1L6JA

Crystal structure of human matrix metalloproteinase mmp9 (gelatinase b).
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
416
structure length
405
Chain Sequence
VLFPGDLRTNLTDRQLAEEYLYRYGYTLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9
publication title Structure of the C-terminally truncated human ProMMP9, a gelatin-binding matrix metalloproteinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 108
structure length 405
sequence length 416
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2002-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 1l6jA01
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1l6jA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1l6jA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1l6jA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1l6jA02
966CA 3WV1A 2ERQA 5JMYA 2K9CA 4IN9A 1GXDA 1MMRA 1GO8P 4H30A 4PKVA 3BKVA 5I4OA 4WF6A 3DNGA 2CKIA 2JT5A 1GE6A 1JAPA 4L63A 1CQRA 4DD8A 3K7NA 2OW9A 1GE7A 4JQGA 4ZR5A 2JT6A 4BPAA 1CK7A 456CA 4A7BA 2OY2A 4AXQA 1IABA 2DDFA 4I03A 2Y6DA 1LBUA 2RJQA 3USNA 1I1IP 1GO7P 1Y8JA 3O2XA 2WOAA 2PJTA 1OO9A 4PKUA 4QKZA 3LEAA 1C3IA 1SLNA 1D8MA 3KMEA 4DV8A 4WKEA 3EHYA 1E8BA 1G12A 3F1AA 1JH1A 1KBCA 1MMQA 4G9LA 2CLTA 1CIZA 3B8ZA 3DPFA 3KWVC 3HYGA 4XCTA 5D1TA 2FN2A 4Q1LA 1Z3JA 4JA1A 1JAQA 4GWNA 4FVLA 1MMPA 1JIZA 1UTZA 4IJOA 5B5OA 1QO6A 2ERPA 3LK8A 3HY9A 1GKDA 3N2VA 1BM6A 2W13A 3LILA 3LGPA 3P24A 1EB6A 1PWQA 5L7FA 3P1VA 4R3VA 3MQLA 2TCLA 1R55A 1JIWP 3ELMA 3LJZA 5CXAA 3N2UA 4BXEA 5L79A 1ZTQA 2DDYA 1SRPA 4GWMA 3OHOA 4GUYA 2D1NA 1BKCE 1S4BP 3D2YA 5CZMA 1BQQM 2O3EA 1XFVA 2WKXA 4GR8A 2V4BA 4J4MA 2JNPA 1XFYA 2Y6CA 5I2ZA 1G05A 4FXQA 1HFSA 4PKRA 1OS9A 1AKLA 4FU4A 2WO8A 1XFXA 1OM6A 3ZVSA 1FBLA 3V96B 1KUHA 3MA2A 3HB2P 1K7GA 1QJJA 2FV5A 3L0VA 5D1SA 3B2ZA 4GQLA 4GF1A 2Z2DA 1IACA 2W14A 1XFWA 3AYUA 2RJPA 1BUDA 3HY7A 3WV2A 2DW1A 2HU6A 1C7KA 4WZVA 1R54A 4JPAA 4HX3A 4PKSA 1EAKA 1RM8A 1FM1A 1YQYA 2OVZA 4G0DA 3LIKA 3HDAP 1G4KA 830CA 4PKQA 4ILWD 2KRJA 1KUGA 3LIRA 1Y0VA 5I0LA 2EROA 1BIWA 4XBHA 1JK3A 4BOLA 1KAPP 1HFCA 3EHXA 1SMPA 3U1RA 1IAEA 1DTHA 3I7GA 3LQ0A 1MMBA 3KRYA 4HMAA 3EDGA 2USNA 1PDCA 3LE9A 2D1OA 5BOTA 2YB9A 1QUAA 1Y93A 3DSLA 4DPEA 2OW1A 1QJIA 1CAQA 2MZHA 2W15A 1UMSA 1D8FA 1SLMA 1ATLA 3UVCA 4CTHA 1ND1A 5I3MA 1JJ9A 1CXVA 1H8PA 1C8TA 4BXDA 2K2GA 1SU3A 4WK7A 4A3WA 3EDIA 2MLRA 1KUIA 1O0TA 1BKCI 1R1HA 3L0TA 3TSKA 2W12A 2XS4A 1QIBA 3LUMA 1Q3AA 1BKCA 1BSWA 2DW0A 3OHLA 3TS4A 3Q2HA 4BJ4A 1HY7A 5I12A 1PWUA 1KS0A 3TVCA 1USNA 3EDZA 1QICA 3F19A 1OM7A 1XFZA 3HBVP 2QPJA 1PWVA 3RTSA 2WO9A 5B5PA 4IUWA 1L6JA 3NX7A 3M7PA 2X3AA 1HV5A 1O0QA 2YIGA 3LJTA 1IADA 5I43A 1QIAA 1ZP5A 1B8YA 4XM7A 1CGLA 1UTTA 1EUBA 1A85A 2OW2A 3F15A 3TT4A 1H71P 5BOYA 1DMTA 1AF0A 4L19A 3SHIA 5D1UA 3F18A 3F16A 5CUHA 4GR0A 1J7NA 2AYKA 1K7IA 3BA0A 3KEKA 1ZXVA 2SRTA 4H49A 4BXJA 1CGEA 4XM8A 1ROSA 1UEAA 2POJA 2L0RA 2OXUA 1R1JA 3KECA 4AUOA 4WKIA 2OW0A 5D2BA 1D7XA 3KMCA 1IAGA 1K7QA 1BZSA 2O36A 3VTGA 2OXZA 1RMZA 2OI0A 1KUKA 1YP1A 4G54A 2X3BA 2XS3A 1FLSA 3DPEA 1UMTA 3RTTA 1HOVA 1JANA 1G9KA 2AIGP 3O64A 1XUCA 1GKCA 1GE5A 3E8RA 2BH7A 3DL1A 2DW2A 1IAAA 3G42A 4H3XA 3BKHA 4H84A 2W0DA 4DF9A 