4MB5A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella complex with nag5
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 172
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb5A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb5A01
2H45A 4UFMA 5DSCA 4P57A 4FLSA 3MUAA 2YDRA 4Y16B 1NH6A 2AJXH 1OP3H 1OAUL 1VENA 5DS8B 3N04A 4P5TD 2HFTA 1PKQA 2JIXD 1RQ5A 2EDWA 4JDZA 2FGLA 1MCHA 3R1GH 3H9ZA 3HAEA 1EHNA 2JB5H 3BUYB 4H1LA 4XH2B 5DLMH 3WEXB 1UWTA 3W6MA 4AK1A 1Q9KA 1OP5K 3ILPA 3IFPB 4D6JA 3BGMB 2QR0A 3AXLA 4MD5A 1FH5H 1GL4B 4B15A 4ZO7A 4PJBF 4PJDE 4MAVA 1XH0A 1NGZA 3L4UA 4GG6B 2EH7H 4J3VA 2PWHA 1L7IH 2VISA 2EEBA 2CMRL 3G04B 5GS0H 4KC3B 2Y7QA 4OZIB 4JO3L 2Q8BH 2XGBA 3QZWG 5L8KB 1DFBH 3T8XB 4KMTL 2X10A 1YYLL 2EDTA 4PJEB 4XP1L 4F33B 3RQ3A 1CT8B 1YNTA 5E56A 5JXAL 5LA1A 2WINB 3SKNB 4XNMB 3DXAA 4L4VD 3E3QE 2FEEI 3ARSA 4WGVB 2I07B 4G8FB 2AMGA 3F5LA 1JGUH 1T89A 2XKNA 3QDGB 5J8OA 1ERNA 4Z7WE 1ZHNA 5D96C 1CE6A 2MQCA 3SCNA 4JPKL 3C60B 3SE8L 2UWEF 3LDBB 3II1A 3WBAA 2ZXAA 4HW6A 1C12B 5J13C 3CLWA 4OUEA 4MGXA 5SWZB 2GUOA 1J8HB 2YPKB 4Q97A 1OGBA 4MHHG 3N11A 3LN4A 1F42A 4LSPL 5GGTL 4WFHE 2EQDA 4BSJA 2MWCA 3G5XB 4OD3H 1QFOA 5J4MA 3BYTA 4LLUB 1YN7B 5I6XB 2NXZC 3QB7C 4JB9H 3WLBA 2W9EH 1DBAH 3LKSB 3CFKA 2VLKE 2NXZD 4NKDA 3VIMA 1XH1A 3H3PH 5E9DE 1KXTB 3PHOB 3S6CA 1ZWIB 2ICWB 5L7XL 5T1DH 4JZNA 4O51A 4PGCA 3OZ9L 1OOAA 3HZVB 3EO0B 2V2TB 3FOMA 1U36A 1WZMA 3C2AH 4JHAH 4JKLA 4KTEL 4JO4L 4L3CA 3AY4C 4P59L 3SY0A 2D7TH 1T1WB 3EYVB 3S3PA 5EBLA 2XVKA 1HNFA 3QNZB 4OF0A 4DGYH 4HWEH 4FNLH 1EIBA 3RX8A 2EO9A 1VRXA 5BW7C 4HK3J 2H2SC 4WUUE 4FQCH 3JV5A 2VZVA 3K2UL 2FX8L 4BQ9A 2OCFD 4F3FA 4UT6H 5ERWB 2V9QA 3PP4H 2H2SD 4LSUL 3RI5K 4Y16C 3RWCB 3S5LG 4ORZC 4CUCA 1WGOA 5KAQF 1DQMH 1YNKH 5GQBA 3HR6A 4Y16D 4F7MB 4Y4HA 3MOAL 3OKMB 4MCZA 1PYWB 3LMJH 4M5ZL 4MNGB 5KVFH 1A21A 2WWKT 1H2JA 1AXIB 4Q2ZB 4Y19A 4ZSOB 1HHGB 2BNRB 1FRGL 3PWLA 4PJ7E 2VWEE 2YK1L 3EOTL 1LO2H 5FGSA 5CJQL 1YEJH 1R5WA 3KG5A 3KXFD 4QNPE 1M7DA 2VUOA 5LGKA 4S1RL 2Z35B 3S3SA 1XF4B 2LU7A 4QO1A 3VXMA 5IB3B 3EFDH 5DXWA 3IJHA 2BNQA 2QSTA 1Q9LB 5HDQL 1PY4A 3VXNA 1S7XA 3DIFB 4FQLL 1TCMA 1LF1A 2OL3H 2I60H 3DRTA 3F8UB 1ZBKA 2DQGL 5TDPB 4BFEA 2EXWC 3GB7A 1AD0B 5JORB 3NPSB 2I9LA 3OJDA 1CFBA 3VGHA 1ZU8A 2FHFA 3BH4A 2DQEH 4ACPA 4KY1H 2EXWD 2WSKA 5SX5K 1LE5A 3QZWA 4L4PA 1CLOL 3C60C 4V1DB 3AAZA 1E56A 2SEBB 2H6PA 4KPHH 1AR2A 3LDBC 4FXGA 4Z7VE 1NGXB 1JK8B 4LQFL 2V5DA 1WCQA 5EC2A 3MUGA 4PG9A 3C60D 3GK8L 3OTTA 5FM5O 4XB3A 4FP8L 4P0DA 2ZPKL 3N1PC 5ESAB 2B1HH 1HH9A 4PUEA 5CKGA 2JFEX 3FO2B 3WIJA 2UY7A 4LHUD 4N8VB 3WUBA 4QKXB 3K1DA 1I1FB 1RU9H 5I6XC 2A3HA 3ALPA 3LRHA 3MLUL 4PJ9B 4YHZL 1F6LL 1M71B 4WHDA 4YDIL 4I4WA 1XCQA 5E1AB 5C0JA 1JTTA 2R1XB 1V7NH 4F57L 2F53E 4ALAL 1IKNA 1BQSA 1P2CA 2AEQH 4PRPB 4POUB 4X4ME 1WWBX 2VXUL 4JFEE 5FOBB 3AZTA 1KCVH 4R7NA 3BXNB 1GAFL 1JMXA 3KLHC 5I74B 5EDXA 4HWBH 2QSQA 2VDLH 4OKDA 1KB3A 4UDTA 3F5KA 4F9DA 3IS0X 3KLHD 2X05A 4NPYA 5K9JL 4JFDA 5IMKA 4L3EE 4A3YA 4YO0B 1F3JB 4XC1L 1NSNL 2AS5M 2ZX5A 1ODAA 4M6AA 1MWOA 3PWPE 3D69B 3MLRL 1V05A 3U9UA 5DVNA 3AHZA 3JV6A 3VE0A 3CDGB 4PGBA 3A6BL 5FKPB 3WFEL 4JHZA 1NWTA 3TGXA 1IQWH 4XB7A 4XWOC 4KRUA 1D5MB 5BRZB 3D0VB 4AIOA 5MENB 3MLWH 3VNYA 1W3HA 4XC3L 1ZLWK 5I30H 5EO0A 1R8LA 4XWOD 1CD9B 5F6HI 4JY4B 3FL7A 3SQBA 4WF7A 1U9KA 4RIRB 5FHBH 1FZKB 3BJLA 4Y4KA 4JY5L 1R3KA 1JF5A 3DI2B 4CKQA 1EFQA 32C2B 3D87B 4Q6IC 5CGMA 4MA3A 1OLZA 3S5LA 3FT2A 4GAFB 4K8RL 3VXSA 3UO1H 1LG2A 3VFTB 4R90H 1ZHBB 2O5ZH 1JXKA 4MJIB 5EIIB 4ZPVA 3UJJL 2AJ3A 4QRPA 4IPNB 1R24A 4TSBL 1I7TB 4YHML 3B5GA 4YDVB 1HINH 5F9JB 3E6HB 1RUPH 3WD4A 4TVDA 4N1CA 3NPSC 4YHGA 4BQCA 4Z18A 1KCRL 1EMTH 4PMQA 3I6GA 4R9HA 1DWHM 2ZXQA 3BPCA 1LDPL 5I2IA 3QP3A 4XHQA 2QHRL 1AQDA 2BSSB 4MDJB 1BPVA 1TVBB 1TJIL 4P23B 3RHWK 2FJFB 4PJBB 4HZLB 4NGHL 4QF1A 5E5RB 2WHKA 1GHFL 4V1DD 3TBWB 1VFAA 1S9XA 5LQBL 3E1F1 1A0QL 5GGRY 3RJXA 4MMXC 2FJGA 3AU1A 2VX6A 3HI6H 4U1JB 5EU4B 3OAZK 1A5FH 3LN5A 4Z7UE 1C5CL 4PJ9C 4PJAF 5CJXC 3UYRH 3FRPG 1IC7H 3SGKC 2FLBT 3UBXI 3AXHA 1FFRA 3QDJA 1E4XI 1I9JH 4PJ9D 4TTUA 4NRSA 3WIFA 4JG1L 2R1YB 2XWTB 3H9SE 4YR6B 5A40E 4ZFOL 3WLWC 2EPLX 5GGRA 5E2UH 5I74C 3FFCD 4QXWA 4PJCA 3MV9B 3BKMH 5EZIL 2UWEB 2DTSA 4QXUL 3WLWD 1DWIM 4ZG1A 2DT3A 3SDXE 5MP6L 4HQQL 4UILL 1FZMB 3V5HA 3PABA 2DDXA 3PV7A 1HKMA 3BDXA 1XCXA 4XVUC 1TQBB 1OIMA 4DVRL 1KCLA 4GW4B 4L4TE 2L4OA 3QEQA 4XVUD 3WSQL 1JPGB 1RPQA 2JCCE 3NOIA 5HHVL 3S9DB 1T6VN 3LKRA 4FOMA 4HLZG 4XCCL 5EZLA 5HGHA 2YEZA 1AGEA 3MJ8A 5ELIA 2I9TA 4LNRB 3TNNA 3RIAF 5D9NA 3LZFH 3H2WA 3RWJA 1JV5B 4BZYA 4D0DA 2R69H 4NQCA 1T03L 4CD5A 5MEND 2YKLH 1IGMH 2NCMA 5C0IB 5D5MA 1DBML 1UEYA 4GSDL 3OXRB 3QRFM 1IQDB 9CGTA 1F90H 5EBAA 4ZDHA 1GONA 5IFAH 1T20A 4HDIA 3JTTA 3A3HA 3CUPA 2YBUA 2G5BB 5JPMB 3FB7B 3TV3L 2XOTA 5F3HA 3A67H 1MLCA 3KWWA 4NZRH 1Y6NR 4W6XB 4YXKH 4BA8A 1E4XH 4J2XA 4K23H 1NGQH 4AY0A 4PJ5E 3MLYH 5HPMA 3SURA 2R4SL 3VNZA 3QHZH 4H26B 3QXTA 3FT3A 2DH3A 1JYVA 1JD7A 2E5EA 4JFFE 4LSVH 3MYJA 3T08A 3OKDB 4HUXB 3VG9B 1E3XA 1W1PA 4GBXB 1H5BA 5E2VL 4J7RA 2QJDA 