4MB5A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag5
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
molecule keywords Chitinase 60
total genus 172
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb5A01
3RY6C 3X11A 2IANA 4MWFA 3FRPA 3I6GB 1G7LB 2I60L 5IB1A 4AZGA 3WIFB 1B6UA 1T20A 2QADC 1NBQA 2HJKB 3O9WA 3T2QA 4JHBA 4I18C 1JNNL 5CIPH 1DUZB 5DQ9B 1E6OH 3MACL 1KLFA 1YJDH 4PJHB 3UPCA 4IIQC 5EU6E 3A4AA 1EOKA 3EO0A 1GQLA 1T89A 1YEGH 2OMNA 1OGTA 2QHRH 2B5IB 2AEWA 2NPLX 1KJMA 3NCMA 4GXUN 4KTEH 2H32H 2R1WB 3NIGE 4HXAH 4XAKD 5EULV 4ZPTA 5KSVA 1XF4A 4DEPB 1XR8A 4Z7OE 2PYFB 3D69B 3FQRB 5KJRL 2DH2A 4FTVA 5IB5A 5JO5B 1A4KA 5T1DL 4XNXH 5CZXC 3TVMD 3SE4C 3VFMB 1U8MA 2NY0D 3RWJB 5E7FA 5HYIA 4LK4A 2MANA 1B0IA 3QUZB 4RDQG 1K4CB 2HN7B 2IFFH 3QDAA 3SKUD 5JW4R 3RA7L 1K8IA 5IMOB 2BCKB 4KFZC 2HKFH 1GZPA 3HNTL 1WAAA 3ULVC 4NQCD 4JFEB 3AZTA 1WCBB 1M7IA 4M5ZH 3SKMA 5EZJB 3BAEL 3LQAL 4M6NL 3REWB 5IFHL 1KB5L 3GKWH 4GSDH 5D4YA 3D85A 4KQ4H 4QEGA 4D9RD 4FXGB 4L8CB 1VFBA 5CZVL 2UUDK 5HI4C 3SKNB 4HSQA 4W84A 3G04B 1B30A 1KR1A 1X5GA 4KMTH 3SDCA 25C8H 3TYFA 4F7MA 2ICWI 2IFGA 1R3JA 3UTQA 1E3ZA 2VVSA 1WCGA 4QHKJ 5D72H 1DBJH 4KK5C 4QT5A 1HHHA 1N64L 1U93B 3OPZH 1Q72L 2MQCA 3O9NA 3VILA 1FZJB 3TCXA 5EA0L 1KOAA 2VLLA 5I1IL 4MLIA 4PRHB 3EYQC 3FFCA 3W0WB 3UESA 1KCUH 3RGVA 1AQ0A 1KJ2B 3O2VH 4N0RA 4YDKH 1EHLL 2ICEB 1IEAA 1BGXL 4D0DA 5DUPH 3D39E 4M1DH 2DWDA 2Q86A 2NR6C 3QJFA 4OZHE 5GGVL 1NAMA 5IMMB 1I9IL 2LV4A 5T1LA 3WN5B 3U36B 4CJ0A 5AZ2H 3QWQB 5DTFA 1GSMA 1T0MB 1UH3A 2NY4B 4H2CA 4OOUA 3L5JA 3UJJH 4TOQA 3MV01 3AISA 3TYGL 1J8HD 2DTMH 1EEZB 4OKDA 4LRIC 4FQQA 4LYRA 4U5KA 3KLHC 3POCA 3GMNB 5I30L 4MJID 4UINL 3VFGL 3IVKA 3DV6B 3U82B 3IU4L 5I0ZA 3QHZH 3AMGA 1PKQA 4WWKA 4Y2DC 3IAQA 3OB8A 4EOWH 4JZJC 3VJ6A 4DVRL 2WNGA 4V1DA 4YBLB 1MAML 2DWEA 5TF1H 4M7ZB 3U4EB 4P99A 3KR3H 1N5YL 5C0RL 4E41B 4M82A 4CKVX 1V05A 2UWEE 3UJIL 2EXOA 4JKKA 3QO1A 3VFWA 5I71C 1IKFL 3WV0A 1IGYA 3GZKA 3UO1L 2G41A 5I19L 2HVMA 3CLEH 5L2KA 1PEWA 5MERA 5SWZB 2BY1A 5IM7A 4XPHL 3BMWA 1BOYA 4PEEA 2WWMC 1LP9E 1HKLL 4HA3A 4WFFD 3T4YA 3MRHA 5DJXB 5ID1B 3VRJA 1KIRA 3BIAX 4U7KA 2R4SL 4CMHB 1GJWA 3GK8H 1X5IA 3JWOL 3LQAC 1UB5B 4EDXB 2V2WB 4HAGA 3GM8A 4C58B 3W5NA 2XTKA 1GHSA 2VIRB 4CCCA 1A1NB 5IB2B 3OAUH 2XA8H 2GAZB 3ARDA 4NUJA 2NY6B 4M29A 5IBUG 4BA8A 3FXYA 4YO0B 4U2YA 4S1DD 3CD4A 1HH9A 4PJIB 3WQ8A 4BKLA 1QKZL 3GNMH 4R26L 3SQOH 4W93A 3SDAB 1BQSA 1NMBH 4PJFE 1YNLL 3MJ9A 4K3EL 3MJ7B 1JFHA 5TE4H 5DURD 1FNLA 3VXSB 1K85A 4ZFZB 4S2SB 2A6DA 5FOOA 1BQUA 1RPKA 2J6EL 2B1HL 3NIFE 5DC9B 3WSQH 3UG3A 5JDJA 1RV6X 3AXLB 1LF1A 3SDXE 4X4YB 2GK1A 3WDJA 5EZLA 3ARVA 3PQYD 5DMGD 3CK0H 4RWHA 1F58H 4PG2A 4Y4KD 3RVWC 1KACB 2OLHA 2PNDA 3O4LB 3LEVL 4F58H 4KROB 1D5IL 1I1RA 5CEXA 3ZTJG 1GAFL 4FQJH 4XNYH 1HF6A 1DANT 1CBVH 4NYLA 1SJHB 3ULVF 4LOUC 1VADB 4Q6IC 5IMLB 4M00A 2FB4H 1NWTA 4PLKC 1IGIH 1B31A 3FAXA 4MJ5B 2HT4D 2FBOJ 3MREB 2X42A 1G9ML 4WUUB 4QFUA 4Z0BH 1I1AA 5EC1A 5KN5B 3B5HA 3F5LA 2ADJA 1C90A 4DM1A 2FIKB 3O4OC 5ITBH 5M5DA 1X7QA 2NY5H 3QRGL 1A2YA 4QNPE 1F4WH 3ROLA 2YPLD 3K4DA 1WBYB 1E71M 3O4LE 4H88L 1XGYH 5I76A 4YFDB 5EPMA 3SKOA 2WMFA 4KRMB 1IGJB 5BRZE 3DX7A 3OKOA 3CZEA 1CS6A 4KJYA 2DAVA 2XTLA 2AS5M 2R8SH 1JHTA 3TBTB 5GJSH 2BVOA 3BP4B 3ARGC 3BYYA 4K8RL 4OLWH 5DD1H 3WFHB 4K3HA 5DHYB 3OLGA 1LP9B 4LL9A 1ULVA 2OZ4L 3MRIA 3ROLB 2DWDB 1EOMA 3P77B 2A3AA 3MUGA 4MAUH 5IVXE 4K3DL 3GSVB 5GS2H 3GMRB 4M6OH 3VPLA 1PLGH 5TQ0L 4AIEA 4WUUA 3JVGC 1RURL 5KN5A 4XVUC 3TH2T 4B41A 4NKDB 3L7EB 1FBIH 4P5MB 4O51B 5GGRB 3V0VB 4JG0H 5D1ZA 4X4XB 1ONQB 5DJ2B 3DURA 1WZAA 4HA1A 3HRZB 2APFA 5AYUH 2VQTA 4FZEH 3QIWC 4OM0H 1O7SA 1WTLA 1R3KB 4CUCA 5IW1A 4TVDA 4OZHA 1EDGA 1AD0B 3HPLA 1DBAH 1Y0LA 2Z8RA 3OXRA 5E8EB 1CF8L 2JK5B 4JM2B 1XH3A 2HT4C 3WH7A 1J8KA 3K46A 1RK0B 4Q2ZB 4GKZB 4MD4B 5ESVB 4CD7A 3DECA 2Z4QA 2R1XA 1HHHB 5F1IB 4G3YL 2IPTL 4PJCA 1A6AA 5GRZA 4IOFC 3QR3A 4LKCB 4LU5H 1YEKL 1A7BA 5CZKA 3TA9A 3MRQB 4P23A 3VNZA 5DJZB 2Z93B 3LN5A 5BWFA 4QCEA 1W0WA 2X9WA 3A6BH 3RHWK 1U8LB 1Q38A 1D5MB 3O4OB 4WY7L 2OJEA 5IWLC 5LG1A 1P84J 3AU1A 3PQYB 4RIRB 4I3SL 1BPVA 4KI5C 1YY8A 1R3KA 1CE6B 4GPNA 1YNTA 3F5WA 2IH3B 5CMAB 1VESA 3LN4B 4XP5H 4YUEH 5E8EA 5EIIB 5IIEB 4JPVH 1HNGA 4JZNA 4OQTA 4PBXA 4WW2C 3ZHDA 1FRGL 4K9EC 4OGZA 3F5JA 4W8AA 3OKDA 1N4XL 5D7SL 5IROA 4XWOC 4NPYA 3VM5A 4ERSL 4JGUA 3MOAL 5JDSB 2ZSWB 4Y1AB 3L5IA 1KTLB 1G7QA 4G6FD 3SE3C 4UNUA 3QDMD 4NUGH 1QBLH 2WMIA 5JPMB 4ZD3L 2V17H 4RMQA 4Y4FC 1RZ7H 1VAHA 3IRPX 4N1EA 1BYBA 4M5ZL 3RAJH 3FT4B 4GS7C 3MO4A 2GSJA 3ULUH 4PY7B 2V3EA 5DD5L 4NJ9L 2TAAA 3GI9H 2DQXA 3VXOB 4M61B 1DLFL 3WL9A 5ANME 1K9TA 4HT1H 3H0TB 1R3HA 3UJIH 3ARBC 3UJTH 1A6ZA 2RIKA 4NNPH 3TNNA 4FQXD 4XPFH 2X05A 1JZ2A 3PWUA 1J1XH 4NPYB 4ZSOA 2X4NB 3VD5A 1JWMB 1LLOA 5CSZB 1AI1H 4XNYL 1V3JA 2QSCL 1W1YA 3UTTB 4HGKC 1I9IH 3DRQA 2J6EA 4BF7A 3CAFA 1RJCA 3FMGH 5IHZB 3WEOA 4N0YL 43C9A 2BVQB 5E24E 1NFDF 3BZ4A 3OXSB 5CEZE 1BD2A 2V5DA 3CU1A 1BGAA 5D2LA 3JXAA 2O92A 4L8DA 2EYRA 3KS0H 4HF5L 3MV8A 3S34L 1MHHA 2F8VA 1TMQA 2VZTA 3C8KB 5C0FB 1UR1A 