5D7WA 3EWJA 2N8RA 2E2DA 3LMCA 4I35A 3VI1A 1PWWA 3LQBA 1OMJA 2JIHA 1ASTA 3KEJA 1G49A 5H8XA 3Q2GA 2X3CA 4GR3A 4XM6A 5BPAA 1D5JA 1CGFA 4H2EA 1B3DA 3DWBA 1R1IA 4AYKA 4PKWA 3KHIA 3LUNA 2MZIA 3I7IA 2OXWA 1OM8A 5D3CA 1MNCA 4AIGA 2OVXA 1JAOA 1WNIA 2JSDA 4PKTA 3EDHA 3WV3A 3ZUKA 3LKAA 2OZRA 3K7LA 1SATA 1YCMA 2FV9A 3ZXHA 2V5OA 4JP4A 2I47A 3HBUP 3CKIA 1PWPA 1XURA 1ZVXA 1BUVM 2A8HA 4H1QA 3B92A 3HDBA 2J0TA 4ON1A 1I76A 4H82A 4JIJA 1YOUA 4EFSA 1J7MA 3G5CA 1A86A 2MZEA 1KUFA 1I73A 2MLSA 2X7MA 1AYKA 1JKYA 4LPQA 1E88A 3F17A 2OY4A 4FXYP 3AIGA 3AYKA 4H76A 1BQOA 1ZXCA 2E3XA 1XUDA 3GBOA 3D2ZA 1HTDA 1XFUA 3LJGA 5LABA 4L6TA 1CXWA 1OS2A 2J83A 1ZS0A
chains in the Genus database with same CATH superfamily
966CA 3WV1A 2ERQA 5JMYA 4IBKA 2K9CA 4NZ3A 4IN9A 1GXDA 1MMRA 3N3FA 1GO8P 4H30A 3WD0A 4PKVA 3BKVA 4Z2GA 5I4OA 4WF6A 3DNGA 3KS8A 2Y2MA 2CKIA 2JT5A 1GE6A 1JAPA 4L63A 1CQRA 4DD8A 3K7NA 2OW9A 1GE7A 4JQGA 4ZR5A 2JT6A 4BPAA 3L28A 3HONA 2JE5A 1TVIA 1CK7A 456CA 4A7BA 2OY2A 3L29A 4AXQA 1IABA 2DDFA 4I03A 4Z2IA 4OJ6A 2Y6DA 1LBUA 2RJQA 3USNA 1I1IP 1GO7P 1Y8JA 3O2XA 2WOAA 2PJTA 1OO9A 4PKUA 4QKZA 3LEAA 1C3IA 1SLNA 1D8MA 3KMEA 4DV8A 4Z2KA 4WKEA 3EHYA 1E8BA 1G12A 3F1AA 1JH1A 1KBCA 1MMQA 4G9LA 2CLTA 1CIZA 3B8ZA 3DPFA 3KWVC 3HYGA 4XCTA 5D1TA 2FN2A 4Q1LA 1Z3JA 2BG1A 1YU4A 4JA1A 1JAQA 4GWNA 4FVLA 1MMPA 1JIZA 3L27A 1UTZA 4IJOA 5B5OA 1QO6A 2ERPA 1E6NA 3LK8A 3HY9A 1GKDA 3N2VA 1BM6A 2W13A 3LILA 3LGPA 3P24A 1XM5A 1EB6A 1PWQA 4MB5A 5L7FA 3P1VA 4R3VA 3MQLA 2TCLA 3WX7A 1R55A 1UR9A 1JIWP 3ELMA 2Y2LA 4HMCA 1XAXA 3LJZA 5CXAA 3N2UA 4BXEA 5L79A 1ZTQA 2DDYA 4MB4A 1SRPA 4GWMA 3OHOA 4GUYA 2D1NA 1BKCE 3FKEA 1S4BP 3D2YA 3L25A 5CZMA 1BQQM 1E6PA 2O3EA 1XFVA 2WKXA 4GR8A 2V4BA 4Z2LA 2JNPA 4J4MA 1XFYA 1GOIA 3WD2A 2Y6CA 1G05A 5I2ZA 4FXQA 1HFSA 4PKRA 4IBDA 1OS9A 1AKLA 4FU4A 2WO8A 1YUEA 4OJLA 1XFXA 1OM6A 3ZVSA 1FBLA 1E6ZA 3V96B 1KUHA 1OZ9A 3MA2A 5BPVA 3HB2P 1K7GA 1QJJA 2FV5A 3L0VA 5D1SA 3B2ZA 4GQLA 4NYUA 4GF1A 3HSHA 2Z2DA 1IACA 2W14A 1XFWA 3AYUA 2RJPA 4IBJA 1H0GA 1BUDA 3HY7A 4IBEA 3WV2A 4LG2A 2DW1A 4NY2A 2D49A 2HU6A 1YU1A 1C7KA 4WZVA 1R54A 4JPAA 4HX3A 4PKSA 1EAKA 1RM8A 1FM1A 1YQYA 4IBFA 2OVZA 4G0DA 3LIKA 3HDAP 1G4KA 830CA 4PKQA 4ILWD 2KRJA 1KUGA 3L26A 3LIRA 1Y0VA 5I0LA 2EROA 1BIWA 4XBHA 1JK3A 1W1TA 4BOLA 1KAPP 4HMEA 1HFCA 3EHXA 4OJOA 1SMPA 4IBCA 3U1RA 1IAEA 1DTHA 3I7GA 3LQ0A 4OJ5A 1MMBA 3KRYA 2Y2OA 4HMAA 3EDGA 2USNA 2IOUA 1PDCA 1YU3A 3LE9A 2D1OA 5BOTA 1W1PA 2YB9A 1QUAA 1Y93A 3DSLA 4DPEA 2OW1A 1QJIA 1CAQA 2MZHA 1E15A 2W15A 1UMSA 1D8FA 1SLMA 1ATLA 3UVCA 4CTHA 1ND1A 5I3MA 1JJ9A 4NYYA 1CXVA 3KS4A 1H8PA 1C8TA 3DTIA 4BXDA 4TX8A 4L7AA 2K2GA 1SU3A 4Z2JA 4WK7A 4A3WA 1OGBA 3DTKA 3EDIA 2MLRA 1KUIA 1O0TA 1BKCI 1R1HA 3L0TA 3TSKA 4NZ5A 2W12A 2XS4A 1QIBA 3LUMA 1Q3AA 1BKCA 1BSWA 2DW0A 3OHLA 3TS4A 3Q2HA 4BJ4A 1HY7A 5I12A 1PWUA 4OUIA 1KS0A 3TVCA 1USNA 3EDZA 4NZ1A 1QICA 3F19A 1OM7A 1XFZA 2JCHA 3HBVP 2QPJA 1PWVA 3RTSA 2WO9A 5B5PA 4IUWA 1L6JA 3NX7A 3M7PA 2X3AA 1HV5A 1O0QA 2YIGA 3LJTA 1IADA 5I43A 3WD3A 1QIAA 4OJPA 1B8YA 1ZP5A 4XM7A 1CGLA 1UTTA 1EUBA 1A85A 1W1YA 2OW2A 3F15A 3TT4A 1H71P 5BOYA 1DMTA 1AF0A 4L19A 3SHIA 5D1UA 2Y2IA 2Y2HA 3F18A 3F16A 4GHLA 5CUHA 4GR0A 1J7NA 1UR8A 2AYKA 1K7IA 3BA0A 