3MJ6A 4P23C 3VXPA 3AJ7A 1I9IH 2VQ1B 4YHYB 4KJYA 3EMZA 2QQKH 1WUNT 4QWWC 5I1LA 2YZ8A 1YQ2A 3UX9B 4X5WA 4O02L 3WKNA 5A8NA 3HE6A 5IHSA 2WK2A 2CGRH 2P45B 3I2CH 1WZLA 2XACC 3CK0L 4NN5B 4P23D 3FB5A 1P7KB 4BSWA 4GI9A 4PJFE 4DZ8B 2PR4L 5F89B 3GSUA 1W72L 2G2RB 2H1PH 3NZ8A 5IHLB 5JDJA 2LQRA 2PWEA 1KPVA 2XZAH 3OHXA 2VUYA 3ZTNH 1QG3A 5I1CL 5T3ZE 3REWA 2P5ED 1SM3H 3VIFA 2VTFA 3PL6A 4LLWA 4OT1L 4HUUA 1T04A 3GI9H 4P48A 5KTEH 4OCRL 4MB5A 5SWQB 1W3KA 4ACZB 2QEJA 1VFBA 1UYWH 4M3KB 5HHOB 4U1LA 1XC6A 1G7IA 3OGOE 3SO3C 4EI5B 1IVLA 4PSRA 2AXFB 3EYFA 3KE0A 3FRPA 1N8ZA 2YD1A 5E8EB 3MA9H 4XCNA 3LCYA 3MV9D 5AZ2H 4AZ7A 5DRZB 1SBSL 2QMKA 1TQBC 4BQ6A 3PZIA 3DVGB 3QDMB 4BFIB 1AO7A 2J7DA 1LO5B 1OWWA 4M1DL 3U0WH 1TENA 4DUVA 1AD9B 4C57C 1CL7I 1UCBL 1T1YA 2X1IA 4MA8H 4N5EC 3F65A 4XPGL 3VDHA 1LHZA 1D9KA 5GGVH 1DQJB 3HMWH 2F5BL 5EOTB 2XN9E 1OAKL 4XX1E 1OD0A 4N5ED 3CVIH 4JFHD 2AJUH 1BEYL 5IF0A 5EBWA 2R4RH 3L7FB 1E4WL 3NCEB 1TR1A 1QO3A 4YDLC 3RPIB 3VW3L 4UDUB 3RUGE 1NGPH 1QKZL 1INEL 1FL6A 1CZ8H 5ESVB 2DLFL 2DGAA 3DGCR 5GGUB 4PUBL 4HPGA 3MRCA 3OKYA 3WENA 1P4IL 4K8RD 2GAZA 5ICZA 2RBLA 3G08B 4OBSA 5IGXL 1JWUA 4BSVA 5DJZB 5KVEL 4EIGB 4AISA 3AIEA 4NHCL 4YFEA 5KZCB 4Q9RH 3PQYB 5CBEB 2WVTA 1KIRB 1HX0A 5AAMA 1DVFA 1OAYH 1TETH 4HWUA 1S7VA 1GGIH 2O9RA 1FLRL 2ADJB 5EG6C 1BOGA 5K59F 3G6AB 4TUJA 4HIIA 1CFTB 1P84J 4DK3A 3HCVB 3PZUA 3OPZH 4BFGA 1JGVH 2N4IA 5DFAA 2W60B 4NYLB 2YC1A 4X4YA 1BIIA 4ONFH 1K3ZA 3RWDB 1QHOA 4NZDA 3RFZC 2KDGA 1I8KA 2J75A 2YR3A 2EPMX 3O45A 1ZLSL 1V02E 2NQCA 4PRHB 2D0FA 3GMLB 5I78A 2CBJA 4QTHB 2EPNA 1JWMB 2CD0A 2JB6A 4YHYC 2XTJE 4TOYL 1G1CA 1W72B 4QLKA 3OG6B 4CJ1A 4R26L 4LSRL 4W68A 1FLTX 3DX6B 1JNDA 3CUGA 1F8TH 3D85A 5D2LE 1P9MC 4JJ5A 4NN5C 2DYPA 5I6SA 4LPUA 1B0WA 1NEZB 3OKLA 4LLQA 4Z7VB 4I0CC 3RWEB 3VDCA 3ULUE 3HTLX 1S8DB 1RZ7H 4ONOA 4JAMB 5KOVC 5DZNA 3RX7A 3GJEB 3K8MA 4NRXA 4R3SB 2UZIL 3CSYB 2K1MA 5ENWB 1RZ8A 4XT1C 2D22A 2ED9A 5IBLC 3ZLQC 1BQCA 4ISVB 3CCHA 1G84A 4Z5RA 2E9IA 1TZGL 1EDTA 4I18A 1XH3B 2F74A 2BK8A 4PD4K 2ICCA 3QXWA 3X11B 5IBLD 4ZE5A 2BVUA 3VIGA 1LK3L 1RP9A 2O61A 1WVZA 4U6VL 3RVVC 3PBGA 5DD5H 4PTTB 5DJ0B 4OZFB 2DF3A 1F11B 1T7ZA 1NANH 3GSVA 4GXUM 3W39B 3GZAA 4OCNC 2DS4A 3MGAA 5FYLH 3IU4H 4F9JA 4K3JH 3HRZB 1OAZH 3FN3A 4ZXBA 1QVOB 1QSVA 2COQA 3SDDB 5I19H 1FVCA 2OL3A 1UQZA 1T66C 4DAGL 3U6RA 4L3EB 4NO2A 1PZ5A 4KMQA 1BYBA 2P8LA 4R97B 4PJAB 4KHXL 4Z0BL 2NNAA 4ZS7H 1KCSL 3EFFB 4JQIL 4B16A 1T66D 4OAWA 3VFRB 4RA3A 4FS0A 3BP7B 1A6VH 4PGJA 1CR9L 2FH8A 1JPSH 1A1OB 1NFDA 4NQXA 4YH6A 3F58H 2BVQA 1A2YB 5FGCB 1CFQA 1QOKA 3MBXH 4WU5B 1OP3K 2WANA 3P73A 1ONQB 5HYQB 2BVTA 2E4TA 5IT2H 2Z9TA 1N6QH 3KYOB 1EO8L 4XRCA 5BS0E 1VACB 2OXGA 4GXVH 2YPLA 4JN1H 5GJTL 4Z77A 7A3HA 5I66B 1HKJA 3O2DH 5IB5A 2UWFA 3CMOL 4G9FD 4KVCL 2BOBA 3PJSB 4D8PA 1FHLA 5JUEH 1FORH 1U3JA 3DO3A 3BZ4A 1XYZA 2UY4A 3D3VB 3ZJ7A 1TCRA 1OQOA 5FA4A 4G9DA 1HHJB 4FLOA 2V7HA 2X4NA 5IEKB 2W4XA 3EYSH 2DM3A 5JUVA 4Y5YA 5KZCD 4LIQE 1IMHC 3IJSA 1HHKA 3O4LA 4FTVB 1S5HA 3SPVB 3UZEA 4OKVA 2BY2A 4HWBA 4IRSA 3NCFB 5KVDL 2RAMA 1P84K 4M1GL 1YY9C 4N0YL 4TVPL 4X98A 5B39G 5ECJE 3RVWC 5FF6A 3CJJA 4JQXA 3QFJB 2CKBL 2ILLA 4P2RB 2H3NB 3U46A 1YY9D 2GTWB 2IEPA 2ARJB 3MXVL 1NPUA 2FX9L 3CBWA 3RVWD 3CVHL 4PRHD 1ZSDA 3SE3A 5I79A 3WMBA 3PXJA 3QCVH 2DWEA 4Z78B 1WBZB 2CMRH 2J6EA 4B7LA 3L6FA 1JPTH 1UZ6E 4Y4FA 1LO0H 4JO3H 3C2SA 2HJFB 4X0NA 5HYJA 5DD6A 3U5UA 2AJVH 3TFKC 4YHNB 3UG3A 1IKFL 4KMTH 1C7TA 4KJQC 1YYLH 4NSKA 5FFLA 3VM7A 1J86A 5AYUL 4KI5E 3NFNA 2OM5A 4XP1H 5EC1A 3UTTA 3UBXG 3W2DH 1Q6GA 3TFKD 5D7KD 4KJQD 5IBUG 1UJ3B 4A3HA 4J4PC 4GKNB 2DKSA 2GITA 3QQ4A 2CDEA 2DBJA 3UTZB 1E0WA 4MD4A 4EDXA 1Q6EA 4F9PA 4JPKH 5SWSA 1EEYA 4H0GA 4J4PD 1UT9A 4OIIL 3SE8H 1OGAE 3F7PC 3BP6A 4ZYKA 1JHKL 2DWDA 2V2WB 3H9HA 2C5DC 4X6CE 1K8IA 3SDDC 2APVA 3SDXB 1EEQA 3L3GB 5A6AA 4LKXB 2N56A 2WVUA 5KVMC 5D2NE 2C8NA 1YEIL 5I3DA 5LAXA 3L5HA 4LPCA 3B9DA 3SDDD 5LYRA 1BBJA 4XP5L 3OXSA 3T0EC 1R5IA 4YDJB 4O00A 4U5KA 5DMIL 4NQVA 3UEQA 1IC4L 2PO6A 1UD5A 1RZKH 3PGDA 5ALBL 3AROA 5F88B 4ZTPL 3T0ED 5KN5B 5T3XE 4IM8A 3RX5A 5F3BA 2UYLB 1K9FA 3OZ9H 3IB4A 1MCQA 3AFBA 4LLDA 3OZPA 4ODBD 2ZICA 3QWOA 2XVGA 2Q76B 2IALB 5E8PA 1JD9A 1ZGLA 1WCBB 1FYTB 1BAFL 3KYNA 3UTPE 3PZQA 3S96A 3A0OA 3CLFH 1KIQA 1BREA 4P46A 3RRQA 1CLYH 1GC1H 1DUYB 2ZCKL 2OQJB 2HFEA 3WNOA 1ZOXA 3C5ZA 4OD1L 2J7FA 2MKWA 3D3VD 1ZHKB 1BQHG 5C0BA 2FX8H 3BQUA 3RZCA 1EFXA 2J74A 2Z0BA 5KZ6A 4XBGB 4ZNCD 1J0IA 4LSUH 1R5VB 1BGXH 5BV7H 5EO9A 3OB8A 1I3RA 1DBBL 4XVJL 5C0FB 3TCLB 1BX2A 1I1AA 3KHQA 3QCTL 2IQAB 4FTVD 5F96L 3UC0H 4BH7B 3CVHB 4M5ZH 1UM6L 5ILTL 2BNUA 1KJ2H 1AJ7H 1HHHA 4XCFH 3CZJA 3HZMA 1T0NA 3GIZH 2WIMA 3CUFA 2YK1H 4XXDA 3KPMB 4LAQL 3EOTH 3NABH 4P2RD 3SE4C 3RM9A 4X7DC 3W4RA 4UUJB 4IRJA 1JUFA 5IVXE 3BAJA 1ZANL 3IETB 1DZBA 3AMLA 4AH2A 2UY3A 1MJJA 1U8LB 4HF5L 5B3JF 1IEAB 1XGYL 4ATDA 3GJFH 4ODHL 3T2PA 4NQED 5HDQH 3TN0A 5JXEA 3KDMB 3BDYH 4ZENA 4MJ6A 3OSKA 4UQ9A 4I48B 1WCGA 3RTQA 1GIGL 4NC1E 3DETC 3J7HA 4U1IB 3ORJA 1OTTC 2OP4L 1W0VB 4D9RD 5IMOB 5E6IA 4L8SC 1UJ3C 3AREC 1KLUA 1U92A 3O41A 