5CD3A 1UH4A 5GGQH 2GJXA 1B3YA 4XCEA 4LASH 4OCYH 1EQPA 3NN8A 1KULA 2WWMD 5JW3L 2AVGA 4QAWA 3UYPA 4WO4B 3LS5L 1SMDA 3QHMA 1WV7T 3GBLA 3AIQA 4K94H 5FKAB 5JOEA 1HSAA 2Z92A 3PABA 4JY5H 4OT1H 4KMTL 5EBLB 5HY9A 4HW6A 1W3LA 4WF7A 1IC1A 1QW9A 3WS3A 1HJUA 3MV7D 1CL7I 4W87A 3CDFA 3KHOA 3H9SB 4PMXA 1AGFB 1CG9B 1EMTL 3ARGD 1E6SM 4PMZA 1R86A 4NN5B 4Y19E 3FQUA 2KH2B 2E9IA 2XG5A 4X5XA 2IALA 3K74B 2H2SC 4LCCB 1HWHB 1IM9B 3V6OE 4MXQD 4YHPA 2YLLA 1IL1B 3AHVA 3RIFF 2C7UA 1S7SB 1LEKA 1LEIA 3BPNB 4K3JL 3V9FA 5KSVB 3QIWB 3AIRA 4W86A 2Y25A 4I77L 2E9MA 1H09A 1DBAL 3QT2A 2DL9A 4KUZH 4YFLI 1RHHB 3PQYE 2IG2H 1A7OH 2R56L 4ZENA 3FONB 1BSIA 5INDA 2DQIH 4XMLL 2EKSA 5ID1A 3QA3B 5HPMB 5F7NC 4DGIH 5ETUB 2XFRA 3TIEA 2FO4B 4XPTL 4UOJA 2V5YA 5FUZH 5FM5O 4YDVB 3U7WL 2YPKA 4QRRA 1T0PB 5I8OL 1TQCC 1K6AA 2V2TA 1JFXA 4XXDB 4LFHG 3VWJD 3KLDA 4P2RE 2AABL 3LD8C 4PTTA 1E5NA 4R2GB 4M7LL 1GOGA 4U1HA 4Z7NE 1UG6A 2OWWA 2A6KB 4RGNC 5D9MA 2P5WE 4P57A 5KANI 1U9KA 5D2LF 9CGTA 3ULUL 2P1YA 2G60L 3K8MA 2VLRE 2A6JA 4IIQB 5CIPA 1CGTA 4MA8L 5DEZA 1GPOH 4QHLA 4WW2F 3TA3B 3B2VL 3L3OA 3EOBB 4OLYH 1W9XA 4HX1B 2BNQD 5KOMC 2J75A 5DJ6B 4D8PB 3RM8A 5AD0B 4Y4HC 1SY6H 3H8NA 3P4LA 4Q9BA 1BECA 1K2DB 3NFSL 1P53A 3CMGA 2DM4A 1CK0L 3WIHL 4RMVA 2J7GA 3BJ91 5IMMA 4TNVK 2EPMX 3VXRB 5C7XL 4ODSH 1RMFH 2HTLC 4PR5A 2E3VA 5CZXD 1K5NA 2EDXA 3VXNB 4MDIA 1EBAA 2ED7A 1QKZH 2ICEA 2YRPA 5I66A 3C2AH 5F3BA 4OCRL 2Z0BA 3VG9C 4P5TB 2Q8AL 5EOTA 2BHZA 2EDHA 4PJEE 4PJEA 1NANI 3IDNB 1JNLL 1HDMA 1SJHA 2VDLL 3ARBA 5HHMD 4DWHA 4F7TA 1U8IB 3P4MA 2M2DA 2DLTA 5F93C 4FLSA 5FYKD 3C5SA 2VXQH 4O2FB 5KS9B 4NN7B 3VMPA 4AW7A 5E9AA 2PO6C 1JGDB 1IQWL 1QW8A 1WITA 2GFBB 3OR6A 4HOXA 4RFOH 3SDCB 1MFDH 1T5XB 3AXLA 3HB3C 4X9IA 3MLWH 4JFHE 4LXFA 1NMCB 1BBDH 2B4CC 1WFOA 4XVSH 1GOHA 4PJ9A 3TTOA 2IBZX 2EYTA 3FN9A 4P2OD 1MFEL 3EOTH 2A38A 5CS7A 4PGBB 3REWA 1S7UB 5FO8A 4JPWH 3F7RA 4NQSB 3CSBA 1DWFM 1I8KB 4QWWC 1T21B 4BSVB 2V5CA 2A73B 3AAZA 5KSUA 4KDTC 2BCKA 4LLQB 2IBBA 4YNYA 3QRFM 2RAMA 4CMMA 1E4KA 4YC2C 5BZWA 1NCTA 5C0CA 4UTAL 1A3QA 2VITA 4OFPA 2F53B 1FPTL 2VR5A 4M5YL 3TA3C 3RU8H 5I1EL 5JLZA 5EC1B 4M7JL 4EUPH 4K7FB 3VU2A 3JBG7 2FZ3A 1WC7B 4JFPB 4KUZL 5EBMB 1LJYA 2XZQH 1BX2A 2X1WL 2DQGL 3ULVL 4X4ZA 1KN4L 4P8WA 1BFNA 2X6MA 4LSUL 4O58L 1S9KC 1XGRB 4DGIL 2IQAB 3MNZA 1DDHB 4ZFOB 3WIFA 5J9PB 4YPJA 3HCVA 2OTWA 4QXGH 1US3A 1DLFH 4KKCD 4LF3B 1MCPH 3GSQB 4CD4A 4ETQA 3RGVC 4BQ5A 3W26A 5HYJB 4BK5A 4M8UA 5EZLB 3N15A 3VWKA 5C6TH 1FH5H 4M93C 1CDYA 5FYJH 2RR3A 4PTUB 5TFSH 2G3MA 1XD1A 1TZGH 3MRDB 3C6LD 3VXMD 1ACYL 2XTJE 2Z4QB 1RSFA 4AD5A 2YEZB 2IF7A 1NCWL 3JWDL 1J0ZA 4J4PA 4PRPD 1OB0A 3B2VH 1YEHH 3H9YA 5E03A 2AJ3A 1RUQH 2Q6WA 2P5WB 2LU3A 4FRWA 1UA7A 1EMTH 2D22A 4GRWE 5LBSH 2R9HD 5MEOA 3EYFB 4XB3A 5LCVH 1EO7A 4Z95H 3ZSTA 1CLZH 4TSCL 3TIDB 4LIQE 4QTIH 3PN8A 3UEQA 3SCMA 4HIEB 2XJ7A 1MHHB 5A6AA 5EOQH 1UKPA 2P5WA 2K7QA 2UV3A 1BFVH 1C5DB 1UKSA 1ZHBB 2DQTH 4XPTH 5FUZL 5K59F 1V02A 1A1OB 3CFEB 1JZ5A 3C6SA 5CSYA 3ZO0A 5JHLL 3CFIC 1MVYA 5F1NA 3VOCA 2PC8A 2EICA 4GI9A 1F6AB 4ZFFA 3WHE1 4I9WE 4OCLC 5AYBA 5HI3C 3SEPA 4R2GC 2C3XA 1EEYA 5TDNA 3IJSA 3MXWH 5I8EB 3J8F7 5CBEA 3MRIB 2G75B 3V4VH 4Z7UB 1QSFA 3TO4C 4M4RA 1KCSL 4LVNC 3HR5A 5FCSH 5GS1C 3RDTC 5D1ZC 3G6MA 4HU8A 4HT1L 2MKWA 5EO0B 4UBDC 5EO9B 3QULA 4DCQA 4PJAB 4LVHC 2WUBL 4WEUD 4GG6A 4GG6E 2HFEA 3WF1A 4Z2KA 4NQDD 3QUZC 1CL7L 4G6KH 1XIWB 2GJRA 4PRDA 1JDAA 1KFWA 5HGAB 5F96H 1UWTA 2GJZA 5JIKA 4S10A 2ZOXA 1AP2B 2NTSP 4HWEL 2YL6A 3D0LA 1CPUA 3RL1B 1F3DH 1SBSL 4G8FA 4HWBL 4JANB 3KPPA 5TDOA 1FOBA 4WNQA 2K7PA 2VWEC 4NZRL 1NC4B 3H42L 2X1IA 3CXDH 5EOCJ 5JOFA 4X9HA 4EI6B 3WIIH 3LAFA 2WZHA 2R2HB 3T65A 1W9UA 3GZAA 3RRQA 4Z7WF 4TVPD 1F5WA 4X6BA 2DQEL 5HGBB 3X12A 3OLIA 3HUJE 2R1WA 1KCVL 2Y5EA 4K94L 5BXRA 2P5ED 2AJZB 4QRQA 3W9DA 4AZ6A 3WEMA 3EYSL 5BV7L 4RQQB 3EO0B 5I1JL 3PGCB 1RZIB 2YRLA 4AIOA 2DQHH 1YEJL 1RZFH 1TZIB 4I4WB 1XYFA 3QFJA 1U8JA 2VLRD 2CBVA 1VACB 3IFOB 4KTEL 1KENL 2PW1A 3MRQA 4P23B 3STZB 1JDCA 2BSED 4ZNCD 4JRYB 3ZTJH 4YHLH 5I5RA 4XB7A 5F70A 4I1NB 1OB1A 5DJ0A 3TBYB 3V4UH 1MJUH 3UBXA 2XWEA 1XH1A 3O2WL 4K23H 4JGJA 2DI8A 2W9DL 3MGAA 4KRPB 4H8HA 3ZYIA 1UM4L 5KANG 2YDRA 5KG9A 1HDMB 5E9DD 2E5EA 2XPGA 3MRCA 3PZNA 2NY2D 5GS0L 4YAQA 4KTDH 3WLWC 4UNIA 3B2UD 2VLJB 4O2FA 4V2BA 4KC3B 2DICA 3ARGA 3V8CA 4JFSA 3NN8B 2VDLH 3AHYA 1UM6H 1XIWC 2F19H 1RJZB 3I50H 3QDME 3SDYH 1QNOA 4HZLB 4O5LH 2D7PA 3KYMB 1F90H 4IUGA 5M95B 3MGTB 4PJDF 2UY4A 4E4PA 5I8KL 1AGEB 1R3JB 5I1KH 3DYPA 4CU6A 3VI3F 1K5NB 4P7LA 4F9JA 3KPTA 1SQ2N 4QRRD 3U5UA 3VG0H 1F6FB 1FL6A 5C1MB 4LLMB 3TM6A 5SX4H 3X3GH 1UB6B 2VXUH 2DT3A 4LEXH 5SWSD 4K68A 5JBFA 1E9LA 5EU6D 4FABL 2W38A 5EUOE 4UCFA 4PUBH 4KKBC 5JW4Q 1HH6B 4DTGL 1WISA 1FH5L 3AHTA 5C0AE 4NP4L 5TFSL 1O0VA 3BKJL 2A6JB 2EDBA 3QH3B 6FABH 3EDEA 4KZDH 3IVKB 1MLCA 3EJJX 3SDAC 1P4BL 4U3HA 3W11C 3QNZA 1U8KA 4Y1AD 4G6AD 3V5KA 3BXNB 1INEH 1MY5A 1MSPA 4P23C 5DUMH 4WDIA 4DK6A 1MWOA 4GXPA 4NGHL 1YQVL 1DHKA 3QEUB 1A14H 1VFFA 3PGFH 1MELA 2DSZA 3IETB 3ME0A 3TIEB 3MV8E 4XNUL 5GS1A 1H0DA 4O2EB 4KJWC 3QG7H 3QJHB 5DI8A 