3KEKA 1ZXVA 2SRTA 4H49A 4BXJA 4IBIA 1CGEA 4XM8A 1ROSA 1UEAA 2POJA 2L0RA 2OXUA 1R1JA 3WD4A 3KECA 4AUOA 4WKIA 2OW0A 4HMDA 5D2BA 1D7XA 3KMCA 1IAGA 1K7QA 1BZSA 2O36A 1E6RA 4NZ4A 3VTGA 2YUFA 2OXZA 2Y2KA 1RMZA 2OI0A 1KUKA 1YP1A 4G54A 2X3BA 2XS3A 2Y2GA 1FLSA 4GH9A 3DPEA 1UMTA 3RTTA 1HOVA 1O6IA 1JANA 1G9KA 2AIGP 3O64A 1XUCA 1GKCA 1GE5A 3E8RA 4QNLA 2BH7A 3DL1A 2DW2A 1IAAA 3G42A 4H3XA 3BKHA 4H84A 2W0DA 4DF9A 2Y2PA 5D7WA 3EWJA 3DTEA 4IJEA 2N8RA 4GHAA 2E2DA 3LMCA 4I35A 3VI1A 1H0IA 1PWWA 3LQBA 1YU0A 1OMJA 2JIHA 3L2AA 1ASTA 3KEJA 1G49A 5H8XA 3Q2GA 2X3CA 4GR3A 4XM6A 3WD1A 5BPAA 1D5JA 1CGFA 4H2EA 2Y2JA 1B3DA 2Y2QA 3DWBA 1R1IA 4AYKA 4PKWA 3KHIA 3LUNA 1W1VA 2MZIA 4IBBA 3I7IA 2OXWA 1OM8A 5D3CA 1MNCA 2FFFB 4AIGA 2OVXA 1JAOA 1WNIA 2JSDA 4PKTA 3EDHA 4IBGA 3WV3A 3ZUKA 3LKAA 2OZRA 3K7LA 1SATA 1YCMA 2FV9A 3ZXHA 2V5OA 2RTSA 4JP4A 2I47A 3HBUP 3CKIA 1PWPA 1XURA 1ZVXA 2UWXA 1BUVM 2A8HA 4H1QA 3B92A 1YU2A 3HDBA 2J0TA 2Y2NA 4ON1A 2XD1A 1I76A 4H82A 4JIJA 1YOUA 4EFSA 1J7MA 3G5CA 1GPFA 1A86A 1AIWA 2MZEA 1KUFA 1I73A 2XD5A 2MLSA 2X7MA 1AYKA 4IJFA 1JKYA 1ED7A 4LPQA 1E88A 3F17A 4Z2HA 2OY4A 4FXYP 3AIGA 3AYKA 4H76A 1BQOA 1ZXCA 2E3XA 1XUDA 3GBOA 3D2ZA 1HTDA 1XFUA 3LJGA 5LABA 4L6TA 4MB3A 1CXWA 1OS2A 2J83A 1ZS0A 1OGGA
chains in the Genus database with same CATH topology
966CA 3WV1A 2ERQA 5JMYA 2K9CA 4IN9A 1GXDA 1MMRA 1GO8P 4H30A 4PKVA 3BKVA 5I4OA 4WF6A 3DNGA 2CKIA 2JT5A 1GE6A 1JAPA 4L63A 1CQRA 4DD8A 3K7NA 2OW9A 1GE7A 4JQGA 4ZR5A 2JT6A 4BPAA 1CK7A 456CA 4A7BA 2OY2A 4AXQA 1IABA 2DDFA 4I03A 2Y6DA 1LBUA 2RJQA 3USNA 1I1IP 1GO7P 1Y8JA 3O2XA 2WOAA 2PJTA 1OO9A 4PKUA 4QKZA 3LEAA 1C3IA 1SLNA 1D8MA 3KMEA 4DV8A 4WKEA 3EHYA 1E8BA 1G12A 3F1AA 1JH1A 1KBCA 1MMQA 4G9LA 2CLTA 1CIZA 3B8ZA 3DPFA 3KWVC 3HYGA 4XCTA 5D1TA 2FN2A 4Q1LA 1Z3JA 4JA1A 1JAQA 4GWNA 4FVLA 1MMPA 1JIZA 1UTZA 4IJOA 5B5OA 1QO6A 2ERPA 3LK8A 3HY9A 1GKDA 3N2VA 1BM6A 2W13A 3LILA 3LGPA 3P24A 1EB6A 1PWQA 5L7FA 3P1VA 4R3VA 3MQLA 2TCLA 1R55A 1JIWP 3ELMA 3LJZA 5CXAA 3N2UA 4BXEA 5L79A 1ZTQA 2DDYA 1SRPA 4GWMA 3OHOA 4GUYA 2D1NA 1BKCE 1S4BP 3D2YA 5CZMA 1BQQM 2O3EA 1XFVA 2WKXA 4GR8A 2V4BA 4J4MA 2JNPA 1XFYA 2Y6CA 5I2ZA 1G05A 4FXQA 1HFSA 4PKRA 1OS9A 1AKLA 4FU4A 2WO8A 1XFXA 1OM6A 3ZVSA 1FBLA 3V96B 1KUHA 3MA2A 3HB2P 1K7GA 1QJJA 2FV5A 3L0VA 5D1SA 3B2ZA 4GQLA 4GF1A 2Z2DA 1IACA 2W14A 1XFWA 3AYUA 2RJPA 1BUDA 3HY7A 3WV2A 2DW1A 2HU6A 1C7KA 4WZVA 1R54A 4JPAA 4HX3A 4PKSA 1EAKA 1RM8A 1FM1A 1YQYA 2OVZA 4G0DA 3LIKA 3HDAP 1G4KA 830CA 4PKQA 4ILWD 2KRJA 1KUGA 3LIRA 1Y0VA 5I0LA 2EROA 1BIWA 4XBHA 1JK3A 4BOLA 1KAPP 1HFCA 3EHXA 1SMPA 3U1RA 1IAEA 1DTHA 3I7GA 3LQ0A 1MMBA 3KRYA 4HMAA 3EDGA 2USNA 1PDCA 3LE9A 2D1OA 5BOTA 2YB9A 1QUAA 1Y93A 3DSLA 4DPEA 2OW1A 1QJIA 1CAQA 2MZHA 2W15A 1UMSA 1D8FA 1SLMA 1ATLA 3UVCA 4CTHA 1ND1A 5I3MA 1JJ9A 1CXVA 1H8PA 1C8TA 3DTIA 4BXDA 4L7AA 2K2GA 1SU3A 4WK7A 4A3WA 3DTKA 3EDIA 2MLRA 1KUIA 1O0TA 1BKCI 1R1HA 3L0TA 3TSKA 2W12A 2XS4A 1QIBA 3LUMA 1Q3AA 1BKCA 1BSWA 2DW0A 3OHLA 3TS4A 3Q2HA 4BJ4A 1HY7A 5I12A 1PWUA 1KS0A 3TVCA 1USNA 3EDZA 1QICA 3F19A 1OM7A 1XFZA 3HBVP 2QPJA 1PWVA 3RTSA 2WO9A 5B5PA 4IUWA 1L6JA 3NX7A 3M7PA 2X3AA 1HV5A 1O0QA 2YIGA 3LJTA 1IADA 5I43A 1QIAA 1ZP5A 1B8YA 4XM7A 1CGLA 1UTTA 1EUBA 1A85A 