1VAHA 4IHOB 1E27B 4N0UA 3DETD 1GZPA 1HILA 2CUHA 1HSBA 4OM0L 1OTTD 2YRPA 1JTPA 1G7JB 3ARED 3C08L 1W0WB 4OZHF 1KLGA 1J1PH 5IG7A 3PV6A 1XGRA 4LQFH 2KBGA 3GSNA 4MPKA 3GK8H 5KOMC 2BSRA 4FP8H 3UBXA 1T0PB 2R0LL 4HIJA 4TRPL 4NP4H 1INQB 4Q9QL 1ISYA 1QI2A 2EYTB 2HT3D 4OF5A 1N59A 4X7SL 5LA2A 2JIXA 3MLUH 2AGJL 3WQWA 1UXWB 4CDHA 1RK1B 4HIEB 1LDSA 2E6QA 3RL1B 4WI4A 2C3VB 5CAYB 3VH8G 1UA3A 3ZDYF 4ALAH 3MNVB 1TZHA 2VXUH 2FGWL 5A94A 1Q0XH 5JHLL 3IXAA 5DUPL 3UTSA 1SJHA 3U7WL 4W81A 3QXDA 1S9VB 3AIWA 3MV8D 3AM8A 2RJMA 1CK0L 1EK3A 1KTDB 2ZUXA 4ODXB 4HWZA 4JZJB 5DK0A 1ZHLB 1IC5L 3MV7B 5K9JH 4G3YL 3V0VA 3B3IB 4XC1H 2AK4B 2ZJSL 1NSNH 4XGZA 4XAWH 1DWGM 1QLRA 2DQFB 2NY5H 3BAWA 1FYTD 3B2VL 1T7WA 4FXLA 1B90A 3MLRH 4HIHB 3C6SA 1A4JB 3OKOA 4JKKA 1GOKA 4BQ8A 5GSVA 4L4VA 1EEUA 4ZUVB 2WZIA 1MEXL 5HHME 4LHUG 3B9EA 2OI9B 4UNTA 3BO8B 5GGVY 2FZ3A 2NY2B 4UIMA 4TVPD 2GK1B 1MJ7L 3MRBB 4HKBB 1YMHA 3FZUC 3OAUH 5F7DA 4GKSB 2GDUA 4CVXA 1RUKH 2WV3A 4GQRA 2R0WL 3QI9B 5H2BB 3LKQB 2VLMD 3FZUD 2KZWA 3T0BA 4M6OL 1HEZB 2GSJA 1V5JA 3G5ZB 5DDHA 4EK7A 4E42B 2HKHL 2VB5A 2IANB 1IM9D 3IVKB 3HZKB 4PP2B 4K8RH 2K7PA 3CZLA 1LP9E 1GOMA 1IGYB 1SYSB 3UJJH 1DWAM 3GNOA 3VRJA 3QCUL 4TSBH 2UUDH 3GSRA 3FKUS 4YHMH 3L5WB 1KFWA 4K94H 5C0CE 5B3NA 3BUTA 5F97E 1ES0A 4D3CH 2JJTC 4HEPG 4EN3A 1MVUA 4N9OB 4S1QL 1LDPH 3FQNB 1ADQL 3DBXB 2XSAA 1Z3GL 1X5YA 5D1XA 4M5YL 3O11A 4XVTL 5I1HH 1ZGLP 5D6CA 3VFUA 2HVJB 2FB4H 5IK3A 1TJIH 4G8IB 1U8IB 1I3VA 2NTFA 1FSKC 4P9ML 1OB1A 2DSZA 4FZ8L 3NCMA 3MMDA 1GHFH 1YA5A 4RDQG 2YBRB 5ISZB 1QP1A 2X4RA 1A0QH 2NPLX 4A6YL 5EOCL 2IWGA 2ZP0T 4MA7H 5GRUL 4DWSA 5L0QB 3HI1A 4UTBL 4AEHL 3CFJB 1LL6A 1OD8A 5BW7A 2Q8AL 3MKKA 3ZDZE 1G7MA 4HKXA 2HFGL 3N85L 1ZS8A 4JHOA 3PHQA 4DTGL 1MHEA 5CGTA 3RWIB 4GI8A 5ACMA 3S36L 4F66A 2H32H 4L8DB 1F45A 1DQTA 1AXTH 4DUXA 1NMAL 2XFRA 3W11C 2VSDA 2E9MA 5MEQA 2XT1B 5C71A 2WSPA 1AQKL 4Q7DA 4U6YA 1K9EA 3VKKA 4MXWH 5IDIA 1FBIH 4OUUA 3W11D 3WXWL 3AHTA 4KTDL 1W9BM 4NKIL 3KXFA 4IRZL 3ARGD 3W9DB 4QXUH 4G43A 4P2OB 3HB3C 4RL3A 1D6EB 2EYSA 4JZJC 1UWIA 5CSYA 4R8WL 1SYVA 4GG6A 2CK0L 4L9LB 3SDAB 1TMQA 4P7LA 5BYWA 3BE1L 3TVMC 2WPGA 4OZIA 4F8QA 6FABL 1W8NA 2KKQA 3TWCL 4ESKA 4BKLA 4TYUA 3MRJA 4ZUSB 1RZJL 2ORBL 4PJXE 4L1DA 2VKXA 4WJXA 5FYJE 3LY6A 3P4NB 2VLJD 3TVMD 4QCEA 3PDGA 5HHVH 4OF6A 4XPFL 1U8PA 1LD9B 4NQUA 4F33A 3DGGB 1CT8A 2OI9C 3S88L 4QHMB 2Y23A 2NY2C 5I24A 2WINA 2F58L 4IIQB 3CFDA 1JGEB 2IGFL 2LV4A 2DSKA 1ODUA 3O6ML 2A6DA 5JIWA 1RUAL 2CRZA 1ZLVK 5DHVB 5E8NB 1TQCC 2X4QA 2NY2D 2MOVA 5CD3A 4D9LH 3AS2A 2EDXA 2V3FA 3QI9C 2GIYA 4LCYA 1T03H 3C60A 1NAKH 4WW2A 2NZIA 4PV8A 5EA0L 1X44A 1NCBL 4YHPA 1RUML 5L8LB 4GSDH 1C12A 5D71L 4AENA 1NCWH 4LHUA 1TUXA 4GZJA 2DQHH 2ATKA 3ZO0A 5FYKU 1FFOB 3M6DA 1FN4B 2IAND 1YQVH 5I9QB 1HT6A 1EOMA 2D7MA 5DTFA 3TV3H 1FVDB 3GMOA 3WCYA 2ARWA 3LVEA 4QXGL 3N18A 2Z93B 1NQBA 1CN4A 4DGIL 2P5WB 1JE6A 3M7SA 3QIUB 3VGDA 5I1AB 1OD9A 4NRRA 4QP0A 3U7AA 1Y6MR 1KXTA 3O2DA 1I75A 1OQXA 5FV2A 2XA8L 2EKSB 3FN0L 3SQOH 1U8MA 4QHKJ 2XM2A 1Y6KR 4XPTL 1DQDL 3GMMB 3W53A 3JVGC 1KBGL 2AJYH 3ARBB 3ECQA 4NKOA 2EXOA 2VLRB 3DUSA 2G3MA 1PY9A 4UQCA 3CK0H 1IILE 3GMRA 4WI7A 3L3OB 5L0QC 4GKLA 3B4NA 3AI0A 2VDQL 4RA0C 2CERA 3QQ3A 4XHJC 4R96B 5ISZD 2Z8VC 4QOKE 1H3WM 4MVBC 3E8UL 5ERWA 4K68A 5JBDA 4HG4K 2V17L 4XHJD 2VQUA 2OMBA 4OT1H 1XT5A 2GW5A 5GJSL 1E6JL 2D7PA 1N82A 1DR9A 4OCRH 2NY6B 3D9AL 3QUYB 3KPPB 3W6LA 1BLNA 5DRWA 1T2XA 4MNGA 1AR1C 1HJXA 5DGRA 3WHXA 3BFOA 4ZSOA 3GSXA 2Z92A 3KVQA 3QXAB 2BVPB 3JV4B 4OZHB 1KCKA 1DBJL 3WMSA 1AGBB 1AR1D 1BAGA 4P2OC 3MGTB 3LOWA 3BIBX 5AYIA 4Q6IA 3V6FB 1XF4A 3ROLB 5IB3A 2DLIA 1PKQE 4UQBA 4M1DH 3X14A 1WPCA 2K7QA 1UCBH 3N17A 1DQQB 2H41A 5DZOA 3DRQB 4EUPH 5FKAA 4CBPA 1J05A 3VXUB 1H9VA 3VFNB 2EDYA 1G7QA 3EYPA 2WBJC 4IIQC 1OAKH 4IMKC 2ZUTA 5IW6B 3ARUA 1I8IA 2AEIT 3TYGL 1KULA 1XCWA 5ACZA 2Q87A 5IESL 4CVZB 1FZOA 2WBJD 3FAXA 2PW2A 3WJLA 2FHCA 3VW3H 2RQ8A 4EBQL 1FA2A 2XQYK 1QKZH 1INEH 5ETUA 5EN2A 4MZ2A 3TLRA 4ZAKD 4HK0B 4UINH 1NGXA 4I2XA 5GGTA 5DJ8B 1WBXB 1RV6X 3CMJA 2CIIB 5ESAA 2YMXH 2J4WL 5HGBA 1KR0A 3U7BA 3RAJH 5KVEH 4H0HB 4NHCH 3DXAE 5DFTA 5I9QC 1PFCA 1WDRA 1HHIA 4PJ9A 8FABB 4J12A 3EDEA 2VDMH 4EAMA 4J1UB 2WW8A 5E6YA 1LG1A 4YC2B 3OMZA 4LCCB 2ICEA 1NCCL 4KQ4H 3BAKA 4PY7A 3WUWB 1CICD 4L3AA 2VL4A 4GRMB 3X3GL 3FFCA 5GSRB 3VD9A 4ZO9A 2EDDA 3HNVL 2R9HC 5E4EB 2FIKB 4EVNB 5K33A 4NUJA 4D6EA 1ZLSH 3WYRA 1HDMB 2J7CA 2ATPB 2Z8RA 2NMSA 3IU3B 2V9RA 3QO0A 4TOYH 4EI6A 1NUFA 2YSSB 4FA8A 5T33L 4JFSA 2EDQA 4LSRH 3GBMH 1VADB 5E5MA 4MDIA 2BC4B 4U1KA 4YO0A 7FABL 3NZHH 3RU8H 3RNKA 3IDJA 4OLZL 1YN6A 1JWSB 4QNPF 3DPBA 3LQZA 4LRNH 2YRLA 4GIAA 3B2UC 1QNOA 2AJZA 2UZIH 3CDGA 3BVNA 5DHYA 4M7LT 5FKPA 2P7TB 3GKWL 3HUJA 3SGEI 1EZVX 3B2UD 2W92A 5ICYB 2WHJA 5HYFA 5ABHA 3P2TA 1IAOB 3IF1A 1TZGH 2NY6C 1D5MA 3QUYC 1D5XA 3LIZL 4Y8AA 5MENA 3X13A 3STBA 4XNYL 4GFTB 1WK0A 3C8DA 2PXYB 5IQ9B 1NOFA 1LK3H 3MRQA 3QUYD 3WFHB 4QRSB 3KJ6H 1U8NB 3RDTB 4U6VH 1J7VR 3U4BH 1TIUA 2QQNH 2GJXA 2V7NA 3GJFA 1B4JL 4Y2OA 4NQDB 2DQUH 3GDBA 1RZJC 3O6FD 3GXIA 1HWGB 4HC1L 2EDRA 4CNIA 5BXTA 