 1QSZA 1TZGH 4FLQA 3GIZL 4HOZA 1E6JH 1P69B 1FYTB 1UWTA 5HHVH 5JHLL 5CINH 5IT2L 3FB6B 3QDJE 1YMHB 4ZUVB 4OKVA 4IRJC 1U8LA 5BXRA 1AD9A 4PTMA 3CSGA 5I6XC 4MDPA 1TJIH 1IT9H 2V2WB 1CE1H 2YPLB 2BV9A 5ABFB 3QRGH 3L5HA 4RBPH 1JGDA 1OWWA 4PJFA 2J4WL 1AGDA 1W72H 4LHUD 4EVNB 4IBLT 1U91B 1UQYA 3MPCA 3TH2T 3QEQA 1EGJA 1MAJA 1LEGA 2QEJA 2A1WH 2Q76A 4JZ5A 2FJGA 4KJPD 4AZCA 3E2HB 2XACC 4OCXH 5DC4B 3PIQB 3LKSB 1AIWA 5DJCB 5FYJU 3IDUA 5IFJB 2OWCA 3O6KL 2C1PA 4WFEE 1JYVA 1CICD 1I1AA 1XH3B 1Q0YL 3ARXA 2CERA 1UKQA 4HH9A 2HVKB 3LDBC 4W4OA 2VISA 1ADQA 5IBTH 1E6QM 5KVGL 3LRSB 3MFFB 2R2BB 2JEPA 3INUH 3SCPA 1EQPA 4H5SB 2GY7B 1TJHH 1U2CA 2FIKA 5F7EH 5DJXA 2HFTA 4UNVA 4LIQL 4IRJD 2B20A 1AY1H 2ZCHH 3B3IA 3G5XB 3L5JA 4O4YH 4KJQC 3QUXD 1YPZB 4IRJB 3DI3B 4M7LT 1YC7A 1HJWA 4J3UA 4XMKH 3FQTB 1E6JL 4ISVA 4ODTL 1TQBC 4D0DB 2FO1A 1KCRH 2DQDL 2OR9H 4OFKA 3FN3A 4PR5A 3ULUF 4HF5H 5IB3A 4Q22A 5DTFB 43C9A 5DJZA 2GFBB 1CL7I 1FFOA 5DFWH 5EU5A 5INCA 1CLOL 1CGUA 5GPRA 4NC1E 1K2DA 2NY7H 1HSBB 3MXVL 3MACL 4GBXB 3BKJH 1UKSA 4FQCL 4LL9A 4F7PB 4IDLA 3S88L 3II1A 5BV7L 1UH2A 4FMKA 3JTTB 3LIZL 2R4SL 1MIEL 3P4NA 3MRKA 4LCIL 4UZGA 1ITXA 3G6DH 1RV6X 1QSFB 1WQVT 3U6RB 1WDSA 5DURB 4R96A 5ICYB 1UVQA 5EOTA 1Q72L 4J3TA 4NKDA 5GISH 3WY1A 4PY8J 1JXJA 1ZBCA 3FQUB 4PBWD 4AEIL 1HEZA 1UR0A 5L8KB 2WHKA 2EC9U 5AZ2H 1NQ6A 4YHPB 1AXSB 1AI1L 2FHBA 3MRPA 5IM7B 1QVBA 3B9KD 3I6GA 3GRWL 4I0PD 1LP9A 3MODH 2YA1A 2HRPH 5DJ2A 4WV1C 2HT4D 3V0WL 5F1NA 5CBEA 3S37X 5GRJH 4MAZA 1P84K 2P8MA 5FUZL 3PHOB 5K59F 4AZ5A 1JUFA 4G42B 5IP4A 4DW2H 3IDYC 5CLTA 1MHHB 4OAWB 1ONQB 1IEBA 5GSRB 1EEQA 3HNSL 4OZGE 4L8BB 2DQEH 5E4EB 1PKQE 3EJZD 4P7LA 2EEXA 5LA0A 4GKZA 4CRPA 1MCEA 4NRZA 4PJXA 4K3HA 4YWGL 4Z7QF 5DHVA 5EORH 4XNMB 1PYWA 3MRRB 2PF0A 4YX2L 5I16B 3D3VA 1U42A 1YY8A 3EO1B 1BD2D 1R3HA 1TQCC 2CSPA 2DQUL 1QSED 2J5LB 4JM2F 4IM8A 4U6VH 3U2SB 5J11B 1CDUA 1XR9B 3UDWC 1UKOA 2R2EA 4BZ2H 1CFTA 4X6EA 1NL0H 4MAYA 5JPMA 4Z0BH 3WJJC 4UV7H 4RGOH 5BMFL 3B43A 4AZ8A 3SDCA 1EO8L 4GXVH 3BPLB 2VC9A 5CP3A 4Z95H 2EEDA 4ZFFB 1V3MA 3G9AB 3SHSA 3IU4H 5JR1H 3H42L 2HISA 3RIFK 2FIRT 3OR7B 2BHZA 1F45A 1PIFA 4PP1D 3G08B 3VXRE 1F4XL 1JF6A 2VC2H 