1YECL 1XF2A 1PKOA 4HG4K 4ZE5A 3WD2A 1JYWA 3AFLA 2MTPA 1XH0A 4EN3D 1NEUA 3MO1A 2EZ0D 2J7BA 2A9NL 5FUCC 1D7FA 1EFXA 3KPLB 3MRJB 4MAVA 4HFUL 4WNQB 1N3NA 4Q97A 3TBSB 1HT6A 5F7KC 4J3TA 2Y4SA 3IDJA 5E08H 4W68A 4JDTL 3GMOA 1EFQA 2AJXL 3NSXA 1TQCB 2ZJSL 4YHMH 4PJ5E 1QVBA 4U6VH 5IHLB 4D71A 3OHXB 3SE3A 2LVCA 3EOTL 4ZS6C 1BMGA 1FV1A 1TJGL 1QI4A 4LSSL 3ALXA 5FDYA 3EFFA 3SOBH 1RK1B 5SV4A 2GJ6D 4CVZB 4O2EA 2V2XB 3N17A 1UQYA 1AQDA 2OWCA 4F7CA 4WHDA 4YDKL 4GOSA 1TETH 2E27L 1EHLH 1XH2A 4JFFA 5EOQL 1FLTX 1IAOB 4HIHB 1UZ4A 3P9MB 4KVNH 3K4AA 1NGWB 3V0WL 4LPYA 3AHXA 5CBEB 1X5HA 3C08H 4KKAD 3RHWF 4RGOL 4NZRH 1HK6A 2Q7YA 4P3WA 3PWUB 5DFVC 5C0DA 3WLBB 4V1DD 2D23A 1J8HE 2EKSB 3LS4H 1DLHB 4L3CA 4UNVA 5JIWA 3WIIL 4NM4H 5FO7B 1OQOA 3LKPB 5INCB 3MLSH 4UNTA 3MV8B 3RPIB 3AVEA 4LPWA 4ZDHB 4HK0B 2NXYB 4WWKD 1RK1A 4UFJA 1A9BB 2DQCL 4J1UA 1CCZA 1CQKA 2PW2A 5F9AC 3MPCA 1BYCA 1ZA3A 3LKOA 4D8PA 4DN3L 1MAMH 4HUUB 4M6MH 4L3EB 1FO0L 1JN6B 1Q9KA 4GW5A 4FZ8L 1ZHKA 4UV4H 3KYOB 5EO0A 2JJWA 2MHAA 5ICYB 1MCSA 5CIPB 5DZLA 1U95B 3I6KA 2VDPL 4RAUA 3TZVA 3TTYA 2OBGA 1UKTA 1UD2A 1DBKL 2AEQL 2GUOA 4D0CA 4PIRF 3L3JA 1G01A 1C8QA 1DQDL 3EKCA 3HN3A 2PO6B 3LKOB 1ZA3B 2WWKT 4X4ME 1FFPB 1IBGL 4X0VA 3OKOB 1LE9B 4L29B 2HRPL 4JZ5A 4ONGL 5JDSA 2PBOA 2COQA 1CD0A 3NCYP 2ERJB 5JUEL 3LKPA 1X5FA 1G7JA 5IBUB 4YBQD 4V27A 4J6RH 5C0EA 5FA4A 2W9DH 4YQXL 1NOWA 1DP0A 1ODZA 1MPAH 2EDTA 4H5SA 5GRYA 4AT6B 1NP2A 4PJGA 2VRQA 3PWPB 1V02E 1YHTA 4FP8H 1MCKA 4Y88A 1FP5A 3OB0K 4XI5D 3VXNA 3V95A 4AMKL 4KDWA 3WF0A 4M1CD 4BH8A 5JHLH 3D39A 1X6NA 2XY2A 4LFHD 1J88A 2J47A 5CILH 3BIKB 4PRHA 1FAIL 1T5XA 2WLZA 4YBQC 3SGEH 3HUJA 5T3XH 1RUPH 3GIZL 3PGDB 5T5FH 2HFTA 2IALB 1OAYH 4JJ5B 3VGAB 4LLUB 1GCYA 4B3KA 4PJ8C 2YD3A 4PTVA 1I7UA 3WDQA 3T77B 4DW2H 1X4YA 4BK4A 2J1KA 1IAIH 2I07B 1VKXB 3BH9A 1SYVB 4MCYB 1MCOH 2FATL 3PNWB 5ABGA 4IRZL 4I48A 3TA3A 4XVUD 5TDNB 4MX7A 3L7FB 1EJOH 1Q0YL 3S37X 4X98B 4OF3A 4YEEA 1JZ6A 3IANA 4QY8B 2DKUA 3H7BB 4Q2ZA 1P4BH 1V6UA 3TBYA 4YJZL 1C5CL 3FT2B 3MA9L 5BW7A 1Q9LA 5DGRA 1PSKH 2QQNL 1CBVL 3ARFC 4X7TA 3D1MC 4N5ED 3MO1B 5I1AA 1T4KB 3B8SA 3T04D 5DRZB 3MV8D 4XCYB 2CHNA 2OR9H 3RWJA 4LRNL 1WDPA 1EV2E 4D0BB 2YL5A 3W28A 4I9WD 1P6WA 5D93C 1KXTA 2XKSA 3ZYZA 4X8JB 1C16A 3RBSA 4U6HB 4K7PH 1YUHB 4OCWH 2ZNXA 4QTHA 1W2VA 5JUVA 1MCNA 1Z5LB 3CFCH 1KFAH 5F7WC 3SO3B 1JZ4A 3S5LB 5GISL 4DGYL 3C60C 1ZGLB 1LDSA 4JR9L 4OAWA 3TBWB 4O02H 1OTSC 1NMCC 4MCZA 4JAMB 2FRGP 1UVQB 3AROA 4P5MA 2N7AA 3NA9L 4CU8A 4HQQH 4JJHA 1KEMH 3VFWB 4M1GL 1RVFH 5KSBF 1WKYA 5CQ1A 1TJGH 5L0QC 3SDDA 4ESKA 4WJXA 4ODXB 3DPBA 3ULUC 1EGJL 4IPLA 1OP5K 3SGEI 2YD2A 1U8QB 4WV1B 3BE1L 2IPUG 1RZKC 3O3EB 1UXSA 3QP3A 4LYPA 4XWOD 4Z9KB 3QQ9C 4W70A 1IAII 3PL6D 2Z1SA 4CN4A 1MVFA 1EHNA 4L5FL 1ITCA 5B3NA 2X41A 1LL6A 4NC2B 3R8BB 5AWNH 3TT3H 4PMOA 5GS2D 1IM3B 3PHQA 3L4YA 3RVTC 3DIFB 2Q86B 5JIHA 1OAZL 2C4FT 3LRHA 2DQEH 4FFYH 4MCZB 1LO2L 1E72M 1PX4A 5SWZE 4RDQF 3LMJH 2NY0B 1S9VB 3PTQA 5K9JH 5KSUB 2MPAH 4ZAKB 1EEYB 3PZMA 1GYAA 3RY6A 2CLVB 3QH3A 2AXFA 3QI9A 4YAQB 2GJ6A 3DJ9A 4KK8C 3BGFC 1C8PA 4GW1A 3PHOA 5IEKA 4V2CB 1I7TA 3BPCB 3JTSB 2NXYC 1E5JA 5CPQA 2VAAA 2F2HA 4IMKC 3E8UL 2Z91B 2VX7A 1RUPL 3GIZH 3MLTA 3EAKA 1NWUA 3SCRA 3SCUA 3O3DB 4ZPVB 1C1EL 2ADFH 1CXIA 5B39B 1AC6A 2BVPB 1J12A 4OJFH 5HDRA 5D7JD 5D96C 4WO4A 1UUQA 2AERT 3I3BA 5HTSA 1U30A 2BJMH 4JFFB 1AQKL 4FQXC 1S5IH 3IAPA 4ZFOA 5J9PA 3VDBA 5BVPL 1I7ZA 4W7VA 4XAWH 1M6OB 3GNRA 1X6LA 1FHDA 3D39D 1D9KB 3X14B 4BSWB 5C0FA 3TESA 2G2RA 2VQ1A 5ELIA 4D6GA 4QCFA 2GEEA 1T1XB 3THDA 4XXDA 2FJGA 3NGBB 4APQD 4DUVA 4DWSA 3E2HC 3H9SA 2OP4H 1UM6L 3CZGA 1E55A 4JEGB 2ESCA 4RMRA 1J01A 2ZUNA 3L4XA 4LQ1A 2WCGA 3UYOD 1JNNH 1TCRA 1XF4B 5SV3A 5ADOH 5BOZG 5A8NA 3MOBL 3VFOB 3WO4B 2IC2A 5JOFB 2EDOA 2CR6A 3MYJB 4MJIB 1XCWA 4GG8A 4R2GD 2HVJB 3IDGB 3LPOA 4QGTA 2GUOB 4O2CA 4DN3H 2WVUA 1QP1A 4X5XB 4YR6A 3TO4D 3BKYL 2QHAA 4KK8D 2FBJH 5GS3A 3N06B 5ESAB 2ZUWA 3MUGB 3NOIA 1RZIA 3HI1B 4PJXB 3F6LA 4KI5D 1MRDH 1WLHA 3LVEA 2IFFL 4PJAA 4N5UA 1XGUB 1CYGA 5F9JA 3UTSE 1FNGA 5ICZB 4KVNL 3VG9B 2AGJL 2CIKA 4K3JH 1A6WH 3U46A 5LA2A 2IWGA 3O11B 3E0GA 3DARA 3TJHD 1CR9L 2M1KA 3LV3A 1HJQA 1JRHI 3WD3A 2L7UA 4GKNA 1VPOL 4KKNA 4AZBA 1NAML 2CDFA 5A3IC 3SDDD 5CSBA 3GMPA 2EECA 3QUZD 3WJLC 5C07E 3AIBA 4Y7EA 1MUJA 1P7KA 1WWAX 5IXEA 4GZIA 4ATLA 3G6JE 1OARL 4ZXBD 4AZIA 2CUMA 2ZPKL 3UC0L 1MAJA 1H3XA 1T3FA 5DS8A 2EXYC 3C08L 3RVVD 1K2DA 5CILL 5D9SB 1EO5A 1L9NA 3D2UA 3ARPA 4WFEE 4K7PX 1FE8H 3SDDC 4OIAA 4D9LL 12E8H 5KEZA 1H3PL 3GBNL 5JXED 1E27B 3VXQA 3N50A 1GXEA 2EQDA 3GMLA 5CINL 3R1GH 2D7QA 1AC0A 2VZOA 4LLQA 4YNYB 4U6TA 1EBPA 2FATH 5I79A 1HIMH 3FO1B 5A69A 1BJ1J 4MDIB 2OJZL 4H7VA 1RZGA 2VLKE 3O3AB 2EC8A 5DO8A 3C6LA 5FGRA 4PPTA 1FO0H 4HBCH 4PV8B 1MI5A 3G5XA 4MX7B 2E7MA 1NDGA 1QOXA 1CVRA 1MH5B 3IFNL 3V5DA 3QNXB 3UAJC 4LGSB 2V7NB 2DWEB 4MAYC 2XTJC 4L4TD 3HCVB 2ORBH 3VDHA 1NWRA 4TSCH 2MKLC 1QFWI 4FFZH 5EN2A 5BXTA 3IETA 2JJTA 4GAFB 3TFKC 3GMLB 2H26B 2N56A 3T0ED 3CFBA 2H45A 1JPGA 3DSNA 5FYKE 3D25A 3IF1B 2D7TH 5KVGH 1G9HA 3BW9A 3QUXC 5DSCA 1ZKAA 1ZT4B 