3WS3B 1J01A 4CU6A 2VXSL 4MLIA 1UG6A 5EIIA 1EVTC 4XZUB 3QIBA 4UIKH 3MRMB 3FOLB 3NIDE 4JQIH 2DQDL 3FN9A 3FY1A 4YDVA 2HVMA 3TNMB 4M4RA 1A6AB 5C9JB 3E6HA 2PWGA 1KYOK 3W29A 4AD2A 1WIPA 3LS5H 2FX7H 4ETQA 3GXFA 3KZSA 2X4SA 4UAOB 3KL3A 1SEBB 2R0KL 3IRPX 3STLB 3OV6A 4UU9B 1TFVA 3EDFA 5FGBC 2JALA 3BPNB 4GZIA 1UB6B 3ARFD 1EO8H 2BNQE 1TVBA 1QQDB 3M1BA 5EU6B 5GJTH 4P23A 5AG8A 4HFUL 2VXQL 3ZZ1A 4GXUN 2ZOXA 3NSMA 1KIUA 3CMOH 1F02I 1GQIA 4KVCH 3W0WE 5JIIA 4XX6A 3QR2A 1IGTA 1MXGA 3SCUA 1QD0A 5KS9E 1V6VA 2B8OT 3L9RA 1CU4L 4WI6A 1KGUA 4U1JA 2HT2C 5C70A 2P8MB 3OJVC 3BT2L 2P5EA 4GQQA 1D5ZB 4KQ3L 3RBGA 1H49A 4OOUA 2F19H 4JGMA 1XR9A 4LEOB 3GEWB 2WUBL 2FEDC 3SGEH 3GH4A 2HT2D 1PEZA 4YC2C 3CHCA 4YQXL 3MROB 5EZOH 1YEEH 4UQDA 3ZT7A 3E6FB 4IDLA 2AXGB 4DUWA 1MFDL 5BMFH 4M9PA 4HV8B 2G3IA 2AV7B 3GI8H 2FEDD 4HGWB 4OIFA 3FONB 2XWTA 5A2IH 2A9MH 2FECL 4NBZB 5F9OH 3DVFA 4M1GH 4N0YH 4ZXLA 5JIPA 4MJ2A 4I5BB 2B4CC 3CX5K 4XMKL 2A9NL 3T4AB 4XMLL 1IGFL 1X5XA 2CKBH 3VG0L 3MV9A 3LRSA 3GMQA 1SMAA 3FQXB 4TVSa 2UWEA 4XNXH 1PG7W 3ULVH 2FX9H 3MXVH 4LVOC 1TA3A 4JIEA 3DV6B 2BVEA 1WZKA 3HC4H 3HMXL 3DUUB 4IOIA 3Q3GB 4AJ0A 4OFYA 2H8PA 1E55A 4HH9A 2CPUA 2HG5B 1S9WB 5J11B 5D8JH 3IKCA 1RIUL 3QUZB 1XMWA 4W6YB 3MJGX 3SDCD 1GPOH 3WJJC 1XV8A 4Z2KA 1DN0B 3RHWF 1BJMA 5IV2B 3TBYB 4MJ5B 4P5MA 4U49A 1IAIM 4LPXA 4KGJA 5FA3A 2NY7L 2Q20A 4S2SB 3JWDL 3WMCA 3MLTA 4NUGL 1GGUA 4JFDE 2VX7A 5JQ6H 5C08E 1JV5A 3SEPA 4LPTA 2BSTB 3K4DA 4ZD3L 1D5BB 2PYEE 4YBLC 2MCPL 3RDTC 4P3CH 1MHCA 2YIHA 4OIIH 1JZ2A 8CGTA 4P3DB 3WFCL 4XBEL 5IJKC 3ARQA 3OXRA 3RDTD 1KN2L 1IQDA 3HN3A 5GZOC 4NWUH 5IMMB 3VFVA 4D94A 4IISA 1C08B 5FL0A 3EMQA 3UPRA 2C9AA 3VDBA 4NQDD 3V4PH 1JNJA 3RCNA 1BD2A 3TA9A 2ZUQB 3N9GL 5GZOD 4I8DA 4X6EB 4FMVA 4X6DE 1YEIH 4FFVC 1Z0MA 4UBDD 3FB7A 3WQ4A 4GQ9H 4FHBD 3WD5H 3MR9A 4XP5H 1SMOA 2RCSL 4NRZA 5I76B 4H88L 4H26A 3CPUA 3TBTB 2WYSA 2BJML 3OKDA 3BSGA 4UAOC 4HUXA 4H04A 2P46B 1IGCH 3KPQB 4NM8H 3VILA 2Y5EA 5HYSG 5ANMA 4R7DA 4U2YA 3TO2A 4X9FA 2GY5A 4HCRL 1C16B 1UKQA 4A2LA 3GBNL 5B8CB 5IQ7H 3ZE0E 1BAFH 5EU6D 1BFVL 1UA7A 4OCXH 5C0AE 1UD4A 4OOZA 5CPQA 2IG2L 4P2QA 3M17B 4YFLF 4DZ8A 4ZFMA 3RIKA 2GKIA 1F00I 1ROWA 4IS6A 2H32A 3JXAA 3ZE1E 2E9BA 3M46A 2ZCKH 3MQIA 3CPLB 1ISZA 1YEKH 4BJLA 1MJ8L 2FR4B 3UCRA 3VGEA 4XZWA 2OXHA 2PI6A 4ZFOA 3T2OA 2D3LA 1LQ0A 3PNWB 1TJGH 1TVHB 5DC9B 2XI9A 3EDDA 3HNTL 2D4DA 3FTGA 1RHHB 1QVBA 4EUPG 5K9OA 2GT9B 1LMKA 3LEVL 3QCTH 1FJ1B 2R2EB 3PGCB 3UCQA 5CILL 4ACZA 3HRPA 3RL2A 1UZ8A 1V6YA 1FNFA 1JGLH 2VDKL 1UWQA 4PMXA 4PJIF 5C0NC 1W1VA 1HI6B 4U6HA 1IAIL 4MAYB 2VITB 5F7EL 1ED3A 4Y0GA 3QDJE 5C0ND 5I71B 1A7QL 3H9YA 5J11C 5IFJB 4OGXL 4OLWL 3S34H 5LGJB 1TZIB 3DVGA 3QUZC 4BFIA 1VBUA 3AMGA 1LO5A 1V3IA 1XGYH 4ODHH 4G6FB 4AD4A 3RVUC 4JRYA 1MCOL 1CG9B 3MLZH 4JVPA 2VRQA 5CSUA 4MNQB 1LGVA 3AS3A 1LK2B 3QH3A 4FFZL 1DQJA 2Y25A 3MFFA 2CIKB 5EOTA 3QHOA 1I1RA 3RVUD 3EJYD 4TPRL 2DH2A 4ZUTB 2OP4H 1NGWB 4D0CB 4JFXB 3PWJA 5T1KB 4JO1H 1UHVA 5E2JA 5BO1H 3L7FA 4G9FA 4UDUA 2DM4A 4M7JL 5EUOE 1A6ZB 3C08H 1G7HB 4G8GE 4GMSL 5GGUA 3L5JA 4HUMB 4F80A 1KNOB 5A8MA 4F9LC 5CEXA 5ECUA 5A2FA 4WHYH 4NQSB 7TAAA 2N7BA 1T5XA 3H6JA 1FG9C 1KQZA 4QLLA 4TRPH 4OCWH 5DJZA 3GHBH 3PIQB 2ZUQC 5CZVL 4JLRA 2Z4QA 2J47A 3UAJC 3LHPL 5DSCB 4P57B 4X7SH 1ECEA 3LV3A 4YJZL 5H35A 2AGJH 1S7WA 1XF5A 4JDZB 4P99A 3HAEB 4WKFA 2UY6A 5D5ME 4XUYA 1L0PA 2YUWA 1Q9KB 2GK2A 12E8L 2QR0B 3AXLB 4MD5B 2FGWH 1QSFE 4H8HA 2JK5A 2ZG3A 5D70H 1IFHH 4PRHA 5DUPH 3WDPP 4PB9L 3U7WH 3D39E 1WITA 3VXOA 1W72A 2ICWI 3U0PA 2Y7QB 5B8CC 4LK4A 2CR3A 4PRBA 1IC5H 4FMKA 1NEZA 4G3YH 5J3HC 1TTUA 3RWEA 1E4IA 1OGGA 2EDEA 2OR9L 4Z6AT 5HI5C 5CSBA 1J0ZA 1ZEAH 2F54E 1CXIA 3Q5YA 3L5XL 5J3HD 5DF0A 5JPNA 3FQRB 2B1AH 5DA0B 5HYSA 3C09B 2WAHA 4ISVA 4LU5L 3LH2L 1ETZB 1NBVH 1E0OB 2UUDK 5GGSY 3P0VL 5C1MB 2XKNB 2HTLD 3LAFA 1ZHNB 1CE6B 3SKOA 2W0KA 4PJCF 3TEUA 4J4PA 1YJDH 2VCCA 4W7UA 2YUVA 1V0LA 3KL0A 2Y24A 3L3IA 5C9KA 3BGFC 1EGJL 2MHAB 4RFOH 4JO2L 2VLKD 1F11A 3ZMRA 2GUOB 2VABA 4M6OH 4Z8FH 4P7OA 3STZB 4FQQB 3LN4B 4PBVC 2VZ3A 4J23A 1JCKA 1XSJA 2JF6A 3HRZA 4LSDA 4JFPB 5I71C 1QVOA 2CJUL 2VAAB 4ZOCA 3SDDA 5L8JB 2ZOKB 4EUPA 5GGSA 3WLBB 2Z1SA 1LO3H 4Q6YA 3WDQA 5A2JH 1WIOA 1G9MH 3RWHA 5KSVA 3CFKB 4PJAA 3TIDA 3P11H 4NKDB 2P1YA 3QCUH 3VFRA 3T0EA 3I3BA 4NZJA 4G6FD 3H0TB 4WFFE 2F15A 4YBQC 5IB1A 3FMGH 4JZNB 4O51B 3DECA 4GLRH 4PGCB 4YUEH 5DJXA 1A2YA 3G9VA 4KAQH 4MNQD 5FO7A 5DZLA 3FOMB 5EWIH 1SYTA 5ABFA 3OLGA 5HYQA 1Z9MA 5FUCE 1OWQA 1JVKA 2B0SH 3EJJX 4S1QH 4E8DA 2P24A 1ADQH 3HPJA 3QULB 4L3CB 4ZOAA 3SY0B 5T1KD 1AHWB 3QUKB 4XVTH 3OLIA 2AABH 5EBLB 5I66A 1MHPL 3S3JA 1YDPA 2FO1A 3PJSA 1HVXA 43CAA 1TMCB 4P9MH 4PBWD 3IDNB 4FZ8H 1JIBA 3L1OL 2VDOH 3DO7A 2XY2A 1VGEL 3Q5OA 4A6YH 1A9BB 2V3EA 2P43B 2NY3B 4KZDH 3KJ4B 5GRUH 4B50A 4AEHH 3MRFB 3LPFA 3B5TA 4ERSL 2EE3A 2ZX6A 4G7YH 3CFCL 2Q8AH 1UWEL 5A2BA 2HFGH 3N85H 4KKLC 4G6AC 4PY8I 5E2TL 1U3HD 1OLLA 3FB8A 4DTGH 2VR4A 1IV8A 4Y4HB 1MFBH 4MCZB 4U1NA 4FN0A 3SPVA 1XGZA 1GGBL 4LQ1A 3DV4A 4HPYL 4FABL 4Y19B 3DOSA 3PWLB 1V3KA 1AQKH 4PB0L 4P2RA 2FATL 4AIZA 3WXWH 4NKIH 