2OW2A 3F15A 3TT4A 1H71P 5BOYA 1DMTA 1AF0A 4L19A 3SHIA 5D1UA 3F18A 3F16A 5CUHA 4GR0A 1J7NA 2AYKA 1K7IA 3BA0A 3KEKA 1ZXVA 2SRTA 4H49A 4BXJA 1CGEA 4XM8A 1ROSA 1UEAA 2POJA 2L0RA 2OXUA 1R1JA 3KECA 4AUOA 4WKIA 2OW0A 5D2BA 1D7XA 3KMCA 1IAGA 1K7QA 1BZSA 2O36A 3VTGA 2YUFA 2OXZA 1RMZA 2OI0A 1KUKA 1YP1A 4G54A 2X3BA 2XS3A 1FLSA 3DPEA 1UMTA 3RTTA 1HOVA 1JANA 1G9KA 2AIGP 3O64A 1XUCA 1GKCA 1GE5A 3E8RA 2BH7A 3DL1A 2DW2A 1IAAA 3G42A 4H3XA 3BKHA 4H84A 2W0DA 4DF9A 5D7WA 3EWJA 3DTEA 2N8RA 2E2DA 3LMCA 4I35A 3VI1A 1PWWA 3LQBA 1OMJA 2JIHA 1ASTA 3KEJA 1G49A 5H8XA 3Q2GA 2X3CA 4GR3A 4XM6A 5BPAA 1D5JA 1CGFA 4H2EA 1B3DA 3DWBA 1R1IA 4AYKA 4PKWA 3KHIA 3LUNA 2MZIA 3I7IA 2OXWA 1OM8A 5D3CA 1MNCA 4AIGA 2OVXA 1JAOA 1WNIA 2JSDA 4PKTA 3EDHA 3WV3A 3ZUKA 3LKAA 2OZRA 3K7LA 1SATA 1YCMA 2FV9A 3ZXHA 2V5OA 4JP4A 2I47A 3HBUP 3CKIA 1PWPA 1XURA 1ZVXA 1BUVM 2A8HA 4H1QA 3B92A 3HDBA 2J0TA 4ON1A 1I76A 4H82A 4JIJA 1YOUA 4EFSA 1J7MA 3G5CA 1A86A 2MZEA 1KUFA 1I73A 2MLSA 2X7MA 1AYKA 1JKYA 4LPQA 1E88A 3F17A 2OY4A 4FXYP 3AIGA 3AYKA 4H76A 1BQOA 1ZXCA 2E3XA 1XUDA 3GBOA 3D2ZA 1HTDA 1XFUA 3LJGA 5LABA 4L6TA 1CXWA 1OS2A 2J83A 1ZS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 966C A;  3WV1 A;  2ERQ A;  5JMY A;  2K9C A;  4IN9 A;  1GXD A;  1MMR A;  1GO8 P;  4H30 A;  4PKV A;  3BKV A;  5I4O A;  4WF6 A;  3DNG A;  2CKI A;  2JT5 A;  1GE6 A;  1JAP A;  4L63 A;  1CQR A;  4DD8 A;  3K7N A;  2OW9 A;  1GE7 A;  4JQG A;  4ZR5 A;  2JT6 A;  4BPA A;  1CK7 A;  456C A;  4A7B A;  2OY2 A;  4AXQ A;  1IAB A;  2DDF A;  4I03 A;  2Y6D A;  1LBU A;  2RJQ A;  3USN A;  1I1I P;  1GO7 P;  1Y8J A;  3O2X A;  2WOA A;  2PJT A;  1OO9 A;  4PKU A;  4QKZ A;  3LEA A;  1C3I A;  1SLN A;  1D8M A;  3KME A;  4DV8 A;  4WKE A;  3EHY A;  1E8B A;  1G12 A;  3F1A A;  1JH1 A;  1KBC A;  1MMQ A;  4G9L A;  2CLT A;  1CIZ A;  3B8Z A;  3DPF A;  3KWV C;  3HYG A;  4XCT A;  5D1T A;  2FN2 A;  4Q1L A;  1Z3J A;  4JA1 A;  1JAQ A;  4GWN A;  4FVL A;  1MMP A;  1JIZ A;  1UTZ A;  4IJO A;  5B5O A;  1QO6 A;  2ERP A;  3LK8 A;  3HY9 A;  1GKD A;  3N2V A;  1BM6 A;  2W13 A;  3LIL A;  3LGP A;  3P24 A;  1EB6 A;  1PWQ A;  5L7F A;  3P1V A;  4R3V A;  3MQL A;  2TCL A;  1R55 A;  1JIW P;  3ELM A;  3LJZ A;  5CXA A;  3N2U A;  4BXE A;  5L79 A;  1ZTQ A;  2DDY A;  1SRP A;  4GWM A;  3OHO A;  4GUY A;  2D1N A;  1BKC E;  1S4B P;  3D2Y A;  5CZM A;  1BQQ M;  2O3E A;  1XFV A;  2WKX A;  4GR8 A;  2V4B A;  4J4M A;  2JNP A;  1XFY A;  2Y6C A;  5I2Z A;  1G05 A;  4FXQ A;  1HFS A;  4PKR A;  1OS9 A;  1AKL A;  4FU4 A;  2WO8 A;  1XFX A;  1OM6 A;  3ZVS A;  1FBL A;  3V96 B;  1KUH A;  3MA2 A;  3HB2 P;  1K7G A;  1QJJ A;  2FV5 A;  3L0V A;  5D1S A;  3B2Z A;  4GQL A;  4GF1 A;  2Z2D A;  1IAC A;  2W14 A;  1XFW A;  3AYU A;  2RJP A;  1BUD A;  3HY7 A;  3WV2 A;  2DW1 A;  2HU6 A;  1C7K A;  4WZV A;  1R54 A;  4JPA A;  4HX3 A;  4PKS A;  1EAK A;  1RM8 A;  1FM1 A;  1YQY A;  2OVZ A;  4G0D A;  3LIK A;  3HDA P;  1G4K A;  830C A;  4PKQ A;  4ILW D;  2KRJ A;  1KUG A;  3LIR A;  1Y0V A;  5I0L A;  2ERO A;  1BIW A;  4XBH A;  1JK3 A;  4BOL A;  1KAP P;  1HFC A;  3EHX A;  1SMP A;  3U1R A;  1IAE A;  1DTH A;  3I7G A;  3LQ0 A;  1MMB A;  3KRY A;  4HMA A;  3EDG A;  2USN A;  1PDC A;  3LE9 A;  2D1O