3MLSL 5EB8A 1RPQA 4RE3A 4MQXD 1GGYA 2GTWB 4D94A 2F54D 2R23A 1G7JB 3PV6B 5DI8B 1OCWH 4FQXA 1ZS8A 1DL7H 3CVIL 3P73A 5C0CB 5DYOB 2F15A 3C8HA 8FABB 2O5YH 4K55A 5C0BB 4HZ7A 3GHBL 3H7LA 4IBLT 1T6WA 4BSVA 5KZCD 4NT6B 2I9LB 3F7YA 2R23B 3PV6A 5DUBB 1A6TB 1XF5B 2JB5H 3BN3B 2YDSA 3AXXA 3WKZA 5M17A 2ZCHL 3L5XL 3KPNA 3MNZB 4PRNA 3FO0H 4PP1C 2OQJB 2OSLA 1QG3A 4P4KC 1NC4D 3NCJL 1N2RA 4ODHH 4FFWC 5DRXB 1A6TA 1XF5A 1MLCB 1MQKL 2QEJA 4YHIB 3CXHK 4NNYB 2QKIB 3IDGA 5IHSA 1L7TL 2XIBA 1W1PA 3O6MH 1DEEA 4NO0A 7FABH 5CEXB 2Q7YB 1R5IA 2BSSA 1F00I 3KPSE 3WLBA 4HCRA 4M8VA 3ULSA 2Z91A 1T7WA 4X9GA 1HP5A 3P0YH 4PJBE 4Z7WE 3VXUB 2NY6D 2OP4L 2Z92B 5BXSA 1FA2A 2CKNA 1D6VH 3CTTA 4YHOL 3LSOB 1IEBB 1MJ8H 4LHUD 3DETD 3RWCB 5D1XC 3T4YB 3UTPD 4YHPB 4TTGA 1ZBCA 1J0HA 2MJWA 3EYSH 2XM2A 4UUJA 1JPST 4Z77A 1BBDL 2NR6D 3MJGX 3WMSA 4H20L 3FN0L 1E4XL 4L4TB 2I26N 3HC0A 3VWKD 4LHUB 2AGJH 3TYFB 1TZHB 1ADQA 4POYA 1VRXA 4CDGC 2E9LA 4EBQH 5MEPB 1P7HL 3OGVA 1RUKL 4FFYL 3UTTA 1MXGA 1RUML 4NFCA 3HNSL 2HMIC 3TBSA 1JGUH 2PYED 2DLFH 2NW3B 4FA8A 3EYOA 5BXPA 1IFHL 3FRUA 1XHGA 3BKML 3B3IA 2DT2A 3LZFL 1WBZB 1TIUA 3GHEL 3WY1A 4WHTA 1OAQL 5C0AA 2I9TA 4EQ3A 3GIVA 2AK4A 1WTGT 3CFKA 2R0WH 3E6HA 3D3VD 5C0EB 1VACA 3BDBA 4PMVA 4GAGL 4MQTB 3W6LA 4L1DA 4PJCF 1ADQH 1KEGL 5J4MA 5IW6A 2NY1D 2BDNH 4EN3A 3V6BR 4IRJA 3HI1A 1AP2A 2VZSA 2G9HB 2AV7B 2L4OA 4LLWA 5D7KE 1CDCA 3HNVL 2RTSA 3L3GB 4GG6B 4JHOA 4BH7A 5BW7C 1SMAA 3EYQD 4EI6A 4KMLB 1CGWA 1F13A 3ARFA 4PRAB 4N0UA 1GGIH 1JK8B 2XWTA 3NIDE 1CL7H 4LSRH 1V0MA 4FQ1H 3B3IB 5TE4L 4LLDA 2WZIA 2YRZA 4HS6B 4HS3B 1UACH 1E6QM 3QEHB 3B4NA 1CD9B 2YIHA 1NBYA 4B0MM 1IGYB 3ARXA 3QCUH 1REIA 4U31A 3SE9L 2FO1A 2A6IB 5ALBH 3GSNB 1A6VH 5DT7A 1HHIA 2BVUA 5LCVL 3PBGA 1DQMH 2J8OA 5F97E 1MQKH 5HYJD 2GFBA 1DWGM 3LPGA 4QXWA 4UMGA 1GJIA 2GJPA 4WW1B 5BO1H 5FOJA 1CDIA 5IJKC 3KL5A 2N4IA 1RU9H 1WVZA 1Y6MR 1CNVA 1YQVH 3ILPB 1HKJA 1JRHL 2P43B 2MQ0A 3AS2A 5IB2A 4YHGA 3O3BA 5FYKH 5BRZD 5C0BE 1R24B 3BHBB 1CE1L 4WJ5A 3KLSA 4PJ9D 2P7TA 4NKOB 3VX1A 3ZE0E 2IUZA 5EFIB 4TNWK 4D0BA 4P4RA 1N8ZA 2VAAB 1KB9J 5HHNA 3BAJA 1KLGB 3LIZH 4XVJH 3GHBH 3KPRA 4J4PD 2KPNA 4YXHL 4XCNB 2EPLX 4WCYL 1QBMH 2Y7QA 1V6XA 1FRGH 2W0PA 4AT6A 3CH1B 3CZLA 2BOCA 1RI8A 1IGFL 5I9QB 3W53A 5L2KE 3TZVD 5D9SA 4WUKH 3BCFA 4XVTL 4NSKB 4PLJC 3UCRA 1UCTA 1OSPL 3TJEL 3PWJB 4BQ2A 4JO3L 4Z78B 2HP4A 2YK1H 1U8LA 4CU7A 1GZQB 4LVOB 3VTRA 3WH6A 2VISB 2YMXH 2JJSC 1KBGL 1NEZG 2GKIA 4M61A 4Q9QH 4S0SD 3H0TA 1FNSL 2ORBL 5C09D 2I07A 1VKXA 4FFZL 4PJXA 4Z2GA 4HUNB 5F1IA 3CMOL 5DJ8B 5EIQA 3FZUC 3MUAA 3H42H 3W9DB 8A3HA 1UQZA 3PTMA 2CIKB 1MY7A 1WT5A 5E8DH 3U36A 1JPSH 4GQPH 5MENB 5GJTH 2XGBA 5IT2L 5F3HA 1MI5E 2MOVA 1RIVL 4MXVE 1F11A 1H11A 4PGZA 1BEYL 3NGBC 2VCBA 4U1JA 5T3XE 4OZOA 3QNZB 2W0FB 4LCIL 4LF3A 2NW2A 2ILLA 4HUMB 4FZEL 5HJ3A 4AC1X 3QWOA 1IZKA 1QLFB 4L3ED 4BM7A 2J7EA 1P7QA 1S9YA 1MVUA 2J78A 3T0EA 1S7QB 3QUMA 5MI0B 1AR1C 1KCRH 4ZS7H 4H0HB 3TPUB 1S7VA 2VN7A 5ANMB 1GOOA 4B9ZA 4LSTH 1Q9WB 2Y8KA 1KENH 4PY7A 4LSRL 4QF1B 3FOMA 2YKLH 4UFKA 1JTTA 3FHAA 3TVMB 1JHKH 3VA6A 1A8JH 1MFBL 4N1HB 1I7ZB 2BNQB 5DMKA 4PP2A 4DEPC 4CJ1A 1MIEH 4LDEB 3VIIA 1YEEH 1FYHB 3QIUB 1QYGH 8CGTA 2VN4A 2AI0H 5DHXB 2CIIB 5GRWA 1QI0A 2AJUL 3MLXL 5ID0B 4P9ML 4ZDHA 5I15L 2R0WL 1NDGB 1VDGA 3QQNA 3BP7A 2NCMA 2G2RB 3HZMB 4YHYC 1IEHA 3DHJA 3S35H 2J8HA 1CLVA 1CICB 5L8LB 4RX4D 5HD8C 3NACL 5F1OB 4M4PA 4P8VA 4Q6YA 3WUWA 5HHQA 4V1DE 5ABHA 1QSFD 2YZ8A 3NMEA 1KCLA 5KSAC 3MFFA 4RBPK 3S97C 3N1FC 3TV3L 4JPVL 1HZHL 3CZ8A 3MRRB 1B2WH 5IFAL 1I9JL 1LNUB 1CE1H 4U6YA 3CJJA 1ZLWH 4CD8A 4ZOAA 2VC9A 2GY5A 3SKJL 3RNKB 4OTXL 1CXKA 2GCYB 2Z8SA 3FJTA 4FXLA 2FIRT 2J4WH 4KUCD 4X6DE 1DEDA 4E8DA 5DO2D 4UUJB 4WEMB 4PJFB 3ELAT 3I9GL 4MNMA 5GS0D 4GUPA 7A3HA 1AY1H 3PWLA 2AXFB 2H8PA 2Z31C 3V5KB 5EU6A 3T3ME 3QG6A 3UETA 4CADB 3B9AA 2AQ2A 1H8SA 1AXTL 5D8JH 2B0SL 1I1XA 1JIBA 1SBBA 3X13A 1JFQH 2RBLA 5HHOA 4EJ1C 3LRSB 5GHWL 5GSRA 1LP9A 3GI9L 5HGDA 5GS0C 4JRWA 3I85A 5IGXL 3U46B 2E0PA 3AZSA 4Q9QL 3NDZA 5EMYA 2BRQA 3GRWL 1R7OA 2I5YH 2UUDH 3VX0A 5C07D 1FG2A 2Y36L 1JWSB 1S46A 4NGHH 4LLWB 1ZHKB 1A14L 2OSLB 1ODUA 2MMXA 3QIBA 5FYLE 5TDPB 2FECL 2VXSL 4XPAH 1K4DA 3Q0HA 4KUCF 3PZQA 5D1ZB 4L8BA 4OLUH 4OCNC 1A9BA 3HI6H 3C6LC 3WSUA 1LE5B 4Z78A 2ICWA 1FVCA 3Q5OA 2G3JA 3QCTL 4R0LC 1JN6A 1MCCA 4H26B 4U1NB 5DDHA 3JSSA 1MWAH 2EDDA 3QIWD 3QA3A 4LSVH 4EBQL 1CECA 4M9OA 1SJXA 2ZIDA 3I3DA 5JW5A 3E6HB 3WFLA 1FNEA 3S37L 3QIUD 2A3BA 1JZ7A 5KSAB 2NQCA 5ALCH 3Q1SH 2RFXA 3H6JA 1DFBH 1AO7D 1G7HA 3G6JA 3RGVB 3U0PB 3ZE1E 3W9EA 2EDNA 3DROA 1W3HA 3HNTH 1JUFA 2VLJE 5J06A 3V79C 3GHEH 2MWCA 4GLRH 4U1LA 5FB8A 1RH9A 1T2QL 1SMOA 4HH9A 4NO5A 3SQBA 5DJYA 1P69B 3QDJD 1BD2E 2V7HA 5C71A 1IGTB 2IPKA 3QHNA 4HEPG 1TMCB 3OKLB 4LPUA 2AKRB 5FV1L 3MMWA 1D2KA 2IJ0C 3MLPA 4HKBA 3GM0A 4UQ9A 2E40A 1MCWM 4XPBL 1OAZH 2WMHA 1EAPB 1BEYH 5DC4B 2VZVA 3NCBB 3G9AB 4QXTA 3UTTD 4LP5A 1UWGH 1MJ8L 5K9KB 1YEGL 3BCDA 3HFMH 4MCYA 5F3BB 2E7LA 4AEIL 4JDZA 3RX5A 3WQVA 1JUFB 1U92B 2BRRH 2NY1C 3OZOA 4JPIB 3O2VL 1Y7VA 3QQ4A 1WUNT 4OCMC 1V0NA 4MVBD 1UACL 5JHDE 