1H8SA 1JFQH 4IRZH 3V0WL 1PQZA 2AK1L 3VXMB 3ZKNC 3T4YA 5E0FA 3IJHB 4PJHA 4GOSA 5MEPB 2BNQB 4R8WH 3L4YA 4HXAL 5DD0H 2ZWZA 4HFWB 4NQEA 2CK0H 3QNXB 1Q8MA 3F4VA 3VXNB 4TX8A 3BAEH 5DVLA 1TJHL 3BE1H 3ZKND 3VIPA 1EXPA 3TWCH 4DVBA 2X5PA 4KRMB 2PKDA 1ULVA 5T1LB 2ORBH 3GB7B 5EU7E 4YHNA 5FOOA 4F7EB 5CBAA 1NMCB 2I9LB 3C09C 1CD8A 3OJDB 2A73A 4XP9L 4CN1A 2OX5A 3KPSA 4KH2A 2ICES 3S88H 3WNPA 2F58H 1VCAA 3QZWB 2WCAA 4L8SA 3AREA 4ZUUA 5A6JA 2H6PB 1K2DA 4XP4L 3OKKB 1RUAH 3HA0A 4FXGB 1R86A 4AZBA 3IT8D 5AG9A 5ID1B 1SEQH 5EC2B 4RE2A 4UTFA 1QI5A 3MUGB 4PG9B 1ISVA 1N5AB 5I15L 5C3TA 3IKKA 3PZGA 3KGRA 1CDGA 4RAVB 1NCBH 4H0IA 4N8CL 4XXCA 3BZDA 4AMCA 5D71H 1BZ7A 2HN7A 2WBGA 4WIWA 1OM3H 4WO4D 5HY9A 1YPZA 4LKXA 1BOYA 4FQ1L 4I4WB 1XCQB 2M26A 5C0JB 5LXGL 3T0WA 5DMKA 1AQ0A 1NCDL 4W70A 4HBCL 1P2CB 1M05A 1U6AH 1RMFL 1A6TB 5GRZA 4L4JA 1IAKA 4DGIH 4R7NB 3QHNA 1FL3A 2CETA 4NM4H 5KN5A 5I8KH 1VSCA 4UDTB 3W24A 2XA8H 3MV8A 3KPOA 3EOBA 2XG4A 1J0HA 4Y1AE 2OR8A 1W0YT 1AHWC 4MCYA 5IMKB 5TE4L 4XPTH 3NDZA 4CJ0A 1WCBA 2VZTA 3F5JA 3IDXH 1FYTA 5CZXC 4GO9A 5JHDB 1WB0A 1Q38A 3JV6B 3VE0B 4U7KA 1WNOA 4PGBB 3T3ME 3KJ4C 5CZXD 1MQKH 1AXSA 4PRID 1ZHKA 1FIGL 4F58H 5CJOL 2PB1A 1M6OA 2J7HA 1SJVA 5GRXG 3IDIB 1O7AA 2YPLE 2EDKA 2CKBA 3OG2A 4JR9H 5EO0B 2CLRA 4WY7L 2YN3A 1UM4L 4YHKL 3UEZA 3VI4F 1N64L 4CGTA 3G6JA 4BH7A 3CVHA 5I73B 2CESA 2C4FT 1I7UB 5EOQL 4Y4KB 1AY1L 3V6ZA 1R3KB 3ARXA 4GAYA 5M5DA 5C09E 1XIWC 1IM9A 3S5LB 4QRQB 1DBJH 4NQTA 1H3GA 3VXSB 2X1WL 4C54A 4ELMF 4PGDA 3L3KA 5IHBA 4XPHH 4OF7A 1XIWD 3IETA 4ZPVB 5JO5A 3VINA 3O4LE 1U8LA 4QRPB 1R24B 4UV4H 4WHYG 1LEIA 3SE9H 2WZPD 2HH0L 1INDL 4YN5A 4OUOA 1NMCC 1KG0A 5F72S 1NBYB 3I6GB 3RVTC 5T1LD 3BPCB 3VXRD 3VXTA 5I2IB 3SUSA 5CPSA 2CO7B 5JW4M 4EE9A 1EH9A 1AQDB 1G6RL 2JJTA 3QSKB 4PR5B 3TYGH 1UWGL 1BGGA 2J88L 5IESH 5GRVK 5JW4Q 1UKTA 4QF1B 1G7JA 1L0QA 1JGDA 4EBQH 1VFAB 1S9XB 2DICA 2VSCA 4U0RB 3H9SD 2C26A 5HYJE 2FJGB 3AU1B 1ZVYA 3IYLW 1NMBL 4JN2B 3VMNA 3CHEA 3LN5B 4HZ8A 3UTTE 4AG4L 1QPKA 2EEDA 2J4WH 2E6PA 1BSIA 4GW5B 1W2PA 2EYTA 3QDJB 4LFHG 1CLCA 1F4WH 1NFDF 3WIFB 1F3RB 2FBOJ 3TH2T 3EYOA 4K3GA 2W62A 5SWSE 3R1GL 5J1TC 3RL1A 2GJPA 1NCCH 2WCGA 1IGJA 3MNVA 5T5FL 3MUZ1 1GXEA 4PJCB 1OF2B 6CGTA 3HNVH 3ARGA 4MXQC 2VRJA 4W87A 5CG0A 4C55A 2PN5A 4JL1A 2FRGP 3V5HB 3FJTA 2XRAL 2EH7L 3PABB 1L7IL 5EBMA 1Q72L 2CKSA 4MXQD 5T33H 3QO1A 2G5RA 4QXTA 5D7IF 3ROOA 3N1AA 1ZHLA 2PTTA 4QHNB 4OLEA 2EIDA 5HHXL 3B3IA 4B0MM 1N3NB 1HJQA 4K3DH 1DFBL 3DURA 3QEQB 3AIQA 4OLZH 2VLJA 3TVMA 5IVXF 1KB9J 1SJEB 5JHDD 4GRWF 4HIHA 1YUHB 3LKRB 5EZLB 4PRAA 5HGHB 1AGEB 4JRXE 4OJYA 2I9TB 3WKZA 3TNNB 2EXYD 2DLGA 2A6KA 3WL9A 4D0DB 4NQCB 3MO4A 5C8BB 4ZXOA 2GK1A 5H94A 4HKBA 4UV7H 5I1GH 2RIKA 3BRFA 3VO0A 4Y4KC 3NJ3A 4PJ5D 1VEOA 4LIQL 3B6SB 4RGNB 3TJEL 3JUZA 4ZDHB 4YWGH 1WWAX 1A8JH 2B2XH 3I75B 4JFFD 5DVKA 4MZ3A 1T20B 4HDIB 3JTTB 4XBPA 1M7IB 3CUPB 4TVCA 2IANA 2E9WA 3IVKA 4HC1H 2YOCA 4PP2A 3VXSD 5F3HB 1TVNA 3BD5A 4JB9L 4HPHA 2W9EL 1MLCB 2VXSH 1IGYA 1YNLL 3ZKQD 5KSBA 5HPMB 1DEEB 3FT3B 2CHOA 2PBGA 3RPKA 2DQDH 4QLRA 3JV0A 4YDKL 1ZT4A 3MYJB 1NUDA 5T1DL 3RVXC 1WAAF 3QHMA 1PX4A 1H15A 1YYMH 4PLKC 2RR3A 3VXPB 3BEVB 4KJYB 3VM5A 2A77H 4LEXL 3FQNA 3ZM8A 5A2AA 5I1LB 2D7TL 5DK2A 3HE6B 4PLKD 1ISWA 1WE5A 4U0RC 2HVJA 3EHBD 4BSWB 3FB5B 4G8IA 4FNLL 3R0NA 3GSUB 1A7NL 4DOHE 4QYOA 3T3PE 4FQCL 1KPVB 2Q3ZA 3OHXB 1TTFA 2BCKA 4QHLA 4UT9H 1CU4H 4P8XA 3SOBL 2NX5E 3PL6B 1ZLUH 4HUUB 1T04B 3MOBL 4D6FA 4YZFE 2FEEL 4H8WC 3AUVA 1DQML 2LU4A 3NGBB 5TQ0H 1YNKL 2QQLH 4HD9A 3WE6A 5DURB 4PTVA 3U7VA 2H9GB 4HZ7A 1B6DA 5KVFL 2JE8A 3FT4A 1MFDH 1QRNE 1VFBB 4WTWA 4AZIA 4U1LB 1H3PL 5K9QG 4X8JB 2WHMA 2E6JA 2FIRT 3NCYP 1NLBH 3DYPA 3EYFB 1J8KA 3BRGC 1N8ZB 1A22B 4XMKH 2A9NH 1G6VK 1IGFH 4QFUA 4XCNB 3VG0H 2B7DT 5CS7A 1MI5B 2IBZY 3W9DA 1D6EA 1AO7B 5TGBA 5A69A 4K7PX 3ZTJH 3HMXH 3KAAA 4D72A 1Q6FA 3BP5B 2XWBA 3AS1A 1T1YB 2P47B 3BD3A 3DHMA 1RIUH 3QXVA 1EDQA 3VFWA 1D9KB 4ZNEA 1SBBA 5ADOL 1FH7A 1ZJAA 3M07A 3QEQD 2Y36L 3P4NA 4GRLA 4FFWD 5D93C 5FHAH 5IF0B 2DQEL 4YPGB 3QAZB 5EBWB 2DOCA 2WBJA 4X9BA 1QO3B 2NY7H 3O6KH 4IMKA 1JGEA 3JWDH 2Q3AA 3QPQC 4NUGH 1FL6B 3V6OA 1YECL 1I3UA 3DTXB 4D9QE 1OPGL 5E8NA 2QPSA 4ZAKA 1UC6A 4M3JA 4ZD3H 4RGNC 3MRCB 3QPQD 5DQ9A 1MPAH 5AYBA 2GAZB 3U7YL 5GRJL 5ICZB 1OTSD 3U57A 1JWUB 1A7OH 1JYNA 4RGND 5JQHC 1GGCL 1NOUA 1BQUA 2O5XH 4L4VE 2DN7A 1J18A 1RU9L 3NFPA 3GHEH 1QHZA 1FFOA 2R23B 4M48L 3N9GH 2WMJA 2XSBA 1V7NL 4L8CB 1BOGB 2MQ0A 4HIIB 4L29A 1GHSA 2AEQL 1PEWA 1CICA 1FVDA 2ZUUA 3WN5A 1YC7A 2YC1B 2GJZA 4X4YB 4D6GA 3IJYA 4M00A 1QFPA 5CJBA 3WD2A 1ADQA 1FOBA 1I8KB 3U36A 4HK3N 4H88H 1X5AA 3O45B 2VDLL 5EB8A 1E0VA 3VMOA 2JB6B 5E7FA 2BJMH 5IW1A 2FYYA 1A7PH 3P0YL 2EKSA 5I1JH 2W0FB 3J8F7 3M8OH 4JHBA 2G75A 3D85B 4JJ5B 4G6KH 4A6YA 4HA1A 4LLQB 4ELMB 5E99L 3HFML 1N26A 4PPTA 1KIPA 2PCPA 4NRXB 4Q74A 5DJCA 1BFVH 5LWYH 1RZ8B 4MXVF 3KPNA 1JNLL 3VFGL 3L7EA 3PL6C 4XP6H 4WTXA 5CGYC 3V8CA 4LOUC 4QEGA 3CCHB 3NGBC 4I18B 5IR1B 2F74B 1XEDA 3MLWL 5CGYD 4LOUD 4OIBA 5DRXA 1Z5LA 5CINH 3QUYA 5EU5A 2VC2L 5DURD 4CKVX 1X4XA 5GS0C 2C4FU 3LEVH 