4OAWA 4XXCC 4WV1B 4JY5L 1AGBA 3VXSB 1JXKA 4L9LA 1G9MH 3SCQA 5E6IC 3WF1A 4ZQKA 4WCYL 5B39B 5C08E 3RHWK 3CFBB 4O02L 3W6MA 1KQZA 3EFDH 4NPYA 4LGPB 3OR6A 4PJ8B 4TNWF 3VGGA 4M7LL 4WUUB 5F7FA 1BOGA 4ZUUB 3ARGA 1W9XA 2MWCA 2CJUL 5EZJB 1WBZB 1CXIA 3PWVB 5T1LD 1UR4A 2PB1A 1DTUA 2NW2A 2RGLA 1GZQA 5DMKA 1E4KC 3RBSA 3BIKB 1CD1A 3V5KB 1J87A 4UTAL 3VIHA 4LKXA 5A2IH 1NGXA 1MAML 4LAQL 3WFHB 3CFKB 4JRXE 4PCTA 4JFDD 1JF1B 4PRIA 3D39A 1ISVA 4BCEA 1EVTC 1CGVA 4FFVD 2DDQL 3FQWB 3QO1A 3BP5A 4IS6A 2J8HA 1QSFD 3ARFA 3QXWA 2GT9B 4GQ9H 3VM5A 1OAXL 1FZMA 1X7QA 3CVHH 3VNYA 4A3YA 4QLKA 1XYFA 4NRYA 3MLWH 3FFCE 5DTFA 3EO0A 4B53A 2QLVB 2EH8L 3GUTA 4O9HH 4PJ8C 3IFNL 3QIBA 5GZND 4M8VA 5EBWA 1U6AH 4M29A 1EJ6A 1QRNE 1OB1A 1HYSC 2VDMH 4Z7UA 2PI6A 5E6IB 5EN2A 2AERT 4UFJA 1RMFH 4QRPE 2CRIA 5I30L 1SEBB 1YEGH 5TDOB 5BS0E 1SMOA 3MC0A 4MXQD 5C8BB 4JHAH 1GC1C 1YPZF 4I77H 3GKWL 1IRAY 3RUGE 5F21B 3U4AA 4QFUA 3CVHB 1R5IA 3RY4A 4JZJA 4UIMA 4L8CA 1V6XA 4LSVL 4YBQC 1B0GA 2IADB 2MQ3A 3ZKMC 1A7PL 1CT8A 4H25B 3P0VL 1KEMH 1T4KA 1G7LB 4LASL 2P5WD 1K9FA 3WDQA 1U93A 4YHML 5ISZE 1VPOL 1F90H 5ETUA 4ZTOL 2WBJD 3KHOA 2R0ZH 5GGRB 3T1FB 5E09A 5LGHL 2BY1A 1QI5A 4FFZL 1I85A 3BSHA 1MQKL 3CIQA 5C0BA 3SJVD 1AQMA 4R26L 1MIMH 2Q76B 3AIRA 3NA9H 1BAFL 2OYLA 4YDJB 3QEQB 2W61A 2HFEB 4ZPVA 3TA9A 1H5VA 2XFRA 5DUPL 3KZSA 1JIBA 4PB0H 2DMBA 4FQ2H 1SVZA 4H7VA 2ESVE 1PFCA 3ECBB 5JLZB 3OXRB 3TT1H 5CJOL 3QFJA 3VXUE 3MRPB 3R06A 5DRNB 3WSUA 4ZO6A 4F15B 3PP3H 4OCWL 1XF3B 5AG8A 1NCBL 1BP3B 1Q6EA 2NY5L 3HCVA 5IEHA 1X5FA 1OW0C 3PWNA 3RI5F 5EUOE 3CUIA 1G9NH 3X17A 1FGNL 3NTCH 4W6XB 3T8XA 2V5CA 2P48B 3RM8A 4JFQA 1Q6FA 3HE6A 2OI9B 2XTJC 5FYKU 5EZOH 3S8WA 1FFOB 4Y4HB 3UTPD 1KJ3H 4DW2L 1DLHB 3ECQA 4JQVC 1OCWH 1B3WA 4MNQD 1P4IH 5D7LE 4RMWA 3TA3A 1MCRA 2X89D 2XKNA 3S36X 3RJQB 3TH4T 3WD3A 4LSUH 5DD5L 1VPOH 4YBHA 3A67H 5BVPL 3GMPB 4WFHD 2IXVA 5AAMA 2AKRA 3KPOA 4GG6B 4YX2H 5KANI 3O6FC 5DYOA 4LXFA 1Q4NX 4P2OA 3IDGB 4GRLA 3IJYB 2ZXQA 5JUVA 4RFEA 4K7FB 5C0CA 4NQDB 2H6PA 4OSUH 1RUQL 2NXYD 1D5MB 4AD2A 4HT1H 3BH8B 3AY4A 1Z3GL 1X5ZA 4ODHL 4UQAA 3VFMA 1UWGH 2MHAA 4R4BA 1GGTA 1BQLH 2ENYA 4OCMC 1TPXC 3HG1D 4WV1A 4E41E 1NGWA 