A;  5BOT A;  2YB9 A;  1QUA A;  1Y93 A;  3DSL A;  4DPE A;  2OW1 A;  1QJI A;  1CAQ A;  2MZH A;  2W15 A;  1UMS A;  1D8F A;  1SLM A;  1ATL A;  3UVC A;  4CTH A;  1ND1 A;  5I3M A;  1JJ9 A;  1CXV A;  1H8P A;  1C8T A;  4BXD A;  2K2G A;  1SU3 A;  4WK7 A;  4A3W A;  3EDI A;  2MLR A;  1KUI A;  1O0T A;  1BKC I;  1R1H A;  3L0T A;  3TSK A;  2W12 A;  2XS4 A;  1QIB A;  3LUM A;  1Q3A A;  1BKC A;  1BSW A;  2DW0 A;  3OHL A;  3TS4 A;  3Q2H A;  4BJ4 A;  1HY7 A;  5I12 A;  1PWU A;  1KS0 A;  3TVC A;  1USN A;  3EDZ A;  1QIC A;  3F19 A;  1OM7 A;  1XFZ A;  3HBV P;  2QPJ A;  1PWV A;  3RTS A;  2WO9 A;  5B5P A;  4IUW A;  1L6J A;  3NX7 A;  3M7P A;  2X3A A;  1HV5 A;  1O0Q A;  2YIG A;  3LJT A;  1IAD A;  5I43 A;  1QIA A;  1ZP5 A;  1B8Y A;  4XM7 A;  1CGL A;  1UTT A;  1EUB A;  1A85 A;  2OW2 A;  3F15 A;  3TT4 A;  1H71 P;  5BOY A;  1DMT A;  1AF0 A;  4L19 A;  3SHI A;  5D1U A;  3F18 A;  3F16 A;  5CUH A;  4GR0 A;  1J7N A;  2AYK A;  1K7I A;  3BA0 A;  3KEK A;  1ZXV A;  2SRT A;  4H49 A;  4BXJ A;  1CGE A;  4XM8 A;  1ROS A;  1UEA A;  2POJ A;  2L0R A;  2OXU A;  1R1J A;  3KEC A;  4AUO A;  4WKI A;  2OW0 A;  5D2B A;  1D7X A;  3KMC A;  1IAG A;  1K7Q A;  1BZS A;  2O36 A;  3VTG A;  2OXZ A;  1RMZ A;  2OI0 A;  1KUK A;  1YP1 A;  4G54 A;  2X3B A;  2XS3 A;  1FLS A;  3DPE A;  1UMT A;  3RTT A;  1HOV A;  1JAN A;  1G9K A;  2AIG P;  3O64 A;  1XUC A;  1GKC A;  1GE5 A;  3E8R A;  2BH7 A;  3DL1 A;  2DW2 A;  1IAA A;  3G42 A;  4H3X A;  3BKH A;  4H84 A;  2W0D A;  4DF9 A;  5D7W A;  3EWJ A;  2N8R A;  2E2D A;  3LMC A;  4I35 A;  3VI1 A;  1PWW A;  3LQB A;  1OMJ A;  2JIH A;  1AST A;  3KEJ A;  1G49 A;  5H8X A;  3Q2G A;  2X3C A;  4GR3 A;  4XM6 A;  5BPA A;  1D5J A;  1CGF A;  4H2E A;  1B3D A;  3DWB A;  1R1I A;  4AYK A;  4PKW A;  3KHI A;  3LUN A;  2MZI A;  3I7I A;  2OXW A;  1OM8 A;  5D3C A;  1MNC A;  4AIG A;  2OVX A;  1JAO A;  1WNI A;  2JSD A;  4PKT A;  3EDH A;  3WV3 A;  3ZUK A;  3LKA A;  2OZR A;  3K7L A;  1SAT A;  1YCM A;  2FV9 A;  3ZXH A;  2V5O A;  4JP4 A;  2I47 A;  3HBU P;  3CKI A;  1PWP A;  1XUR A;  1ZVX A;  1BUV M;  2A8H A;  4H1Q A;  3B92 A;  3HDB A;  2J0T A;  4ON1 A;  1I76 A;  4H82 A;  4JIJ A;  1YOU A;  4EFS A;  1J7M A;  3G5C A;  1A86 A;  2MZE A;  1KUF A;  1I73 A;  2MLS A;  2X7M A;  1AYK A;  1JKY A;  4LPQ A;  1E88 A;  3F17 A;  2OY4 A;  4FXY P;  3AIG A;  3AYK A;  4H76 A;  1BQO A;  1ZXC A;  2E3X A;  1XUD A;  3GBO A;  3D2Z A;  1HTD A;  1XFU A;  3LJG A;  5LAB A;  4L6T A;  1CXW A;  1OS2 A;  2J83 A;  1ZS0 A; 
#chains in the Genus database with same CATH topology
 966C A;  3WV1 A;  2ERQ A;  5JMY A;  4IBK A;  2K9C A;  4NZ3 A;  4IN9 A;  1GXD A;  1MMR A;  3N3F A;  1GO8 P;  4H30 A;  3WD0 A;  4PKV A;  3BKV A;  4Z2G A;  5I4O A;  4WF6 A;  3DNG A;  3KS8 A;  2Y2M A;  2CKI A;  2JT5 A;  1GE6 A;  1JAP A;  4L63 A;  1CQR A;  4DD8 A;  3K7N A;  2OW9 A;  1GE7 A;  4JQG A;  4ZR5 A;  2JT6 A;  4BPA A;  3L28 A;  3HON A;  2JE5 A;  1TVI A;  1CK7 A;  456C A;  4A7B A;  2OY2 A;  3L29 A;  4AXQ A;  1IAB A;  2DDF A;  4I03 A;  4Z2I A;  4OJ6 A;  2Y6D A;  1LBU A;  2RJQ A;  3USN A;  1I1I P;  1GO7 P;  1Y8J A;  3O2X A;  2WOA A;  2PJT A;  1OO9 A;  4PKU A;  4QKZ A;  3LEA A;  1C3I A;  1SLN A;  1D8M A;  3KME A;  4DV8 