3MLRL 1KJVB 1IGCL 2ZOKB 6A3HA 5C3LD 3BSGA 1UQSA 4S1QL 4XNZB 4Y5YB 4OLXL 3ZDYE 4X4XA 3BO8A 5KTEL 5GS1B 4O51A 1PPIA 4WUUE 5DD3H 1R3LB 4MAYB 4JM2F 3ARWA 5JW4M 1MCEA 3UR8A 2DLEA 3I6LD 4ZUVA 3ULUE 2F54B 2X4NA 3ARSA 4TN9A 1IT0A 4ML4A 4LEOB 5IQ7H 1SVCP 2XG9A 3WN6A 2C1OA 1ED3B 3RL2B 4XVJL 4MA7L 4XMPL 5J3HC 1NP0A 3PWJA 1XGTA 4PMRA 4UAOB 4HLZG 1WWCA 3Q5YA 1GGCH 1K9EA 3FB6A 5I19H 4JAMA 4P9MH 4XPAL 2HKHH 2NTFB 1ZJAA 4DFIA 1WWBX 2F8OA 5C07A 2AV1B 1I85A 1J11A 3G5VB 3X13B 2UZIH 2VL4A 1NCNA 4P3CH 5IM7B 4R90L 1PY9A 3BZFA 5JHDD 5T5FL 4D2NA 3DYOA 4XBPA 5ICXA 3D5OF 5DLML 2ADIB 3THCA 1YC7A 1XZ0A 4PGEA 3NCEB 3AIEA 4JFQA 5EZIL 1KTRL 4QHMB 5E8OB 1LILA 4HC1L 1DN2A 1JJUA 2Y23A 1SJEB 1F4AA 4BJLA 1JZ8A 5D9OA 5FK9A 2VLMD 1IT9H 1K4DB 4KY1H 5HVHC 2WKLA 4FQ2L 4N1CA 2Y8VA 4HOZA 5FDWA 1DR9A 5GNYA 3KWWB 4JRYD 2VOTA 4NNXA 4OKVA 4ENED 4XC3L 1HCVA 3BUYA 5LGJB 2CHOA 1E28B 3INUL 1ZLVH 3NFNA 4EUPB 3ARZA 5B39A 4X7FC 5FYLL 4EDWL 3O3DA 4U3XA 3WSQL 5LYRA 1J9CT 1BPLB 2LAAA 4NRSA 3QQ3A 3FB8B 1HZHH 1QQDA 2D7NA 1TJHH 1RHFA 1JNJA 2NXZC 3TIDA 2D31A 2VT0A 3AREC 2HJFB 4P4RB 5A8MA 1OGGA 3PWLB 1YMME 2CK2A 4YPGA 2J7FA 3AY4C 1AFVL 1UWXK 2P5EE 4PRWA 5D6CB 2DQJH 4FMFA 3I75B 1ROWA 4OZIE 1FVEA 5D5MF 3ZZ1A 2VX5A 1NMBL 1U91B 4P4KA 5CINH 2JEQA 1ZLWK 3GSOA 4AY0A 5IR1B 4OJFL 2G9HA 3PZIA 4WUKL 1S7XB 3SUUA 1E4XI 4IRJB 1MIEL 2HLAA 4LDLB 5BVJB 5ECJE 3D9AH 2FSEA 5EUKB 3DRQB 5IVZA 1OINA 1OWQA 3VGDA 2ESVD 3DURB 4NOFA 4PJ7E 3OAZK 2YMXL 4WFGE 3N1AA 2AQ3A 4HKJA 3HB3D 1CD1B 4R26H 3SQOL 4Z76B 3LKSA 2WP3O 3GJFA 4LNVA 4YHKH 4EIZC 1Z9OA 3NACH 4AD3A 3FHQA 5JBEA 2D4DA 1S9WB 5HHOB 2CMRL 1B9ZA 4WW2B 3P30H 2FNBA 4I0PB 4I3RH 4WTZA 4TVPH 5D1XA 1L6XA 3VJ6B 4NQDE 3RZCD 4YWGH 1IKFH 2X4UA 1K3IA 1LE5A 3FQTA 4BFGA 2H8PB 1RZJH 2CBIA 5ERWB 1CBGA 1OP3H 4LAJH 4HEME 1JHTB 3E3QC 2O9PA 3ZJKA 1QHPA 3KE0A 1BLIA 2G5BA 1WSST 3RVXC 2X4UB 2QADD 4HK3J 2ZOLB 1MJUL 1DLHA 2DS4A 3DX7B 5IQ9A 4H1LA 1I7RA 1OAUH 4UQ3B 2VLKD 2CKSA 2FEDC 3OKNA 4B9YA 32C2B 1UWGL 3IDNA 2VKWA 4KRNA 2WMJA 1M05A 1BFVL 3T4AB 3S96A 5CUSH 3CH9A 4PRAA 3W27A 1YNLH 3LN4A 4AH2A 3MGTA 3CH1A 5EIIA 4KV5E 1QFUH 3AICA 2NY3C 3EYVA 4IDJL 1OT1A 4XBGA 1ZK9A 2JCCB 2WVSA 1MOEA 1AGDB 2WQ8A 4C57C 3V7AE 1BREA 4NJ9H 4YBLC 1LK2B 4X80H 2P24B 5D7IE 5E9DE 3WXWL 3MV7A 3K80A 2QV2A 4GXVH 1G6RL 4CVUA 2PW1B 4IRJC 3STZA 3G08B 3HG1B 3W0KA 1B6DA 4AZ8A 4BQ8A 1J1XL 4AEEA 1QNZH 2XN9D 4LKCA 4OLWL 4OI9A 3EYFA 4R6UA 4F33A 5IBTH 3G5XB 3HZVA 3T0EC 4CVXA 1AJ7L 4F7PA 4MDJA 3NIDF 1I9JH 3TVMC 1K6QH 2BY0A 2JK5A 2VXVL 4JM2A 1H3PH 3GBNH 1U36A 2NSXA 2J77A 5CCKH 3KLHD 3S37H 5HJ3B 4S1SL 2PXYA 4NKMA 2CSPA 4BQBA 2AAVA 4Q74A 2UYLB 5DVOA 4WO4D 4J23A 4YE4H 3OR7B 4WI6A 5J11C 3BP5A 4XX6A 3DX6B 1QRNE 4HMDA 2Y9RT 3QUML 3SURA 1U8NA 4OF8A 1FH7A 1LWHA 2YDQA 5B8CC 4W8LA 4QLJA 4F2MA 1FAKT 4FS0A 1QSZA 3DUUA 1FVCB 2EDEA 1U3HB 4JHZA 1DDHA 4NN5C 3BAXA 4QLLA 1SHMA 3HU7A 4LSPH 4OT1L 1ERNA 3BZ4B 3CLFL 2B1AH 5KSBB 3DVFA 4HAFA 1CFQB 5IGXH 3DV6A 1P4IH 3CVHA 5FUCE 1OPGH 1KQYA 1OGAA 2HG5A 4FQHB 4LLYB 5LVEA 2M26A 4ACZA 2PWGA 5IFJB 2LFGA 4LX4A 5SWSA 3BP4A 3OAYH 5CJBA 4HU0A 2CLRA 4OLZL 4OZFA 5E2UH 4KROC 4PD4J 2C1OB 1RULL 3Q6GH 3GSQA 2O93L 4HFUH 2O5ZL 3WL9B 3STLA 3V4UL 5HBFA 2Y7QB 5HXMA 1TG7A 3DMMD 5C0AD 1U3YA 1YPZA 1YEIH 3P4OB 3A3HA 4JQVA 3D0VB 3LKSB 3ULUD 4GINA 2E7CA 4UT7H 4TULH 5JZ7D 4MS8C 5D9NA 3MBEB 5SWSE 1MFAL 1PFCA 2I24N 1VFMA 1QLFA 5DHVB 3MUHL 4LSQL 4J3UA 4ERSH 1W8NA 3NUKA 2F8XC 1DQJB 1P7QD 5FHBH 5KW9L 5LXGH 5IHRA 1JCKA 1NFDE 3ZKQD 5KAQF 5LKNA 3PZTA 3VIFA 1RZKL 3RVXD 3HG1E 2O9OA 2YA2A 5FUOH 1FJ1B 4ODUB 4HUKB 1MJ7H 4N8VB 1Y18A 4JQIL 4QYOA 4DKAA 1QVOA 3UP1A 4IMLA 2GT9B 3QQ9D 2FJGB 5DA0B 4MXQC 5I0DA 5I16B 1ZB5A 4X80L 5A2CA 1UWSA 2F58H 4Y89A 2O5XH 4ZFGH 4MNQE 4ZODA 3IGAB 4LPXA 2J62A 2YD7A 3MV7E 5C08E 2X8RA 4N0YH 4GRLC 3UTTE 1I1FB 2J2ZA 5EU5A 4QP0A 5BQ7B 3ARFB 2P48B 3MMEB 4NKIH 4DTGH 3F7VB 5MEPA 4LYQA 3EUUA 1SR0A 3EOAA 1UZ6E 3KWWA 2FD6L 4HIJA 5IOPA 3FNDA 3BOVA 2PCPA 4DKFH 1BQLH 3DXAB 5C7XH 2Y1VA 4JE4B 4JO4L 3FOLB 4YO0A 1UH2A 3BISA 2AEPL 2P24A 1I7TB 1FNHA 3JV5A 1Y18B 4G7YH 1FH8A 4E0RA 1TVBA 4PG9B 4TNWF 2XIDA 1AGCA 3NDYA 4X6BB 3NVQA 4HD9A 3W9EB 4JRXA 2NY3B 5C07B 4Z7QE 5EOCH 1D9KD 3B9KD 4G6JL 2W9EH 3F8UB 1VFUA 4QRUA 3N9GH 2UY2A 1TVBB 2ATPA 3TBVA 1LO4L 4CRPA 1HVXA 2BFGA 1V3KA 4APQA 3O8XB 2Z1KA 1MCBA 1RJLA 3VIJA 3M1BA 4PGEB 1BYAA 3NCJH 2AV7A 3EOYG 3T0AA 2EDQA 2VLKA 4OUEA 2ITDA 4TYUA 4LLVA 5C0CD 3RY4A 1W2PA 3RL2A 2WQRA 4HJGA 4UB0H 3C60D 4IM8A 1CFVH 2A6KA 1HILB 1HL8A 1KB5A 3UERA 4A3YA 7FABL 1T20B 1GVIA 3PDDA 4S1SH 4DQOL 4J8RB 1OL0A 3IFLL 1VIWA 3W39A 3T0EE 5EORL 4UTBL 5CJQL 5IK3B 4DVBB 1C8YA 5IBTL 2XWTB 3AZRA 3OLDA 1YMHB 3TCLA 1Q72H 2X40A 3MBED 5HHPA 3RWHA 4LLYA 3NCCB 3MA9H 1BIHA 4MWFB 1VGEL 4ZAKC 3GBMH 2CH8A 3OX8A 4JFDD 3QEQD 1AVAA 5E94A 3VRIA 3V0WH 4ODSL 2P46B 1WFNA 3QPXH 1RZGB 4EKJA 1UGNA 3OAUL 3CX5J 4GRWB 3QHFL 4Z7UF 1PQZA 4F66A 4FN0A 2LAGB 1KGCE 1SFSA 1KBKA 2DJSA 2E7BA 4XNMB 5CEYB 1OIMA 2JIWA 2ZICA 5D6CA 1A7RL 5A3ID 2P7TB 4BFEA 1ISZA 3I75A 3V0AC 4KQ4L 3GSWB 5JPNB 2PF6A 4KKLD 5B38G 5JNYB 2GFTA 5IR1A 