2YSSB 3UO1H 4D2NA 4QGYA 2BY0A 1E0VA 3O2DA 1FZKA 3WLWD 4PY7B 1G7HB 2JTDA 1MCQA 3VH8A 3TYFA 4XPGL 2ZNWA 5AYUL 3ULVF 5FGCE 2O92A 4LPVA 4X7SL 4IOSD 1R87A 1MLCB 4FTVA 1VRXA 1CLOH 2XWBB 4WGWB 5EFIB 1MHPL 2GJPA 1KJMA 4XZUA 2GK1A 2LVEA 3WBEA 3D3VE 4YWGH 1S78D 3EFDL 4Y5YA 1HHHB 1RIUL 1A5FL 2X4PA 5I15H 2EDOA 3HE7C 2A6IA 4WCYH 2IC2A 3UG3A 1P7KA 4ZAKB 3HMXL 2D7NA 4BFGA 3IDMB 4H1LH 1MIEH 4Y4FD 3MRRA 4GH7B 5AWNH 4NUGL 4HWBA 1KSRA 3K46A 5BQ7B 4M4RA 1U3HA 4JG1H 4IRSD 1HOCA 3WEXA 4S0SD 1FYTA 5ID0B 5FUZH 1N0XH 2ARJQ 3SDCC 2XG9A 4M7KH 4AMCA 4NSBA 4N0UB 4NN7C 2QLYA 2W38A 4WDIB 5IMLB 5E8OB 2VRAA 1S9VA 4PV8A 2X10A 1ZV5A 1OCQA 1LWRA 1LE9A 1F5WA 3WH6A 4WIQA 4W5ZA 1TZHB 4NF7A 4KTDL 1OAUH 2A1WL 1AO7B 3LMJH 2V3GA 2WP3T 3JWOH 5DT1H 1MCLA 5E2TH 5BZDB 2LV4A 4PJCA 4ETQA 2OM5A 4ODBD 5JW5B 2W07A 3ZJ7A 3FOMB 2CDFA 2GDVA 5F71A 4R9HA 1NAMH 3W9EB 5GS3A 4I4WB 35C8H 1KF9B 4F58H 1GHRA 3W0WB 1H3UA 4M62H 3JWOC 4ZAKA 3NCJL 1JTOA 3HI5L 2MSPA 3WYRA 3SDXE 3DYOA 1WIUA 3KHQA 4IMLB 1B2YA 1CPUA 4FABL 5I5RA 2H9GB 3GKZA 4PJXE 3GBNH 5HXMA 2HN7B 3TT3L 5HYSA 2O5ZL 5FHAH 4N5EC 4DGYH 2XJ7A 1DN2A 2YZ8A 3OGOE 1DJSA 4OF7A 2LVCA 5FECB 1DUZB 5DRZA 4NGHH 4ZO7A 5JOEA 4E42B 3MLZH 5GRJL 4TX6A 4YAQB 4XPBH 4ISVB 4D0DA 1U8QB 3U7AA 1QNPA 4AZGA 2CR6A 2R0KL 4RGNB 4OLXH 1KXVA 3GHEL 5DRXB 1V03A 3TCXA 4JPWH 4TUJA 4HPOL 3PQYE 1JZ7A 1XHGA 3RM9A 1FH5L 4YJZL 1CFNB 2Q20A 4JDZB 5B4MD 5LA1A 3UBXG 2HJFA 4GW5B 1XGUA 2EXWD 1CIDA 5GISL 3RY6C 2F19L 2VRQA 4O2FA 5ECJE 4WHTB 3G6MA 3BP4A 1RZIB 3BSZL 1E0OB 2AJUH 4G8EB 1HZHL 1IAKA 3DXAB 4LVNB 2V3DA 5CSZB 4NKMA 4XP9L 1I3UA 1NGQL 1A3QA 3WD5H 4U6YA 1HL9A 4P49A 3TIDB 1KXTB 3SCMD 1HX0A 1T7VA 1KELL 2J4WH 1UG9A 4YHIA 1K4CA 1T1XA 4PCSA 1D5BB 5CEYA 3VWJA 5AUMB 1BFOB 1AXSA 4DQOL 5GXBB 4RMQA 2WANA 3OGCA 3U9UB 4CADB 3SKOA 4U6TA 3MCLL 4Y4KB 5T3ZH 3ARRA 5CJQL 5I1GL 5DD3H 3EW3B 4JO4H 4CNIB 5BXFB 1QLRA 2PXYD 3L3DA 4LQFH 4AM0A 1IKFL 2R29L 2I9LB 4PUDA 4JO2L 1NC4B 4UINH 5CIPB 2EYTB 1BWMA 1L7TH 3VMPA 1ETZB 2DBLH 5ENWB 3SY0B 4G43A 4K71C 1OL0A 4PV9A 4JFOA 1J18A 4YFDB 3QB7C 1WO2A 3KPNB 4JZNA 1I85C 2YC1A 1N59B 4Y2DC 1OPGH 3IVKB 3NCCB 4I1NB 1Z9LA 1WDPA 3T2PA 2YMXH 5EO1B 3GFUA 1OSPH <