A;  4Z2K A;  4WKE A;  3EHY A;  1E8B A;  1G12 A;  3F1A A;  1JH1 A;  1KBC A;  1MMQ A;  4G9L A;  2CLT A;  1CIZ A;  3B8Z A;  3DPF A;  3KWV C;  3HYG A;  4XCT A;  5D1T A;  2FN2 A;  4Q1L A;  1Z3J A;  2BG1 A;  1YU4 A;  4JA1 A;  1JAQ A;  4GWN A;  4FVL A;  1MMP A;  1JIZ A;  3L27 A;  1UTZ A;  4IJO A;  5B5O A;  1QO6 A;  2ERP A;  1E6N A;  3LK8 A;  3HY9 A;  1GKD A;  3N2V A;  1BM6 A;  2W13 A;  3LIL A;  3LGP A;  3P24 A;  1XM5 A;  1EB6 A;  1PWQ A;  4MB5 A;  5L7F A;  3P1V A;  4R3V A;  3MQL A;  2TCL A;  3WX7 A;  1R55 A;  1UR9 A;  1JIW P;  3ELM A;  2Y2L A;  4HMC A;  1XAX A;  3LJZ A;  5CXA A;  3N2U A;  4BXE A;  5L79 A;  1ZTQ A;  2DDY A;  4MB4 A;  1SRP A;  4GWM A;  3OHO A;  4GUY A;  2D1N A;  1BKC E;  3FKE A;  1S4B P;  3D2Y A;  3L25 A;  5CZM A;  1BQQ M;  1E6P A;  2O3E A;  1XFV A;  2WKX A;  4GR8 A;  2V4B A;  4Z2L A;  2JNP A;  4J4M A;  1XFY A;  1GOI A;  3WD2 A;  2Y6C A;  1G05 A;  5I2Z A;  4FXQ A;  1HFS A;  4PKR A;  4IBD A;  1OS9 A;  1AKL A;  4FU4 A;  2WO8 A;  1YUE A;  4OJL A;  1XFX A;  1OM6 A;  3ZVS A;  1FBL A;  1E6Z A;  3V96 B;  1KUH A;  1OZ9 A;  3MA2 A;  5BPV A;  3HB2 P;  1K7G A;  1QJJ A;  2FV5 A;  3L0V A;  5D1S A;  3B2Z A;  4GQL A;  4NYU A;  4GF1 A;  3HSH A;  2Z2D A;  1IAC A;  2W14 A;  1XFW A;  3AYU A;  2RJP A;  4IBJ A;  1H0G A;  1BUD A;  3HY7 A;  4IBE A;  3WV2 A;  4LG2 A;  2DW1 A;  4NY2 A;  2D49 A;  2HU6 A;  1YU1 A;  1C7K A;  4WZV A;  1R54 A;  4JPA A;  4HX3 A;  4PKS A;  1EAK A;  1RM8 A;  1FM1 A;  1YQY A;  4IBF A;  2OVZ A;  4G0D A;  3LIK A;  3HDA P;  1G4K A;  830C A;  4PKQ A;  4ILW D;  2KRJ A;  1KUG A;  3L26 A;  3LIR A;  1Y0V A;  5I0L A;  2ERO A;  1BIW A;  4XBH A;  1JK3 A;  1W1T A;  4BOL A;  1KAP P;  4HME A;  1HFC A;  3EHX A;  4OJO A;  1SMP A;  4IBC A;  3U1R A;  1IAE A;  1DTH A;  3I7G A;  3LQ0 A;  4OJ5 A;  1MMB A;  3KRY A;  2Y2O A;  4HMA A;  3EDG A;  2USN A;  2IOU A;  1PDC A;  1YU3 A;  3LE9 A;  2D1O A;  5BOT A;  1W1P A;  2YB9 A;  1QUA A;  1Y93 A;  3DSL A;  4DPE A;  2OW1 A;  1QJI A;  1CAQ A;  2MZH A;  1E15 A;  2W15 A;  1UMS A;  1D8F A;  1SLM A;  1ATL A;  3UVC A;  4CTH A;  1ND1 A;  5I3M A;  1JJ9 A;  4NYY A;  1CXV A;  3KS4 A;  1H8P A;  1C8T A;  3DTI A;  4BXD A;  4TX8 A;  4L7A A;  2K2G A;  1SU3 A;  4Z2J A;  4WK7 A;  4A3W A;  1OGB A;  3DTK A;  3EDI A;  2MLR A;  1KUI A;  1O0T A;  1BKC I;  1R1H A;  3L0T A;  3TSK A;  4NZ5 A;  2W12 A;  2XS4 A;  1QIB A;  3LUM A;  1Q3A A;  1BKC A;  1BSW A;  2DW0 A;  3OHL A;  3TS4 A;  3Q2H A;  4BJ4 A;  1HY7 A;  5I12 A;  1PWU A;  4OUI A;  1KS0 A;  3TVC A;  1USN A;  3EDZ A;  4NZ1 A;  1QIC A;  3F19 A;  1OM7 A;  1XFZ A;  2JCH A;  3HBV P;  2QPJ A;  1PWV A;  3RTS A;  2WO9 A;  5B5P A;  4IUW A;  1L6J A;  3NX7 A;  3M7P A;  2X3A A;  1HV5 A;  1O0Q A;  2YIG A;  3LJT A;  1IAD A;  5I43 A;  3WD3 A;  1QIA A;  4OJP A;  1B8Y A;  1ZP5 A;  4XM7 A;  1CGL A;  1UTT A;  1EUB A;  1A85 A;  1W1Y A;  2OW2 A;  3F15 A;  3TT4 A;  1H71 P;  5BOY A;  1DMT A;  1AF0 A;  4L19 A;  3SHI A;  5D1U A;  2Y2I A;  2Y2H A;  3F18 A;  3F16 A;  4GHL A;  5CUH A;  4GR0 A;  1J7N A;  1UR8 A;  2AYK A;  1K7I A;  3BA0 A;  3KEK A;  1ZXV A;  2SRT A;  4H49 A;  4BXJ A;  4IBI A;  1CGE A;  4XM8 A;  1ROS A;  1UEA A;  2POJ A;  2L0R A;  2OXU A;  1R1J A;  