3HZYA 4H8WC 1C5BH 1CDJA 2AK4B 3PL6A 4I2XE 3OG6B 1ZWIB 4U2ZA 2WSPA 2VDQH 5JMRA 3N1GC 4G7VL 1S3KL 3I6LE 4KRPD 2AI0L 4P49A 5HPOA 3NBNA 3WF2A 1UD8A 1JRHH 1KIPB 1OTTC 1NFIB 4FXGA 5D6DA 1IE5A 3KYKL 3U4AA 1FYTB 1VFBB 3RIKA 4ZTOH 2BHUA 3FB8A 4U4BA 3QHZL 3D5HA 1H5BB 3JZ7A 4JLRB 3D18B 4PRIB 3VWKB 3QAZB 5DJYB 4NKIL 4U0QB 1VEOA 4ETQB 2YC1B 2V3DA 4D6EA 2A9MH 1DN0A 3G08A 5HHXL 2EEBA 1PY4A 4N0CC 5KS9E 4QF1A 2O5ZH 5IVXF 5DMYA 4JO4H 5FGBC 3VRJB 4TX8A 5DMKB 4JFQB 1D5XA 5LAXA 3TO4B 1RFDL 2SEBA 5T5NF 4AIUA 5C08B 2C0HA 1NQ6A 4WO4C 4N5EC 2IAMA 4WFGD 5BCAA 2VWEE 1QNSA 3UCQA 3D48R 3S3JA 4NBYB 1BLNB 1KPVA 1EXUA 3P4NA 3W6MA 3RIFK 1MFDL 3L9RA 1PX3A 2W1NA 5E4EB 3GUTA 4GT7A 3LDBC 2IMMA 1FL3B 4XHJC 3V6ZA 3MGOA 3PWVB 2EEDA 1W72L 1AJ7H 3QWOB 1PW3A 1WQVT 2W9LA 3FCTA 3GGWB 2CUHA 3FAWA 4TOYL 5GZNC 4GO6B 1T2XA 1S9XB 4PYHA 2UY5A 2FGWL 1GPOL 3HE6D 5F88A 5F7EH 4W5UA 5CSUA 5DVLA 4Q22A 3BEWB 4HXBH 1S7UA 1XMWA 4U1SB 5FO8B 2PWHA 2RCSL 2AXGA 3A6CL 5FYJL 4NRYA 4OIFA 3U6RA 5IIEA 4XZUB 4FF5A 1SY6L 3BGAA 1YEIL 1KGUA 3O0RL 2EE3A 1T0NB 4XXCC 1GHFH 3IYLW 5FYKL 3EO9H 2DLGA 2D0HA 3DSFH 2HVKB 3R06A 3B8YA 3BLPX 2FB4L 1CZ8L 3EJYC 2PXYD 4FQLL 2NX5D 1PKQE 1JAKA 1T7ZA 3DBXB 1KR0A 3QULB 3ARBD 3BAYA 1Q6DA 1S7XA 3BN9D 4LSUH 4O58H 4JY6B 3TYGH 2BVYA 2FEDD 1AR2A 2EIZA 1ZLUK 2QADB 4PJ7B 1EH9A 5E7BA 1UZ8A 3LCYA 5BV7B 1ZJBA 3BWAB 3IU4H 4KVCL 4BQ3A 2RHEA 3EJYD 1JPFA 1TR1A 1R5VA 5L2KD 2HLAB 4MB3A 2CGRH 5E8PB 1LG2A 3M6DA 3O8XC 1MW2A 2HWZH 1YN6B 2IQ9L 2VDKH 4MNHA 3QDGD 5I1JH 1BHGA 2W59A 3MCG1 2NLJB 2UZXB 2J25A 4KXZI 3F58H 4JN2A 3WENA 2JTDA 4G3YH 3MUIA 1AXSB 1DBJL 2GSIB 4NZTL 3LPWA 1V7NH 4NQDB 2DYPD 4ODBD 1UWUA 4Y4FA 2DKMA 4WDIB 5D1XD 2E9BA 5EA0H 3U4BL 1F58L 4R0LB 4DJMA 2X4SB 2IMNA 4YHNA 4NQCA 2VDOL 4E5XB 3THML 1WB0A 1OAXH 2QR0A 1RIUH 2QMKA 4IPNB 5MEQB 1T4KA 5BV7H 4QTIL 1PG7X 1GZJA 2UWEB 4HLJA 1G7MA 1QFWL 1T83C 3C09C 5DWUL 1Q9KB 4GW5B 5EUOF 4DUWA 2ZXBA 4KI5E 1EFXB 3KPLA 3DROB 4UDUB 5FHBL 1X1NA 1HSBB 4HS3A 3W5MA 4H41A 1D6EA 1P4LB 1DQTA 1XR9A 5FM4A 1UWRA 5C08D 4WUUD 5IFPA 1Q1JL 1IGIL 5FD0A 1NLBH 3GB7A 5I24A 5DD0H 1XCTA 4K7FA 5HPMA 1G9MH 3QFJE 1UKQA 4HC1A 1YMMB 1AIWA 1BZ7B 4OZGE 1S78C 4JRXB 5GSRB 1F4WL 3QUYA 1X44A 1MYRA 4NN7C 5I6XB 1WZKA 5JZ7C 4NC0B 1XR8B 4KTDL 2C3WA 4F7EB 4ZAKD 4EOWL 5J11B 4AY1A 1D9KC 3PDOA 3I2CH 1IAOA 4HIHA 2X1QA 2DKSA 2WUBH 4C56B 4E9LA 3LHPL 4H26A 1AO7E 1X5YA 1RJZA 5IB4B 1B2YA 4RMTA 1KPRB 3CFJA 4LEOA 3QIBB 2XOTA 5H37H 1UC6A 5K9QI 4LEXL 5SX4I 1NARA 1HYSC 5FFLA 1MREL 1VADA 3IKKA 4U1IA 2VX4A 5D1QB 1W0WB 1NAKH 4Q58C 3FB7B 4XBEH 2I9TB 2GTZA 3QNXA 1N6QH 3AHZA 4BQ4A 4EVNA 1Q0XH 1U2HA 1A02N 4O9HL 2WBJA 1CLZL 3BC9A 4U3AA 1A2YB 1Z6JT 5JOPD 3VFVA 1A3HA 3QG6B 3U30B 3HC4L 1H15A 4JG1H 4JM2D 5DFWH 4DOHB 1B3XA 1UM4H 1R3LA 3N1QC 2DQTL 2MHAB 3E6FA 3FFDB 5ICYA 2XKNA 3GJFK 3QNYB 5LQBL 4Z8FL 4LSDA 4X6CE 1U93A 3AMDA 3RO8A 1ZHBA 4RA0C 4GLRI 4AIXA 3C09B 6FABL 4P46B 3VXQB 1Z5LA 4JHAL 5E4EC 3ZKND 4X6EB 4I0CC 2AJZA 4QRQB 4AZ5A 4QXTB 1OQXA 2EIDA 5F7FA 1N6UA 1FQ9C 3CVHL 2X4TA 1AXTH 3MV9B 2J6EH 1T3FB 1A0QL 3KS0J 3MRKA 2K1MA 4M6OL 5DS8B 4E42A 1KCKA 3C5ZC 4ALAL 4QWWD 1U92A 3ALGA 1Z32X 4PS4L 4XMKH 4OD1H 1F45A 4PRHD 2VL5B 4YHLL 3BFOA 1YYLH 3MRCB 1KWGA 2X4OA 4QRSB 3QWRA 4HX1A 1GOKA 5KZ6A 2ZUSA 2IAND 1AKJD 2F54E 1MCHA 3BRDA 4YDJA 3BKCH 1PAMA 3VFPA 1CQYA 1UJ3A 1UZ8B 3NABL 1V3LA 1G9MC 3OKNB 1AGBA 1I4FB 1RIHH 4IRJD 1CGSL 5TE7L 1ZXQA 4UOW0 4MNQD 3ZHKA 1UZ6F 4ZFOL 1FP8A 2F74B 2OS7A 4PRDB 1A4JB 5DJCB 1SBSH 3RJDA 1FYTD 2CITA 3EDKA 4A6YL 5EC2B 1BVLB 1LDPH 4PGCB 3TTQA 3QCTH 2R2BA 4Z0BL 3ZJ7A 1AFVH 3I02A 2BNQA 3OHXA 2R69L 3N18A 1EEZA 1KXQA 1T1WB 4MHHI 3S4SA 2C1PA 3LOWA 1Q6FA 5BVJA 2UZYB 2BY2A 2JJUA 3VGEA 1SEBA 4KHTH 5HI5D 2IGFL 4HFWA 2OXHA 4TNVF 1UR2A 2LU4A 4OUUB 1DE4A 4RAHA 3P9WB 3ZIZA 2WHLA 4WY7H 3CFBB 1XSIA 5DJXA 1SM3H 1UXWB 2AV1A 2F61A 4AZHA 4JZOA 1ZT7A 3KLAA 3SCSA 1EZVY 3MANA 5E5UB 5E0CA 4IRSA 3WXVH 5MERB 5HYJE 4X6CF 2JKXA 3W0WA 3WS6A 4MAUL 1PD6A 4IS6B 4P46C 2X4PB 2UYLA 1YUHA 4BZYA 2YKKA 4G43B 4H25B 2PCPB 2XI9A 1ZLSH 3MOAH 4G9FA 3TOPA 2C3HA 3DVGB 5TJWK 2FH8A 3CMJA 4MJ4A 2WC7A 4JFED 2J3SA 2ZCLH 5DEGA 4UDTB 2NNAA 2Y07L 4XCCH 1UQSB 4BZ2H 4XTRC 1GC1C 1RZ7L 4HUUA 2KKQA 4KJWD 2QSQA 5EZIH 2VABA 4BELD 1Q94B 4H0IA 3VGFA 1HN1A 4X6FB 1DVFB 5H2BA 1T7YA 4LARL 1JMZA 4OIIH 4S2SA 5C0IA 3RVTD 1X9QA 4KI1A 4KZEH 3LS5H 5C9KA 2CCRA 2WPGA 1KSRA 3NA4A 4WENB 2DSUA 5D2LB 3O81A 4MXWL 4XH2B 3RDTD 2FCBA 4L1HA 4ZD3H 1JWMA 1O7AA 4AD4A 1KLUB 1GONA 1DVFA 5H2BB 3QBTB 4UIKL 1OCWL 4WIQA 2H2SD 1ZWIA 2WK2A 2YN3A 4MNGA 4JY5L 4QHUB 5IMKB 3MROA 4QRPA 4K71C 1TVPA 4HTYA 2XZCL 4WVRA 3U9UB 4IHOA 3DIFA 1JHLH 5T5NG 3WHXA 5IHBA 4PJ7A 4MA8H 2WW8A 2VXUL 3U7YL 4LSSH 4G8EB 3DX8A 1FFOB 5IJKA 5J1AB 3D0VA 2KBGA 4J8RA 4BZ1H 3GXIA 4P57B 3ZDZF 3N0PB 3WUEA 4N0FA 3U5YA 4M7LH 5ITFA 4BYHA 3EFFB 1DUYA 4TTDC 4ONFL 5FGCE 1GGIL 2YBUA 2AJYL 4AENB 4PYSA 1N7ML 3SCQA 3LV3B 5GGQL 4DGVH 1CZ1A 2OI9C 4EXKA 3C9NA 1F3JA 2DMCA 4NM8L 5J57B 4PGJA 1WFTA 3GMPB 4KTYA 4KJYB 5L88H 3FO9B 4GO9A 3EYPA 4WHTB 2OK0H 3EFDH 3MRPB 3C60B 4OD3L 4XRCB 4NHCL 3IFPA 4HUXB 4HPOL 