4TUFA 2H2PC 5FHBL 3GSVB 1JI2A 2OK0H 5BVJA 2ZX9A 3ZYZA 4AEEA 4CU7A 3ZJ8A 4YXHH 3O6FA 1V6UA 2BVPA 1FNEA 3JV4A 2R2CA 3MXWL 4OZHA 4ZXBB 2H2PD 3IXTA 4RGMC 1FVCB 2OL3B 5BCAA 1IAIH 5LJYH 3U6RB 4NO2B 1MI5D 4OZFH 3V6FA 1PZ5B 1KXQA 2P8LB 5I18H 3ROLA 5BS0D 3PDOB 1A7QH 4PG2A 4OLWH 1MLBA 5C0DA 3DI3B 4OAWB 5BRQA 2WB5A 1HKLH 4U1HA 2W9LA 5C6WH 2HA1A 3O3AA 2UVEA 1NFDB 4NQXB 4GZEA 5GXBB 4YGAB 1AC6A 2BVQB 1EMTL 3JWNC 1ZLWH 1J0KA 3DRQA 1CFQB 4OF8A 3P73B 4FFZH 1N6UA 1VGKA 3AIBA 3A4XA 4CU8A 3ARWA 2Q8XA 1OD7A 3ARFA 4XRCB 5C8JB 4Z77B 4GG6E 4CVZA 3G6DL 3LKNA 4TN9A 2DIBA 5F44A 3FRUB 4UQ3B 4OCYH 5F7NC 2BOBB 4D8PB 5IFHH 4OZIE 2OSYA 3U0TA 1F3DH 4EEEA 2DEPA 1QYGH 4E2OA 3HI6L 3P30H 1R0AL 1I1WA 1WBXA 4XV0A 5D7IB 5FA4B 4RX4D 4X5LA 3U83A 1A5FL 3S4SG 2X4NB 1H3TA 1T2JA 4MD0A 4Y5YB 1UKSA 3NMEA 3F7YB 1EGZA 1HHKB 3ZDXE 1I9JL 1AP2A 1S5HB 4OKVB 4AT6A 3VTRA 3U2SA 4IRSB 3QDGE 1NFKA 1FDLL 1DL7L 1GCFA 4X98B 4QCIA 3PUCA 5L2JA 4YHIA 1MREH 5FF6B 4GRMA 3VWJA 4ZFFB 4FLRA 1KWGA 1MW3A 3BKML 3O8XD 3U46B 4M8UA 12E8H 1AQHA 1EA9C 5T5NG 1F2XK 4EVNA 3TBSA 1J8HE 1PBGA 4ODUA 2VL5A 1ZSDB 2C4XA 4JRWA 3QJFA 4HS8H 4HMCA 2AQ2A 3IU3A 2DWEB 3KHOA 1ZT7B 2AJSH 4E0RA 1HKFA 4S3JA 4TXEA 4NO5B 1VADA 3EDKA 2X4TA 4J3UA 1BYAA 3SDCA 1MIML 5DD6B 2A3AA 2NW3A 4JHWH 4MX7A 5E94B 1JWSA 1S78C 1OGAD 3GSOA 3O2WL 3QRGH 4F7TB 3PZNA 4NSKB 1XSKA 4X4XA 1NCAH 3LMYA 1EERB 3L5XH 5EC1B 3WJJA 3UTTB 1Q9WA 2VI0A 5E8OA 4I18C 2WP3T 4M7ZB 4M24A 3UG5A 1S78D 3UR8A 4J8RA 4WFGD 4HKZA 5A6MA 3LZFL 2GITB 1C1EL 3QQ4B 2CDEB 3LH2H 4YAQA 2GFTA 3N9KA 2R69L 4MD4B 4EDXB 4KV5F 5D9MA 5J9PA 2RGSA 2YKLL 2NZ9D 1IGML 1O0VA 1BG9A 1EEYB 4JKMA 3W9EB 1B30A 3O0RH 4HEME 4KRLB 2D9CA 4ZYKB 3BP6B 2DWDB 1C8PA 4G80B 2VE6A 3H9HB 1F90L 4JO2H 2VMFA 4NQDA 3UETA 3ECBB 2YDSA 5CLWA 3MODH 1UWUA 5FKYA 5HBBA 5LAXB 1G0XA 2CJUH 1JHTB 3RPMA 5LKNA 1BBJB 3PWNA 3OXSB 4W4OA 1R5IB 4N0FA 4IM4A 1XCTA 4KKAC 3BPOB 2A74A 4MNGE 2DTML 4XZUA 3QHZL 3MRMA 1GJWA 2PO6B 3W5MA 3PGDB 4ZSOE 3AGVA 4LSVL 2D2OA 1JXJA 5F3BB 2P8PA 5MI0B 1FO0L 3WQ8A 1KB5L 1QFWI 4LLDB 4Q22A 1CBVL 1I9IL 4WW2F 2Y5TA 1U95A 1CVRA 5JOPD 5FYJL 2QQKL 3QWOB 2NY0C 1SEBA 5E8PB 2CLZB 1HVQA 2CGRL 3KYNB 3S96B 5EU6A 2NY0D 1KIQB 1PDKA 2ZOLA 4MQTB 3C5ZB 2RB8A 4OCLC 3L1OH 4KHTH 3WF0A 5C0BB 3WDRA 2DQXA 3BQUB 1LO4H 3RZCB 1SM3L 1EFXB 3ZTJG 4GKZA 3NA9L 1D5ZA 1G7LA 5DJ6B 2WVVB 1WFTA 5KTEL 2WWMC 3CFCH 4IRSC 5FK9B 1I3RB 1QNRA 1KOAA 4U5IA 3NH7L 1BX2B 1I1AB 4V1DE 1A6UH 2GI7A 1JPST 4HV8A 2AV7A 5BJTA 1UYWL 2WWMD 4JQXC 4S1SH 3AXXA 3FONA 1GGBH 4LCWB 3GMPA 4X8XA 1EEZA 4FABH 1V3MA 4EKJA 1HHHB 2DSWA 3MRPA 3HZMB 2XFFA 3GIVA 4OLUH 3T4AA 2D31B 4PB0H 3SE3C 1GQJA 4R27A 4WKHA 2FATH 3VI3E 4IRJB 1JUFB 3CC5B 3SCWA 5LG1A 4AH2B 2BP3A 1HL8A 3V0WH 4DQOL 4ONHB 2HMID 2AK1H 3U0WL 4MMZC 3VD3A 4C4KO 4EQ2A 3Q3GA 4W86A 1FFNB 4HLJA 3UESA 5BWFA 1LILA 1T5WA 4HXAH 5ADPH 3AQUA 3TN0B 1YMMD 2CRIA 3U9PL 4MA8L 4MJ6B 3JTSA 1BFOB 2MTPA 4PJ8B 5CSGA 3RTQB 3HMWL 4NJAH 5HSFA 2VX5A 2DD8H 3B8SA 3WD0A 4RE4A 2BVYA 1DN0A 4M7ZC 1MQPA 5D7SL 3CVIL 4PRNA 2AJUL 5E6IB 1F97A 3UTOA 5C0EB 4RDQF 1KLUB 1U92B 3O41B 4X99A 5FDWB 1SVZA 4N0UB 1QFWH 1GZPB 1HILB 1T0MB 4J3XA 1NGPL 4F9PC 5HPOA 3SBWC 2WKLA 5CCKH 5I77A 4XP4H 3QUXA 1DQLH 1KLGB 5T3ZH 5IG7B 2CBIA 1MQ8A 3PV6B 1CLVA 1XGRB 2YD9A 2QLVB 2B5IB 2QTEA 5H8DA 4J27A 2W38A 4L8BA 4HC1A 1J0JA 2XM1A 2ESVB 2BSRB 4JKPL 3UBXB 5I15H 1US2A 4P3DA 1SVCP 1S9YA 3D1MC 1BFTA 3QUMH 5IBUB 4F9LA 4Q9RL 5IMMA 3IJ7A 1SFSA 1FFPA 4GMTL 3HUJE 4WCYH 2FO4A 1OAYL 4ETYA 1GOOA 3B83A 1GGIL 2JIXB 1R3HB 4NCC2 5BRZE 4FQ1H 4X6EA 2WCSA 1B2WL 3BPOC 5MENE 3OPZL 1W1YA 1OP9A 4QT5A 2PO6C 1WWCA 1PX3A 5A8OA 1GRWA 5JW3L 1RMFH 4XMPH 4ONFL 2G60H 1TZHB 3BGAA 4WFED 4MAUL 5MI0C 1Z2KA 5E70A 5GIRA 4GQPH 2PO6D 1MCIA 3FQTA 1NFIA 2CUMA 3UTSB 5I1DA 4P7NA 1I7ZA 4HPOL 1MRCL 3QXDB 3AHVA 1F8TL 5A3HA 3WELA 3OF6D 1BG4A 5DK0B 1U8JA 4JM2A 1ZBWA 5F71A 2Y4SA 4Z7WA 3V0VB 4MJIE 2J8UF 4M4PA 1RZ7L 4X4ZA 4HKJA 3KNBB 1QLRB 1H1NA 5B8CA 1CL7L 1CE1L 3EO1A 4UMGA 3OKOB 1OBAA 5DK3A 2DSUA 5GSVB 1U0QA 1MOEA 4OZFG 3MMEA 4JCMA 4P9HL 5C0BD 1G7PA 2BHZA 1X5ZA 4UIMB 4RISH 3BZFA 3TT3H 3ET9F 1I1AC 2AXJA 5KEZA 3QOKA 3EDJA 1RHHA 4PJBE 4CVXB 5HPCA 2RTSA 1UM4H 2VLKA 3TF7C 1N64H 5M17A 2O5YH 4BK5A 5DDHB 1EZVY 4HZAA 4JQVA 5FYLL 3HMXA 4GG8A 4LCWD 5C0CD 1LWHA 4AYSA 3BOVA 3UTQB 4M7KL 1XF2A 4UNUA 1RZIA 4QCFA 4Q0XL 1GGYA 5FO9B 4N9GA 1UXSB 3AS0A 1GUVA 1U30A 5F1KC 4ZS7L 1KSRA 4A2MA 2NXZB 3VRJB 4PJ8C 3RTQC 1A6VL 3GSRB 1P5UA 1INDH 4M9OA 1UFUA 4Y88A 5JW4R 4OB5L 1ES0B 4PJ8D 1LK2A 3MBXL 3MV9E 1DWJM 2J62A 2VXVH 5TFSH 2CIKA 4UCFA 2UWEE 4EN3B 4AQOA 3ULUH 1MVUB 1ZV5A 1X4YA 1X5LA 4RAUA 4K55A 1NGWA 4D0CA 3MRNA 4RWYL 5D1XB 5T1KA 3L4ZA 4AZGA 4GXVL 4JN1L 5D6CB 1G6RH 4HWNA 2YD4A 4I1NB 3VFUB 3O2DL 5IK3B 2J88H 4M81A 2C7UA 5EULV 2NTFB 3V6BR 3RJYA 1WFOA 1OB1B 1WF5A 4GW1A 3A4WA 2ZWYA 1F13A 1VDGA 3PP3H 4P4RB 4PJ7A 3NSXA 4PMDA 1KNOA 1NMBH 4DWSB 3L3DA 3HI1B 4JFHE 2ESVD 4OD2A 5CMAA 2DAVA 1ZS8B 3PIQA 1LEGB 2DJSA 1E71M 3PHQB 3WHE1 1MHEB 1U3HA 1ZVSB 3MLXL 2JEPA 4LDOB 1I1CA 1A4KA 4OGZA 2LVEA 1OT2A 5MEQB 3MRIB 4DN3H 4U6YB 1HH6A 2AERT 3DROB 