3WD4 A;  3KEC A;  4AUO A;  4WKI A;  2OW0 A;  4HMD A;  5D2B A;  1D7X A;  3KMC A;  1IAG A;  1K7Q A;  1BZS A;  2O36 A;  1E6R A;  4NZ4 A;  3VTG A;  2YUF A;  2OXZ A;  2Y2K A;  1RMZ A;  2OI0 A;  1KUK A;  1YP1 A;  4G54 A;  2X3B A;  2XS3 A;  2Y2G A;  1FLS A;  4GH9 A;  3DPE A;  1UMT A;  3RTT A;  1HOV A;  1O6I A;  1JAN A;  1G9K A;  2AIG P;  3O64 A;  1XUC A;  1GKC A;  1GE5 A;  3E8R A;  4QNL A;  2BH7 A;  3DL1 A;  2DW2 A;  1IAA A;  3G42 A;  4H3X A;  3BKH A;  4H84 A;  2W0D A;  4DF9 A;  2Y2P A;  5D7W A;  3EWJ A;  3DTE A;  4IJE A;  2N8R A;  4GHA A;  2E2D A;  3LMC A;  4I35 A;  3VI1 A;  1H0I A;  1PWW A;  3LQB A;  1YU0 A;  1OMJ A;  2JIH A;  3L2A A;  1AST A;  3KEJ A;  1G49 A;  5H8X A;  3Q2G A;  2X3C A;  4GR3 A;  4XM6 A;  3WD1 A;  5BPA A;  1D5J A;  1CGF A;  4H2E A;  2Y2J A;  1B3D A;  2Y2Q A;  3DWB A;  1R1I A;  4AYK A;  4PKW A;  3KHI A;  3LUN A;  1W1V A;  2MZI A;  4IBB A;  3I7I A;  2OXW A;  1OM8 A;  5D3C A;  1MNC A;  2FFF B;  4AIG A;  2OVX A;  1JAO A;  1WNI A;  2JSD A;  4PKT A;  3EDH A;  4IBG A;  3WV3 A;  3ZUK A;  3LKA A;  2OZR A;  3K7L A;  1SAT A;  1YCM A;  2FV9 A;  3ZXH A;  2V5O A;  2RTS A;  4JP4 A;  2I47 A;  3HBU P;  3CKI A;  1PWP A;  1XUR A;  1ZVX A;  2UWX A;  1BUV M;  2A8H A;  4H1Q A;  3B92 A;  1YU2 A;  3HDB A;  2J0T A;  2Y2N A;  4ON1 A;  2XD1 A;  1I76 A;  4H82 A;  4JIJ A;  1YOU A;  4EFS A;  1J7M A;  3G5C A;  1GPF A;  1A86 A;  1AIW A;  2MZE A;  1KUF A;  1I73 A;  2XD5 A;  2MLS A;  2X7M A;  1AYK A;  4IJF A;  1JKY A;  1ED7 A;  4LPQ A;  1E88 A;  3F17 A;  4Z2H A;  2OY4 A;  4FXY P;  3AIG A;  3AYK A;  4H76 A;  1BQO A;  1ZXC A;  2E3X A;  1XUD A;  3GBO A;  3D2Z A;  1HTD A;  1XFU A;  3LJG A;  5LAB A;  4L6T A;  4MB3 A;  1CXW A;  1OS2 A;  2J83 A;  1ZS0 A;  1OGG A; 
#chains in the Genus database with same CATH homology
 966C A;  3WV1 A;  2ERQ A;  5JMY A;  2K9C A;  4IN9 A;  1GXD A;  1MMR A;  1GO8 P;  4H30 A;  4PKV A;  3BKV A;  5I4O A;  4WF6 A;  3DNG A;  2CKI A;  2JT5 A;  1GE6 A;  1JAP A;  4L63 A;  1CQR A;  4DD8 A;  3K7N A;  2OW9 A;  1GE7 A;  4JQG A;  4ZR5 A;  2JT6 A;  4BPA A;  1CK7 A;  456C A;  4A7B A;  2OY2 A;  4AXQ A;  1IAB A;  2DDF A;  4I03 A;  2Y6D A;  1LBU A;  2RJQ A;  3USN A;  1I1I P;  1GO7 P;  1Y8J A;  3O2X A;  2WOA A;  2PJT A;  1OO9 A;  4PKU A;  4QKZ A;  3LEA A;  1C3I A;  1SLN A;  1D8M A;  3KME A;  4DV8 A;  4WKE A;  3EHY A;  1E8B A;  1G12 A;  3F1A A;  1JH1 A;  1KBC A;  1MMQ A;  4G9L A;  2CLT A;  1CIZ A;  3B8Z A;  3DPF A;  3KWV C;  3HYG A;  4XCT A;  5D1T A;  2FN2 A;  4Q1L A;  1Z3J A;  4JA1 A;  1JAQ A;  4GWN A;  4FVL A;  1MMP A;  1JIZ A;  1UTZ A;  4IJO A;  5B5O A;  1QO6 A;  2ERP A;  3LK8 A;  3HY9 A;  1GKD A;  3N2V A;  1BM6 A;  2W13 A;  3LIL A;  3LGP A;  3P24 A;  1EB6 A;  1PWQ A;  5L7F A;  3P1V A;  4R3V A;  3MQL A;  2TCL A;  1R55 A;  1JIW P;  3ELM A;  3LJZ A;  5CXA A;  3N2U A;  4BXE A;  5L79 A;  1ZTQ A;  2DDY A;  1SRP A;  4GWM A;  3OHO A;  4GUY A;  2D1N A;  1BKC E;  1S4B P;  3D2Y A;  5CZM A;  1BQQ M;  2O3E A;  1XFV A;  2WKX A;  4GR8 A;  2V4B A;  4J4M A;  2JNP A;  1XFY A;  2Y6C A;  5I2Z A;  1G05 A;  4FXQ A;  1HFS A;  4PKR A;  1OS9 A;  1AKL A;  4FU4 A;  2WO8 A;  1XFX A;  1OM6 A;  3ZVS A;  1FBL A;  3V96 B;  1KUH A;  3MA2 