4FXKB 4HXAL 2XT1B 1A6VL 2HLFC 4X9FA 4K2UL 2VDMH 3VH8B 2DB8A 3CZJA 3M8OL 4TRPH 3ZE0F 3IT8D 1ZS8B 5I1EH 3RQ3A 4I4WA 2YUXA 1P2CA 2AK1H 3P0YL 3NYDA 5C0BA 4J3WA 3RKDC 3WIHA 1I3RA 5KSBA 5FGCB 2VRAA 4MB5A 5CGMA 5DT5A 4AD2A 2JJSA 4X0KA 1NH6A 3P30L 4Z6AT 3S36X 3PWPA 5HD8D 2XGIA 3VXUD 4FZ8H 1ZE3C 4WFHE 1R5WA 3VD9A 4HWNA 5SWQA 4F9LA 4B15A 1RZJL 1BVLA 2ARJQ 2KZ1B 4PGCA 3V6FA 1I3RB 3QUYD 4KHXH 2D31B 1JNDA 4RFNC 4D6IA 4U49A 5EBAA 3G6JF 3SUWA 1KNOA 2P8PA 3EO1A 1DUZA 1ISVA 2DPEA 1EDTA 5TF1L 2CJUL 5JIPA 1CGSH 3BLKA 4UIMB 3ESVF 3FFCB 4ZO8A 1MCOL 1FFPA 2PWFA 3DRTA 3VFUA 25C8L 2VVNA 4KK6C 2WANA 1T5WA 5TGBA 4OFKA 1X5JA 5EUOB 4KAQH 1UWEH 3CIQA 5DWUH 3QFDB 1CXLA 1UENA 2XFYA 4XPGL 5CSGA 1S5HA 3WFBH 4YHNB 3P3YA 2H26A 5JTWA 1G1CA 4W6WB 2XQYG 1ZSDB 3RDKA 5HHVH 1KT2B 3RTQA 1MFAH 1QO3B 3DC0A 3KZSA 2HKFL 5GRJH 4M24A 3BQUC 3QUZA 3BJLA 2XNAA 1FN4B 4JDVB 4JVWA 5FYJE 5E99L 4AISA 4L9LC 5GRUH 5DC0A 2WMPA 4MAZA 4U0RB 1XF1A 3OKMB 3GJEB 4XAKE 1KNOB 2P8PB 2L0DA 3T2OA 7TAAA 3BIKA 4HCRL 4JFEA 3BAWA 4DW2L 4G8GD 4XCYA 3ZO9A 4J3VA 5I2UA 4FP8L 3GSWA 3F58L 1WZMA 4OD1L 3MUZ1 3RWFB 3GMMB 2W5FA 5F9OH 43C9B 2XN9E 5D7JA 5A3HA 3CCHA 2JCCF 5F7UA 1PDKA 1TPXB 2W0LA 1CEOA 4OM1L 1KBBA 1OLZA 3THMH 1SM3L 1RD6A 3BRFA 2NY2B 3L3HB 5L2JA 4MQ7A 4JPWL 1A64A 4NQED 2AEQH 2F5AH 1DQDH 5C0GA 1MFEH 4ONOA 4WI4A 4Z7WA 3DXAD 4ZOEA 2BSRA 2EPKX 1ESWA 3PZ9A 5D2NE 1PZ2A 1IQDB 4D0CB 2W65B 2BVDA 1N6VA 2ZX5A 4NNYA 4DKFL 1M04A 3O45A 5BS0A 1E4NA 1PZUB 5J56B 4R7NA 1BQCA 3ET9F 4ELME 5IEHA 3U7VA 3II1A 1GQIA 4L3EE 1DVFC 3MJ8A 3RWGB 1AQKH 2VISA 1L0QA 3BP6B 1U33A 3KPNB 1W32A 1Q6EA 4JVPA 5EU7C 4HS8L 4V28A 4U6HA 3VI4F 4Y7MA 3T0XA 5ENWB 3QUYB 1AIFB 1KJVA 2DGAA 1CTNA 1LO2H 2NLJA 3QISA 1IEAB 1OVZA 4LARH 4OIIL 2Q76B 5E8PA 3SUVA 3PXJA 4DKEH 1KPRA 1A0QH 1QA9A 2JLLA 1EIBA 2VDRH 1LK3H 5FF6B 5J1TC 1FVEB 4P2YA 4GS7B 4B3LA 1AKJA 1JGLL 5C6TL 4R7NB 3CDYA 2XZZA 1M7XA 5DSCB 2XA3A 5JLZB 2WWCA 2RGSA 5T3XD 1W2KT 3CSPA 4S3JA 4M1GH 2DBJA 1PGRB 3DTXB 1VFOA 1CGXA 1DWIM 4M80A 1KGXA 3OKKB 1ECEA 4HPGA 2FBJL 4UOQA 2DYPA 1KN4H 4F15C 4HUVB 3VFTB 4AL8L 2XSBA 1B4RA 5I17B 2VDML 5INCA 2EDWA 1C12A 1JP5A 3RJYA 5I77A 1OM3H 1XYZA 1E4WL 4N90D 4G6KL 3KYAA 2HISA 4LGRB 1ZHLB 3HG1D 1DCLA 3QXTA 4M1CC 5HY9B 4PUEA 3UEZA 2WLYA 1A1NA 4XHQA 1OIFA 2B7DT 4MQSB 2DYPB 1V7MH 3V4PL 4BQCA 1UJTA 5L6YL 4XV0A 3BDXA 3QI9B 4PRPA 4GBXA 4TUKL 3VO0A 4P5KA 3FQXB 5CHNB 1EA9C 1X4XA 1SJEA 1IQWH 4DGYH 2XZCH 4R4NC 5CD5C 2W07A 4IJ3C 1TJIL 4W89A 2J8UE 3APGA 1C93A 1OPGL 1F4XL 5ILTH 1IGML 1CFTA 3B2UC 5J6HB 2P4AB 3KNBB 1C7TA 1GIGH 2WP3T 4BFBD 1E56A 1SVZA 2WBJC 4D6DA 1IZJA 5CGYC 4LVHB 2HVKA 2C3VB 3ZDZE 3RFZC 1F8TL 3D2UB 1I9RL 1DBML 4C83B 1DBBL 4RAUB 3TZVB 2AEIT 3BAKA 1NC2D 3GIVB 1EAJA 4H5SB 3HR5B 3S6TA 1OTUD 4G9DA 1RQ5A 4L29A 4XNQA 5T3ZD 1DFBL 2X4RB 2XRAL 4XP5L 4AM0B 4OGXH 3SCPA 5F96L 1G7LA 3KPRE 5JOPE 3V52L 4OF0A 1VJZA 4ELKA 2BNRA 4HGWA 4R8WL 5F3HB 3T08A 2ID5A 3JWOH 4L4JA 2JJVA 5ETUA 4N68A 4RA3A 5D93B 3HAEH 2CKBA 1NAMH 4RAVB 2EDFA 1IMHC 3S36L 5GGSB 2VLRA 5DZOA 1CTOA 1WP6A 2P5EB 3GSXA 1R5WB 4WHYH 5T33L 1B3JA 3B5TA 3RX8A 4LHUA 1BZQK 4P2OA 3F4VA 1I1AB 4MLSA 1PBYA 4FQQB 2NY6C 1KXQE 5FM8A 2BSRB 2WV3A 2WBGA 5IMLA 3NH7H 1MW0A 5CD3B 1JL8A 3GI8L 4L4VA 2OXGA 1KIQA 3R8QA 4I18B 3OKDB 4N9GA 2W66A 1UD6A 3LKQB 1WAAF 3VNYA 3LD8B 1KCSH 2XYLA 2XWBA 1SJVA 4XC1H 2ICCA 3BW9B 4XGZB 1JYNA 4RGNB 5DRZA 5TE6L 3QHOA 5HYSG 2YD5A 5BJTB 3HMXL 1YMHA 3TCLB 2BV9A 3K1DA 4HOWA 2QV4A 1VBUA 1B1YA 4ONFH 5TGBB 1C16B 3A67L 3PJSA 3I84A 3C6LB 4XX1G 5AYUL 3BPOB 1EFXD 2WBJB 1F42A 1S7WB 2RB8A 5KVFH 4OZIA 4EE9A 1NJ9A 3GKZA 5DJDB 4FQLH 2VNCA 2JB6A 2O61A 1X5XA 3B9KC 5D70H 2WVVB 2EDKA 4F7MB 3CZFA 2Y6SD 1JK8A 1AKJB 4IDLA 4KZDL 1S7WA 5FYJD 1J0JA 5EU3B 5KS9A 5ACZB 5IQ7L 4IIQA 1T04A 1NBVL 1YECH 4NDMB 5E4IA 2YEZA 3U57A 1U2CA 1KPUB 1W9DM 4XGZA 3OXRB 4ODTH 3GSNA 4Y0GA 4P5TC 1S7TA 2VDQL 1U58B 5I1KL 4M7KH 3L4UA 1NCCH 3MRLB 2PYEB 3VD7A 4GQRA 1CGYA 1Z3GH 1QFHA 3FB7A 5D7LE 5D7LA 3W0WD 4PJ5A 4R3SA 3AYRA 3ARRA 1F11B 1D5BA 1AQMA 5FIPA 3AC0A 5CGTA 2J7HA 5E8OA 4KHXL 3H9HA 1HCFX 4MAYD 4OBRA 5TQ2L 2NMSA 4JFUA 3Q1SL 1BQHA 2E7HA 2X70B 1HXJA 3MXVH 3TONA 1MHEA 2VDOH 3TTSA 4YZFE 1OAXL 1BGGA 1PZ3A 3U83A 5I1CH 1BD2B 4KJPC 3DXAE 1CR9H 1MIML 3OKYA 3VD3A 3AY4A 4HWBH 4AZCA 5E2TL 4RGNE 3VIGA 1E15A 2F19L 4BSJA 5DJCA 4U1MA 4Y1AE 1IC5L 2ENSA 1NSNH 2YD1A 4XRCA 2JE8A 3IXAA 4K2UH 4JQXA 1NDMA 1NLDH 4WKFA 3L5WB 3N11A 2NY1B 1OM0A 5H8DA 3GB7B 4YGVB 3ZKXB 1OWWA 4PLKD 2IPTH 2R0KL 4JPKH 1CWVA 1CLYL 1IC4H 4NSKA 1E0VA 5IWLA 4U1MB 3QG7L 4KI5F 3DX9A 5DQDL 1XCQA 1D5BB 2G5RA 4W5ZA 4EDWH 1BJ1H 3EZ8A 3OGOE 1NGQL 3HFML 3G6DH 1ZV5A 5DD5H 3PDOB 3U1SL 3BSZH 1XT5A 5IW1B 5DMGC 3CHFA 3MSGA 3MODL 3M46A 2AAAA 1OAQH 2AABH 3AS0A 4UFMA 4HKXA 3UTZB 4GW4B 3VRLE 2WMKA 3MR9B 2H2PC 2WMIB 3BKJH 2ZCHH 3AXHA 1GGBL 1HNFA 3QDGE 3WHXB 3WE6B 5EC2A 2FJHB 1AD9B 4XZWA 1ISXA 1TTFA 5KVDL 1M6OA 3KPQB 3RGVD 5DJZA 5CBAA 4JY6A 2VXTL 2CKRA 1A7PH 3O6KH 5DK0B 1F8TH 1JNHB 3WNPA 5C8JB 4ODVH 2YBRB 1GOQA 4MJ6A 4AG4L 2LABA 4P2OC 4JFZL 4NKQB 3FQUB 3PGFL 2MQ3A 5IHZA 3NFSH 4DWSB 2V5SA 