4OUUB 4AEIH 2YD3A 5T5FH 2VRKA 5JW4N 5FYJD 3EZJB 2OR7A 2VZOA 3KXFB 1E70M 4HCRA 5HTSA 5J56B 1AGFA 3AM8C 3CZEA 1QI0A 1U8OA 2XYLA 1A1MA 1RUQH 3QEGH 4G43B 3UTSD 2EYSB 1WFNA 4PMRA 1G5AA 2ZKHH 3QCVL 1SYVB 2XRAH 1L7TH 4KKCD 3VH8B 1Q72H 1N5YL 4QY8A 1JPTL 4KROB 1LO0L 2O92A 3QFDB 2I26N 3CLEH 4BKLB 3IK2A 1SHMA 2GHWB 1DDHA 4H8VA 1NWRA 3BKYH 3MRJB 5HHXH 2AJVL 5EPMA 3CIQA 5EBGA 3TESA 5D1ZD 2R29L 2E8YA 4E8CA 3MO1B 1U2CA 3CDFA 1JPFA 1U8PB 3W2DL 2Y6SC 2QL1A 2O9TA 1TDQA 4U3CA 4W5UA 3EJZC 5HDLA 3FQRA 3MJ9H 3CFDB 4TULH 4I3SH 3F5WA 2A6DB 5ANME 2Y6SD 1ETZA 5DI8B 3BWAA 3R06B 2X4QB 5CD3B 3EJZD 2WMKA 4LCYB 3T0DA 4MADA 4WW2B 5C0GB 4PV8B 4X4MA 4YHPB 2XTKA 4JFEA 1EHXA 2EO7A 4AENB 2MHAA 4LIQH 3TJEH 4RRPG 4LHUB 5TE7L 1HXYA 4F2MA 4QAWA 4WO4A 2ATKB 3STZA 4FQQA 4KWUA 3BIKB 1CXLA 1DANT 3U1SL 4JFPA 1S5IL 5L6YH 2VAAA 4HLZH 4BELD 4OI7A 5DTFB 2ZOKA 5GRYA 1VKXA 3GMOB 4OI8A 1VPOH 2ZUMA 5A6SA 4XNUH 1A6PA 5I1KH 1YNLH 3VRLF 2J1KA 2A38A 1RZKL 4NC0B 5HHOE 1ZLUK 3SKMB 3BSHA 1NM9A 3RDKA 4YDKH 4EN3C 3H0TA 2J79A 3Q6FA 1GOHA 4RE3A 2XJ7A 4NRYA 5D1XC 1U8MB 2OWXA 4Y2DC 3AHYA 4EN3D 3MREB 3AFLA 1BIHA 5J7CC 1F5WA 4LEXH 1U8HA 4PRDA 3QULA 5D1XD 3AMKA 3QDME 4WWID 4AL8L 4BQ2A 4Y2DD 1ZA3A 4F7PA 2VXTH 1AHWA 3QUKA 4NKOB 1JYXA 3CLFL 1QRKA 3D48R 3DUSB 5IUSA 3GMRB 1CLYL 1GC1L 1PG7X 1I1XA 4PJGF 4DWSC 1A7NH 3BW9A 3IDNA 5HDBF 1IEHA 2DBLL 3VFOA 3SKJH 3QQ3B 4PRIA 4TTDC 3EMCA 1FCGA 2OJEA 2YRZA 3UYOD 1LLOA 1O6IA 3RWFB 1A9BA 3SOBH 2DT2A 4DWSD 3F12A 5JMRA 3MRFA 3EOAA 4TTDD 5BV7L 1BGXL 3MOBH 1X5FA 1PD6A 4G9FE 5I1IH 2FBJL 2DIJA 1NBZA 3UC0L 1BLNB 4OZGF 3AISA 5DRWB 3SCSA 4MQSB 2MMXA 5DC4B 2BV9A 3WHXB 1KJ2L 1EPFA 1AJ7L 3R8BB 5DRNA 3UJIL 4XCFL 4HIXH 3GSXB 1H3PH 2Z92B 3KLAB 4H25A 3GIZL 35C8L 1QFHA 5B38G 3NABL 4OZ4A 2VCAA 5LA0A 1FGVL 5E95B 5DD3H 3CMGA 1UWXH 3GSQA 1F3DJ 4Q6IB 3PQYE 3SUVA 1XIWA 4TVUA 2R1WA 4KROC 2Z1KA 3AIRA 5MEPA 5T3XH 2WAGA 4HFWA 2EIBA 1MCBA 3QNXA 3BDYL 2VC9A 3X14B 3WF2A 1QSZA 1L0YA 3DMMB 4KROD 1HL9A 2D23A 3WXVH 3GZKA 4NZTL 5FKAB 1J05B 4UI2A 1F4XL 1UM5L 1U8KA 5T1LA 4E9LA 2FDMA 5ADOH 3VXRA 1G7QB 4F7EA 5DUMH 2Y36H 4X9HA 2PETA 4AC1X 5DT1H 4Z7UA 4PRHE 1I8IB 2V3DA 1MCFA 1PKOA 2VERN 5ACZB 4JGJA 1CLXA 1HIML 1QR4A 3DSFL 2X1OA 2D3NA 1FZOB 4TOQA 1EGJA 2PW2B 4ODVL 2IJ0C 3CNKA 1MFEH 4WW2C 1C91A 5ETUB 5EN2B 1J1PL 1YECH 3OKKA 3H9SA 5FYLD 5CP3A 1OPGH 1KGWA 1HJWA 4I2XB 5ID1A 3CFBA 1NGYA 3N15A 1N5AA 5HNNA 4BH8A 4XZBA 2J8UB 4JY6B 4RAVA 2FCBA 4NP4L 5GRJH 1HQRB 3U7YH 3RMEA 5HGBB 1EAJA 5EB9A 1BP3B 2QQQA 1MWAL 1GGCH 5D7KE 3WFDH 2XIBA 2C1OA 3JWOH 1CFSB 3FHAA 1HHIB 4XX1G 2D3VA 1BYDA 3HG1B 3ILQC 4EJ1C 2A3BA 2E7HA 4MNJA 2X1QA 4M48H 4JPVL 4LLVA 3U4EB 2ICEB 2D1ZA 4PY7B 3GBDA 3CH1B 3ILQD 1GPFA 3FFCB 3NA4A 1A6TA 2VN4A 5D9PA 4GRWH 2EJ1A 1Q0XL 4QGTA 3PTKA 4NUJB 4ZPTB 43C9A 5GS2D 2CSPA 4V28A 3VRIA 1O7SA 4DCQA 3QO0B 4LARL 2DDQL 4EI6B 2JELH 1X1NA 1XGQB 4C56D 2HT4C 3P0YH 1FIEA 5E5MB 1U2HA 5I5RA 4MDIB 4MYWB 2XPGA 3SCPA 4U1KB 4PJIA 2OYMA 1XGPB 4PJAE 4XAWL 1IGIL 3RNKB 3IDJB 2NY5L 2WWKO 2HT4D 3JSSA 5E99H 3HFMH 1YN6B 4JCLA 3LQZB 3EYUL 5BV7B 5JHDA 2H26B 2CR6A 2EZ0C 4I9WE 2AJZB 4KUCD 5M95B 1JNLH 1F4YL 3BVNB 4I77H 5DHYB 3VFGH 1B2YA 4XCEA 5FGCE 3HUJB 5F9DC 1ZA6A 2EZ0D 3K3QA 1S7SA 4WWKA 1IT9L 1KJ2B 3IF1B 2EEXA 1D5XB 3I84A 1JRHI 5LVEA 2OWCA 4NZCA 3IDIA 1OGSA 3CGTA 3X13B 3OAUL 2WM0A 1A3RH 2GJ6B 1UR0A 1RUKL 4U7MA 3MRQB 2FD6L 3OJMB 3V7AE 1N2RA 2HFFB 3TA3B 4PGEB 4PJ5A 2VC2H 1OB0A 1ZXQA 5DT7A 3WUZA 2GJXB 1I7UA 3I02A 3D3VE 4PV9A 1BWWA 2V7NB 3GJFB 4JFFA 4PLJC 4K07A 1DP0A 4R0LA 1U8QA 3TJHC 1QNZH 3MXWH 4QRQA 5DJAB 1XGUA 3WV0A 4CNIB 5I8CB 1QSEB 4PLJD 2XWJA 4F8TA 2I5YH 1N7MH 3TJHD 4XI5D 3CSPA 2K3TA 2X7LA 3DMMC 4FTVE 3QIBB 1K6AA 4K3EH 4K7PH 4PJFA 2OZ4L 5HVGB 1FAIL 5B38A 4K94L 2OTUB 5D7JC 1OAXH 3W81A 3MSPA 3DMMD 5DMGD 3QFJE 4OGAC 2CRYA 4P2RE 4D3CL 5JOFA 1PIGA 1PZ2A 1NBYA 1MAJA 5D7JD 4ETQB 4LSQH 2AKRA 2IAMD 2X4SB 4KU1A 3WJLC 4QRRB 4OGAD 2XUCA 4JFOA 3D2UD 5I1HL 3THCA 1KC5H 4PR5A 3CHFA 4JL2A 2FB4L 3DNKA 3M1BB 4NQEE 3G6DH 4O9HH 5CEZE 3PHAA 4JG0L 5IEHA 2VKWA 1LWRA 1T6WA 4YEEA 1IGTB 5D6DA 1CNVA 1E4KA 3ZE2F 3L9RB 5IP4A 4P49A 2FWOA 2IH1A 1YC8A 4I3RH 4J6RH 3UDWA 1R0AH 4MA7L 1QLEL 4JN2A 2BRQA 4D9RE 2B20A 2P5EB 4ZFZA 1KPRB 1V6XA 4JFQA 3S8WA 3ZT5A 1RZKC 1XR9B 1REIA 1IT0A 1CWVA 4OBRA 3PDDA 4URTB 4NN6B 5GHWH 1T7XA 4GW5A 3S35X 2J3SA 3G5YA 1AXTL 3HG1D 2BOCA 2DQCH 3V52L 1EXUB 1S7UA 2Y06L 1FDLH 1DL7H 1JFHA 5HXMA 2EYRA 1CPUA 1FP9A 4MXWL 1FBIL 3PZMA 2PNDA 3LRSB 3GMQB 1CGSL 1OF2A 4Z7OF 3C87A 3SO3B 1GC1C 4YBHA 1TA3B 1FVEB 1V3LA 5CWSA 4M80A 1DHKA 4JPWL 4IOIB 2QV2A 2H8PB 4HH9B 3PWVA 1KF9B 3IKCB 3KYKH 1ZE3C 5C08D 5BV7C 2X42A 1BBDL 4QHNA 3SCOA 2PYED 1MIMH 1N3NA 7CGTA 4BA0A 1S7QB 2WIIA 1KXVC 2VH5L 3O2WH 1SJEA 1D6VH 4EQ3A 3G5VA 4HSQA 4P5MB 3K4AA 1YUHA 4WU7A 3ULSB 3HPLB 5FA3B 2A3CA 5FAAA 1KBBA 3Q6GL 4RWHA 2ZUSA 3MLTB 2XHYA 4WKAA 3H8NA 4WI2A 1C1EH 2BXZA 4WI5A 4D9LL 3TA3C 4L5FH 4YDLB 1NAKL 4M62L 1FYTE 1MHCB 2DLEA 4OLXH 2D20A 3VPLA 2GJ6D 5HGGS 3FNDA 4PFEA 3MS8A 3A47A 3SDYH 3TA3D 2NXYB 3B6SA 5AZEL 4LGSB 1E4NA 1NCWL 4PJHF 3PGFH 3VFVB 2DQHL 3UPRB 