A;  3HB2 P;  1K7G A;  1QJJ A;  2FV5 A;  3L0V A;  5D1S A;  3B2Z A;  4GQL A;  4GF1 A;  2Z2D A;  1IAC A;  2W14 A;  1XFW A;  3AYU A;  2RJP A;  1BUD A;  3HY7 A;  3WV2 A;  2DW1 A;  2HU6 A;  1C7K A;  4WZV A;  1R54 A;  4JPA A;  4HX3 A;  4PKS A;  1EAK A;  1RM8 A;  1FM1 A;  1YQY A;  2OVZ A;  4G0D A;  3LIK A;  3HDA P;  1G4K A;  830C A;  4PKQ A;  4ILW D;  2KRJ A;  1KUG A;  3LIR A;  1Y0V A;  5I0L A;  2ERO A;  1BIW A;  4XBH A;  1JK3 A;  4BOL A;  1KAP P;  1HFC A;  3EHX A;  1SMP A;  3U1R A;  1IAE A;  1DTH A;  3I7G A;  3LQ0 A;  1MMB A;  3KRY A;  4HMA A;  3EDG A;  2USN A;  1PDC A;  3LE9 A;  2D1O A;  5BOT A;  2YB9 A;  1QUA A;  1Y93 A;  3DSL A;  4DPE A;  2OW1 A;  1QJI A;  1CAQ A;  2MZH A;  2W15 A;  1UMS A;  1D8F A;  1SLM A;  1ATL A;  3UVC A;  4CTH A;  1ND1 A;  5I3M A;  1JJ9 A;  1CXV A;  1H8P A;  1C8T A;  3DTI A;  4BXD A;  4L7A A;  2K2G A;  1SU3 A;  4WK7 A;  4A3W A;  3DTK A;  3EDI A;  2MLR A;  1KUI A;  1O0T A;  1BKC I;  1R1H A;  3L0T A;  3TSK A;  2W12 A;  2XS4 A;  1QIB A;  3LUM A;  1Q3A A;  1BKC A;  1BSW A;  2DW0 A;  3OHL A;  3TS4 A;  3Q2H A;  4BJ4 A;  1HY7 A;  5I12 A;  1PWU A;  1KS0 A;  3TVC A;  1USN A;  3EDZ A;  1QIC A;  3F19 A;  1OM7 A;  1XFZ A;  3HBV P;  2QPJ A;  1PWV A;  3RTS A;  2WO9 A;  5B5P A;  4IUW A;  1L6J A;  3NX7 A;  3M7P A;  2X3A A;  1HV5 A;  1O0Q A;  2YIG A;  3LJT A;  1IAD A;  5I43 A;  1QIA A;  1ZP5 A;  1B8Y A;  4XM7 A;  1CGL A;  1UTT A;  1EUB A;  1A85 A;  2OW2 A;  3F15 A;  3TT4 A;  1H71 P;  5BOY A;  1DMT A;  1AF0 A;  4L19 A;  3SHI A;  5D1U A;  3F18 A;  3F16 A;  5CUH A;  4GR0 A;  1J7N A;  2AYK A;  1K7I A;  3BA0 A;  3KEK A;  1ZXV A;  2SRT A;  4H49 A;  4BXJ A;  1CGE A;  4XM8 A;  1ROS A;  1UEA A;  2POJ A;  2L0R A;  2OXU A;  1R1J A;  3KEC A;  4AUO A;  4WKI A;  2OW0 A;  5D2B A;  1D7X A;  3KMC A;  1IAG A;  1K7Q A;  1BZS A;  2O36 A;  3VTG A;  2YUF A;  2OXZ A;  1RMZ A;  2OI0 A;  1KUK A;  1YP1 A;  4G54 A;  2X3B A;  2XS3 A;  1FLS A;  3DPE A;  1UMT A;  3RTT A;  1HOV A;  1JAN A;  1G9K A;  2AIG P;  3O64 A;  1XUC A;  1GKC A;  1GE5 A;  3E8R A;  2BH7 A;  3DL1 A;  2DW2 A;  1IAA A;  3G42 A;  4H3X A;  3BKH A;  4H84 A;  2W0D A;  4DF9 A;  5D7W A;  3EWJ A;  3DTE A;  2N8R A;  2E2D A;  3LMC A;  4I35 A;  3VI1 A;  1PWW A;  3LQB A;  1OMJ A;  2JIH A;  1AST A;  3KEJ A;  1G49 A;  5H8X A;  3Q2G A;  2X3C A;  4GR3 A;  4XM6 A;  5BPA A;  1D5J A;  1CGF A;  4H2E A;  1B3D A;  3DWB A;  1R1I A;  4AYK A;  4PKW A;  3KHI A;  3LUN A;  2MZI A;  3I7I A;  2OXW A;  1OM8 A;  5D3C A;  1MNC A;  4AIG A;  2OVX A;  1JAO A;  1WNI A;  2JSD A;  4PKT A;  3EDH A;  3WV3 A;  3ZUK A;  3LKA A;  2OZR A;  3K7L A;  1SAT A;  1YCM A;  2FV9 A;  3ZXH A;  2V5O A;  4JP4 A;  2I47 A;  3HBU P;  3CKI A;  1PWP A;  1XUR A;  1ZVX A;  1BUV M;  2A8H A;  4H1Q A;  3B92 A;  3HDB A;  2J0T A;  4ON1 A;  1I76 A;  4H82 A;  4JIJ A;  1YOU A;  4EFS A;  1J7M A;  3G5C A;  1A86 A;  2MZE A;  1KUF A;  1I73 A;  2MLS A;  2X7M A;  1AYK A;  1JKY A;  4LPQ A;  1E88 A;  3F17 A;  2OY4 A;  4FXY P;  3AIG A;  3AYK A;  4H76 A;  1BQO A;  1ZXC A;  2E3X A;  1XUD A;  3GBO A;  3D2Z A;  1HTD A;  1XFU A;  3LJG A;  5LAB A;  4L6T A;  1CXW A;  1OS2 A;  2J83 A;  1ZS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...