4M9PA 1MHCB 2FH6A 4KJQD 1NUFA 1H3TA 3HMWL 1WIUA 1CN4A 1CE6A 1ORQB 3ZKMC 1TA3B 4WWKC 2BSSB 1UM5H 5M03A 1ZGLP 2VKXA 3PWPE 4NQCB 2DLFL 4MA7H 2W63A 3CSYA 2ZG2A 4B5EA 4PRHE 3QFJB 5KVGL 2V2XA 4TUKH 4MTVA 4U1GC 1J0KA 3FOMB 4R4BA 2CO7B 1LQSR 4JFDE 3WE6A 4WI8A 1D3CA 2AJSL 3DETC 3WD4A 2X4PA 2ADGB 4KROD 1UD4A 2UWFA 5E08L 2A77L 4GRLB 4LAQL 3MLTB 4XZUA 4M7KL 4BH8B 1WC7A 5BO1L 4G6FB 1BX2B 1F2XK 3A6OA 2R2CA 1AHWC 3S96B 4JO2L 5FL1A 3CUPB 2DM2A 4U0RC 3NH7L 3TFKD 4ZUTB 2VDPH 3DMMA 4XWGL 1EO8H 5DRNA 4U7SA 3RTQC 2YZ1A 1OM3L 4EI5D 4JANA 4IMKA 5TDOB 4YHML 5CD5D 2PXYC 2XKUA 3NPSB 4PUDA 4D72A 4FQ2H 3MRNB 1KPUA 2X1PA 1UYWL 5I1CL 4XNQB 4PFEA 3IJYB 1XGTB 2ICWB 3H9ZA 2WHJA 3ARYA 1WBZA 2IG2L 2R56H 3BD4A 4HPYH 3WMCA 3DOSA 3O6FC 2NY3D 1US2A 1JTOA 1NLDL 5C3TA 3IDUA 2PO6A 1F2QA 2B4CH 4ORZC 5E6IB 4OCSL 5GJTL 1UB6A 5K33A 4EI5C 4UQ2B 2YLAA 2GSGA 1KQZA 3ZL4H 5FYJU 3LZFH 1BAGA 3C5SB 1ZSDA 3AGVA 1QI3A 2P45B 4L3EA 4H8UA 1TVDA 4DKEL 2EYRB 4DWSC 2QSTA 5J1AA 4G8GE 4OB5L 3GI8H 5I8CB 4HIEA 4PJ8B 3QUKA 2Q8AH 3SJVB 5I1IH 2PF0A 4Y2OA 5FIEA 4UU9A 3A0OA 3UG4A 5GGUA 3K3QA 4Q6IA 2IH1A 3EDDA 4YXHH 1K4CA 4OGXL 5M94B 4UT9L 1NCCL 1W8OA 2XG4A 3SGKA 1W3KA 2CQVA 3SDXB 3RMEA 1AD0A 5D7JB 5J6GA 4Z2IA 3BPLC 4MJ5A 4NO2B 5H35A 4UU9B 2BC4A 2YA1A 3FQRA 4F3FA 3VXMA 3O3BB 4BS0A 3SY0A 1DN0B 5J7CC 4X5WA 2VC2L 2FWOB 1WF5A 1UR9A 3WF4A 4OZIB 1S5HB 1HL9A 2HTLD 4LSTL 4P9HH 4QHLB 3OAYK 1JPTH 2BMKA 2HFGH 1JYXA 1QACA 5JXAH 3O6LH 4F9LC 4M03A 1TXKA 3IK2A 4P2QE 1LO3H 2XN9B 4FOMA 3MRDA 3UMTA 1GOIA 4FG6D 4CW1A 3V7AG 2OLDA 3SKMB 3BEWA 3BUTA 1CVSC 4GAYB 2WAGA 5EUOA 5FB8B 4DZBB 3HPJB 2PWEA 4M81A 1JBJA 1IGMH 3H9HB 4F8TA 2XACC 1JVKA 4JO1L 1WNOA 1FVDA 1SYSA 3HE6A 4KKLC 5I1DA 4PR5B 1X5AA 2DQCH 4CCDA 3DVGA 4GXUM 4HK3N 1MJJA 4NBXB 2X5PA 4M6ML 1H5BC 3P9LA 5DFAA 4POUB 2C3VA 1ES0A 4XP9H 2R4RH 3DLQR 4ZXBC 4FQ1L 5CLTA 2JF7A 5IVNA 2HMID 4LGXA 5A1AA 3WBEA 2AXJA 3PUCA 4WU5B 4OF7A 5BXFA 4JKMA 4OUUA 3T0EB 2CD0A 3RWFA 3P9LB 1EO8L 1BD2D 4LCCA 3I02B 2RJMA 4ONGH 4PSPA 1LDPL 1Y6NR 2OR9L 3QB7C 3IJ9A 2ZG3A 3OKMA 5FCUL 2BNRB 4HGWB 3GH7A 4PRPE 4ZO7A 3VDAA 3HLAA 2BJML 1V08A 5ESVA 3NIFF 1PSKL 2QQNH 1V8HA 5C0CE 4WTZG 5D7JC 5F72S 3WL0A 3BQUD 5BQ7A 4ZTPH 5T3ZH 5AYQA 1GUVA 3LMJL 6CGTA 4MA1B 1FL6B 1HEZB 1H5VA 4MSWB 1TFHA 5EBLA 3KYOA 1INQA 4K3GA 5SWZD 5IV2B 4E5XA 5J12C 1MXDA 4Z7UA 3PQYA 4YDJB 1H0IA 2NNAB 4K94C 2V3GA 3R0MA 5IB3A 5A6BA 4I18A 4Y5VB 3S2CA 1TUXA 2LTQC 5CBAB 2W60A 3UBXG 3ARBB 4HZLA 4F7TB 4QRPD 5E1AA 4WU7B 2MSPA 4GMSH 4XP6L 2AK4D 1A3RH 2OTUB 2DLIA 4PJIA 2G75A 3RNKA 1FGNH 5HYEA 4HBQA 2OJZH 1QR1A 1QVOB 4HQQL 4ZUUA 4DAGL 1J0IA 5D7LB 5EBWB 1L7IL 3G5VA 2CKBH 3HAEA 2DIAA 1B3VA 4CD6A 1NMAL 1CLYH 1IC4L 2ENYA 3MFFB 4MSWA 3QI9D 3RI5F 3VGBA 2CBUA 4PV9A 4ZXOA 3QO0B 3KDMA 3L1OL 3WELA 4D6HA 3ZDYF 3U79A 1CFNB 3TNMA 5C0NC 5I76B 1DEEB 2DQUH 1A6UH 1ODAA 3GSNH 2WC3A 1KTDA 4QOKA 3RKPA 1U8OB 1J9YA 4M5YH 1S78D 4P3DB 5E8DL 4P9HL 1TZIA 5DEFB 3OKEB 3BH9B 3OG2A 3QDGA 2E8YA 1A3LL 3I6KB 5E2VH 3SKJH 2BOBA 4U1LB 4LAQH 3FONA 1INDL 4R5EA 4OSUL 1KYOJ 2B1HH 4LP4A 2G4FA 3HE7B 2MCG1 3UPAA 1S7RA 3I9GH 1TCMA 5GZOC 3BUYB 1IM9D 2FZ3B 1YEHL 5DXWA 2YPVH 1LEKB 1LEIB 3KXFA 5CJQH 4UT9H 2D9QB 2DQDH 1E6JL 2AK4E 4MA1C 5C0JB 1V0KA 3LEYL 1K9DA 1WPCA 3VM7A 1S9YB 4R9HA 5FA4B 1YEFL 4EXPX 3GXFA 2PKDA 4HMCA 3LQMA 4NO0D 4LPCA 2OTWB 5AY7A 3B9KA 3QXUA 3MRPA 3JWDH 4JRXD 4P7QA 5AC5A 1MFBH 3BQUB 1TQBC 3HPJA 2ITCB 1MQQA 4AD0A 3X3FL 1V6WA 4S1RH 2GJZB 3O6KL 4F37K 4NP4H 5IVXA 5MENE 5IEHB 4ENEC 1TVNA 3W81A 2X4TB 3RWEA 5FO9A 1E4IA 2VYRE 4Z0XB 1MW1A 2VXSH 4HBCL 5HDQL 5IHUL 1HSBA 2WWKO 3GDBA 2DSWA 5EO9A 5DHYA 1UG9A 3TH3T 5ACZA 1AXIB 1LHZA 3A47A 2A3CA 3C2SA 5BRZA 1K8DA 1FFNA 1QR4A 1H5BA 4JLRA 4UT6L 1L9MA 3CZFB 1XRVA 2D7MA 1I7UB 2YC1A 1MQ8A 1T1YA 5CJOL 1JPTL 2HFGL 3MODH 2X89D 4GKZA 3T2NH 3VUPA 4B7LA 4ZOBA 2OL3L 2NX5A 3HZVB 4NN6C 5E09A 5BV7C 5MI0C 2E6QA 2VL5A 1HIML 3P4MB 4OI8A 2FEEL 2XY1A 2VZUA 3C6SB 2R29L 2R0ZL 5EZOH 4ZG1A 2A1WH 5GGUB 3QPQC 2VDRL 5IG7A 4OZ4B 2FJHA 3RWHB 1N59A 2XWBB 3OJDA 3BXWA 4Z2JA 5IDIA 2KQNA 3ILQC 4X7EC 1JDDA 4ZUSA 4MMZC 4HJ0D 3MU7A 1MQRA 3OLEA 5FL0A 1ZOXA 1PZ5B 3VGHA 2V17L 1VJSA 2ZPKH 2P8MB 4P2CG 2ADIA 2Q8BL 4XNMA 5CEYA 3BXNA 5EU5B 1QSVA 4WTXA 5HHVL 3WEXA 4Q6IB 4F9DA 2EH7L 5CEZD 1T66C 2JB5L 5D2NC 3VFVB 4PRNB 3TEUA 1KCVH 1EHXA 4B16A 1M05B 1W72H 4JFXB 35C8L 1XCQB 3CC5A 4NRYB 1LEGB 5E8NA 4ZUWA 1OWRM 2CNCA 4U1HB 2GHWB 4Y19D 1GOMA 2X44D 3FFCE 1HKFA 5F7EL 2VI0A 3TH4T 2UWEF 5ACMA 4HXBL 1BWMA 3UTPE 5BYWA 3IFLH 3BSHA 1FDLL 2BXYA 4GRMB 5CJ5A 1UVQA 5JA8B 4LU5L 2FLBT 3MV7B 1T21A 4NNXB 3DBXA 1HKKA 1LK2A 4MNQB 4NJAL 1IV8A 2HFFB 3MLZL 1QFOA 3CVHB 3L3DA 2NY5C 3ABZA 1GGTA 3NCFB 4WWKB 3QJHA 1G0XA 4U1NA 5DDHB 3QEQA 1F4XH 1KF9B 4NQEE 4FFVC 3WNLA 3K2UH 3IDXH 5TPWH 1GIGL 3S35X 3P2TA 4OFVA 5BMFH 3O2DA 3AXIA 4F15B 2R2EB 3ARDD 4WIWA 4X6DB 5DJAB 3PHAA 1IRAY 5I1GH 4P59L 4NYLB 2SEBB 1KTKE 5A2JH 3BN9C 1U91A 3L1OH 4R96A 3WFDL 2F5BH 2OCFD 1DBKH 2FHBA 5I6SA 1MJJB 4L3CB 3JUYA 3KJ4B 4O5LL 3TGXA 2H9GB 5CHNA 5EUKA 4NZUL 2RGLA 2HWZL 1T7XA 2DOCA 1MW3A 4F79A 3W24A 2NYYC 3UTSB <