1MFNA 2DQTL 3I75A 4PJGB 2E9LA 1OINA 1DANU 2DJUA 1B0RA 2AEWA 1E6SM 1BD2B 1M7IA 1YQVL 2D0GA 4TVPE 25C8L 4UFIA 1JF1B 1QSED 3QIBC 3TZVB 4LGRB 4CADA 3BSZH 1O5DT 3MR9B 4WJ5A 4P4KD 3VWKD 2VLME 3KR3L 4NRZB 2A0LC 3QIBD 4ZE4A 2DTMH 2CITA 5C0AD 1E3ZA 1DEEA 4PP1C 1ZLVH 1BQLL 1G6RA 3CUHA 1B3JA 3GRWH 1ODZA 2W66A 4OZGB 2A0LD 1FE8L 3SQOL 1FO0H 4PP1D 1KB5H 5DO2C 5GISH 5BZDA 5ANMB 4HOWA 4R7DB 1OAQL 1CBVH 3TO2B 5AUMB 3BEVA 5FYJH 3S2CA 1MJUH 4QRRD 1L0XA 2AJYL 2EDNA 4GPNA 3HS0B 2HRPH 3C9NA 5DO2D 4P5KB 2BZDA 2YA0A 4P2QB 3AZRA 1BVNP 2EICA 1YPZF 3PZTA 4IS6B 2H32B 1KT2A 5K59E 1MW2A 2IPKA 2F5AH 2KL6A 1DLHA 4NN6C 2F8VA 4KKBD 1V08A 4ZFOB 3S37X 5ABEA 3NA9H 3WFLA 3MJ7A 4NHUA 1C92A 4PD4J 1NUGA 4D0BA 1K9DA 5A6LA 3FTGB 5J6GB 3UR7A 1I85A 5K9OB 2H9GA 3NH7H 4UOW1 3M45A 5D9OA 2Y07H 3RL2B 1UZ8B 4CMMA 4HGKC 4X8JA 2L0DA 2XVNA 3K1KC 2Q7YB 2NY5C 4TNVF 2BVOB 1D2KA 1RJYB 4U6HB 2DJ4A 1PBYA 1ED3B 1HCFX 1MI5A 4K9EL 1EX0A 5BS0A 1Q6DA 4DQOH 2YXFA 2FJHA 2EE9A 4OFYD 3V7MA 2V5YA 5EZJB 4D6IA 2P42B 3BP5A 3MJ9A 4JRYB 3B9KA 3U9PH 4G8GD 4WRLA 1PJ9A 3QH3B 1OL0A 3MFFB 4UQEA 1PVHA 3O6LH 4W93A 5D7SH 3T77B 2A6JA 3PWJB 2NSXA 4YPGA 3ULVF 1QLFA 3G6JF 4L1HA 1CFVH 4G9FB 4ORGA 4CAGA 2LTQB 4K8RC 3DTXA 3MV7E 2VIRA 3BCFA 1FCCA 3OR7A 4UINL 2AK4E 4ZEPA 2NXYC 5ALCL 4NDMA 5CEXB 1A3LL 2YHGA 4RX4A 3T0AA 1T5XB 3BJ91 2YMXL 1MIEL 4W84A 2VLLB 4JKPH 3RAJL 5IBTL 4AEFA 2NXYD 3T09A 5J6HB 1QSFD 3I50L 4JLRB 4K94C 1OSPL 2Z4QB 3IDGA 4GMTH 3ISWA 4OJFH 1JZ8A 3TZVC 3D39D 2VDML 4LMQE 2R23A 3LV3B 3L3JA 1BD2D 5H35B 5I8EA 1S7WB 1XF5B 2X40A 1CGWA 4L8CA 4KQ4L 1B2WH 4KRTA 2ITCA 1QBLH 4PTXA 3TZVD 2XZQL 5C3LD 2J7EA 4HBQA 5JW3H 3IFLH 3O8XA 3CSGA 4WHTA 1HXMA 1I8MA 5HHNA 1KEGL 4MAUH 1TLKA 4W7VA 3GM0A 4Z7NF 2JK5B 2XWDA 2F54D 5AEAA 4ZUWA 4IPLA 1UVQA 15C8L 2IANE 2VOTA 4HPOH 1MRCH 1MUJB 3VXOB 4H1LH 1AI1H 1VFMA 2W0FA 3GBML 3U0PB 4PRBB 1YHTA 5ID0A 3NZHL 3RU8L 4L9DA 4NOFA 4ELMA 2OBGA 4LX4A 2W67A 1OGAA 4LRNL 4X7FC 5KSAC 1CL7H 4R2GB 5F21B 2OYLA 2Q6WA 1CE1H 3OKNA 4P2QD 2VJXA 4X6CA 5JPNB 5HYSB 5KSAD 1ZT1A 2V9TA 2OYKA 2ID5A 1CGYA 1DN2A 4P9HH 1QOXA 4WV1A 5IR1A 5DVMA 5DWUL 4NKMB 3SKOB 1OM0A 3V4UL 3RIFK 2MKLC 1PPIA 2X4PA 3KJ6L 3L3IB 5BVPL 1ZTXH 3U4BL 1FNGA 1QA9A 2QQNL 3LPOA 2YJQA 3D25A 5ISZE 2VABB 3WBDA 5E08H 5I23A 3GGWA 2DQUL 4RFEA 4M7KH 2XGIA 1MELA 5CSZA 3MPCA 2ZG1A 4Q0XH 4LDEB 4EUPB 5GGSB 4HZ6A 4BK4A 2YD8A 3CZFA 3PP3K 3RWHB 5KSVB 1KTLA 3HC0A 3PDOA 5DFVD 4UIKL 3NCCB 3TIDB 5C92A 3P4OB 3T0EB 3IDMA 3WO3B 1E6ZA 1H0DA 4JRYD 3VU2A 1F6AA 5IB1B 3UMTA 2QADC 5DJXB 5CKAA 3T65A 5FYKE 5DEFA 3LS5L 4OB5H 5FO7B 3L5IA 1WDPA 4IDJL 5ABFB 2FX7L 3BH8A 5A8PA 4WSKA 3TYFA 2QADD 2P24B 3HPJB 5A6BD 3TP4A 2LTQC 4RWYH 5C8JA 1XGTB 4RFNB 2EDHA 1CENA 1DE4A 5GS2H 5E0QA 2DI7A 4LVNB 4P8WA 2Y8KA 3FRUA 4UQ3A 2XFXA 1YDPB 4UOJA 2FDBP 3FAWA 43CAB 2CLVB 5FUOL 3I85A 1UADC 2NYYC 3IFNH 3DO7B 2WBWB 4NO3A 3GNML 5D7IA 4X6FA 2NYYD 4ATLA 2F19L 5KSBF 3QWQB 5IVXA 4F79A 2W9DH 5EZOL 1YEEL 3FB8B 1FNHA 1MRFH 3F7YA 2M1KA 5BMFL 1XFPA 3MLXH 3PG2A 3GI8L 4U1NB 1W9PA 1FNSH 1T3FA 3PWUA 3DV4B 4N90D 2ZNWA 2A9ML 5F9OL 4JZ5A 5E24E 4ZFFA 4NOBA 4ENEC 4AIZB 4N5UA 4NFCA 3FQWA 4XNXL 1NCNA 4Y89A 3ULVL 4KUZL 4JREC 2WC4A 1A02N 4BZ2H 2NY1C 1PQZB 3HC4L 3T4YB 1T4KB 4ENED 4PJHB 1FL5B 4FQXD 3I6KA 1PLGL 4W8BA 1J10A 4NQEB 1W3JA 1N5YH 1ZT7A 1YMMA 5D8JL 2DSVA 2NY1D 4U3XA 1MY5A 4LBEA 1AIWA 4NO5A 4R2GC 1XR8A 1GPOL 4CRPA 4DVBB 5DMJB 2RGLA 2ZX8A 1V7ML 2P5WE 1UWRA 4RMSA 5E94A 5F7LB 5CBAB 3MACH 4F7TA 2R29H 4R2GD 2A73B 3KPSB 2ZX7A 4K7PY 4M1CC 3O3EA 1MF2H 3R8QA 3B43A 4KI1A 4L8SB 3AREB 4ZUUB 5JQ6L 3FFDB 1K2DB 1WAAA 4M1CD 4LLAA 4M03A 1RHFA 1QFUL 4P3CL 1NL0L 1EUUA 4NBYB 3SBWA 2VLRE 3NIYA 2G9HB 4ZOBA 3W9EA 1HKKA 5C0RH 3OLDA 5B3JE 3FO0L 3JBG7 3MRKA 4G80A 3OGCA 4NWUL 1DLFL 5F1IB 2UZXB 5J0BA 3PTQA 4JEGB 1BZ7B 2HN7B 4AZHA 8A3HA 5JIKA 2NT1A 1LNUA 5TE7H 5HY9B 3V4PL 1YPZB 3VGAC 3ECBA 2JLLA 3EGSA 4HX1A 5C07B 2CQVA 4AIXA 3U1SH 4Y1AD 5DMKB 1S5IH 2E40A 1JHTA 4GQ9L 4UFJA 1CQKA 3LEYL 1BYCA 3WD5L 3QA3A 5AY7A 1M05B 4PJEF 4F15B 4AMKL 2CIPA 1J1XL 1IAKB 1FL3B 5IJVB 2IBBA 5D7LD 3L95A 3BD4A 4OZHE 5C6TL 4MWFB 5B4MC 1WTLA 3MV8B 1IGCL 2P49B 4NM8L 3KPOB 3EOBB 2XKUA 4L4OA 3TOPA 3OF6A 4AD1A 4MCYB 4RFNC 1UR2A 2EPKX 3W0KA 1H3VA 1CGVA 1JJUA 5FM4A 3ARDA 4LVNC 1KXQE 5B4MD 2CLZA 3VX0A 5IQ7L 4AL8H 4FLQA 1IAMA 4OCXL 3V4VL 4HOZA 5T1MB 4ONGL 2EO1A 1UWXK 1RK0A 2YWYA 2QHAA 1BVLA 4XB8A 4GXPA 1KN4L 1AXSB 2DBLH 1YEKL 3VXUE 1WQVT 2W0LA 3ZDYE 1HZHH 5C09D 1M7XA 1C8YA 1M6OB 5DJ6A 1TJGL 3ESVF 2WVVA 4G42A 2CKBB 2JJUA 1ORSB 3ALGA 1LP9A 5FK9A 2CLRB 3ALWA 1KJMA 4X6BA 1HF6A 2FBJH 1CLZL 1Q9OA 4UZUA 4PSPA 2OJZH 3G6JB 3GSWA 1JGLL 1MFCL 4LCWA 5GRWA 3V6ZB 3WO4B 1G0YR 2IPUG 4LPYA 3UJIH 5C0CA 4GAYB 5IB2A 1OY3B 4OCSH 35C8H 1IM9B 2D31A 2WXDM 4D71A 1FGVH 2L7UA 4PGDB 3CC5A 3L3KB 3LSOA 4OI9A 3W38A 2Z31D 1P6WA 2VAJA 2WMIA 5JO5B 1K8DB 3S34L 4ONHA 1F58H 1HE7A 2JJSA 1LEIB 5B39A 5TQ2L 1FFNA 5ABDE 1KGCE 3C5JA 3MLZL 5DJYA 3ELAT 4OQTH 1BFOA 1KG0B 4PJ8A 3BZEA 4NZTH 1F4XH 2R2HA 1UM5H 3VXTB 2IMNA 3RO8A 4V27A 5C0EA 3HE7B 4JO1L 1RJZA 3KPSD 5FDWA 5ABGA 5BO1L 1HIMH 5F6HJ