3WX7A

Crystal structure of cod
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
402
Chain Sequence
TKGTIYLTFDDGPINASIDVINVLNQEEVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVANHSYDHMVHNCVEEFGPNSAAECNATGDHQINSYQDPAYDASMFAENLSVLEKYLPNITSYPNYKANEFARLPYTNGWRVTKDFKADGLCATSDDLKPWEPGYACDTANPSNSVKAAIAVQNILANNGYQTHGWDVDWAPENWGIAMPANSLTEAEPFLGYVDSALNTCAPTTINPINSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATQNLPKLTKFIQLAKQAGYVFDTMDNYTPNWQVGNNYSAGDYVLHLGTVYQAVTSHTAQQDWAPSPTSSLWTNADPATNWTQNVSYKQGDVVTYQGLRYLVNVPHVSQADWSPSSQNTLFTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitin oligosaccharide deacetylase
publication title Structure-based analysis of domain function of chitin oligosaccharide deacetylase from Vibrio parahaemolyticus.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
total genus 143
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3wx7A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3wx7A01
3HFTA 3WX7A 2C71A 2I5IA 2NLYA 1W1A1 2QV5A 3RXZA 2XU2A 1W17A 4F9DA 1XW8A 1W1B1 4NY2A 4NZ3A 1V6TA 2DFAA 3CL7A 2E67A 4L1GA 2Y8UA 4LY4A 2C1IA 4NYYA 2C1GA 2CC0A 2VYOA 4OUIA 2C79A 2IW0A 4U10A 2J13A 4M1BA 3CL8A 1NY1A 3CL6A 5JMUA 3QBUA 4NZ5A 4NYUA 4WCJA 1Z7AA 4V33A 3VUSA 4HD5A 3S6OA 4NZ1A 4NZ4A 4F9JA 2W3ZA 5BU6A
chains in the Genus database with same CATH superfamily
1P0KA 3B06A 3SJ3A 4Q4PA 4RDZA 3MUAA 4DF0A 3OG2A 3QC0A 1U22A 5CGTA 5FACA 1XBVA 1O7AA 1XBXA 3UZJA 2XD1A 1T5AA 3KRZA 3LHTA 1HUVA 3IANA 3OJGA 2FHBA 3WFLA 1OWQA 1XISA 2QJJA 3ZSTA 3R8HA 3NQDA 1L2QA 4H6KA 1GVSA 1HO4A 3EMCA 3GDBA 2EPOA 1HZYA 4C6QA 3RMEA 3GUWA 2BMBA 1R30A 3CWNA 3ZS4A 4CEUC 2WJFA 1ZGDA 3RUBL 3M0JA 2O9RA 1V3MA 5I0DA 4X0VA 3P93A 4XSMA 4TX9A 2PCQA 2PDWA 1XFBA 3OIHA 4WY0B 2UY3A 4JHZA 2XISA 2PDFA 1R9XA 1LG1A 4DI8A 2PDNA 3R6IA 2QCEA 3A4XA 1J0HA 5CSYA 4P7OA 4L9YA 3OHMB 3SM0A 2WQDA 3QSTA 3QHMA 1DJQA 3CZJA 1K02A 2A79A 3MWCA 2PSNA 2Q02A 3W1XA 1HJSA 1RV8A 4A3RA 3OBEA 5MF5A 1MEHA 4LCQA 2G37A 3BAYA 4IQJA 3G1DA 2RTSA 3AYSA 2X42A 2Z6IA 1ZY9A 3N2OA 2GGGA 3STEA 4J2PA 4Q8TA 3N6HA 3QOKA 2ZX5A 2FQIA 2X2GA 1H50A 3KBSA 1T6MA 1X8CA 2ACRA 5I3DA 4D72A 5I23A 1RALA 5A2CA 3W2NA 1G67A 3WY1A 4GY1A 3MZNA 1TG7A 5A6AA 1YNPA 4QDWA 5KMYA 1SMAA 1R8LA 1V0NA 4N6EA 1HKWA 3L2MA 2DQWA 4AU0A 3A5VA 2YFNA 3PBMA 1PTAA 4N9DA 2R94A 2CLPA 3IJ6A 1KA9F 4GISA 4AF0A 2A4AA 3LHVA 3OZPA 4N02A 3WNOA 2C14A 2QDGA 2BHZA 1VHCA 2J7EA 5AZ0A 4L4MA 4HHMA 3LLXA 3UU0A 4NYYA 3PZGA 2IQTA 4ILSA 1CYGA 2ZZ4A 2REQB 3L21A 1KM0A 3UBPC 1S5TA 1LCOA 2BHYA 5AYXA 4QNLA 2VC9A 6ENLA 4JFTA 5FEXA 3TX9A 2WCGA 2XTKA 3CV1A 3GZAA 2ZXQA 4ADSA 4JY9A 2DDXA 3LV5A 3TJXA 4A3QA 5BZAA 1KRCC 2P88A 5G4EA 4CN4A 5MKGA 4QM1A 5C2XA 4CCDA 2VR4A 4U2YA 4WJ8A 5TF0A 1D8WA 2AAAA 3FHAA 3KLKA 2XZ7A 1B0IA 2WSRA 2WKGA 3QHOA 4JKKA 4DO7A 3NL6A 1H0GA 1E9IA 1UBSA 4OIFA 5C9RA 3M47A 4IBEA 4HSOA 3H70A 5FEWA 1IEXA 3CO8A 3R10A 2HK1A 3UY8A 2V5OA 1IEIA 3W7PA 3LENA 1K7FA 4MDPA 1Z6KA 1PTGA 3IVUA 1GVRA 2C6QA 4IQDA 5AHNA 3W37A 4OTKA 3THCA 4AIUA 2GOUA 3T4WA 5I00A 4ZOEA 3ZT6A 2R1MA 3VGHA 4CNPA 4ZQMA 2FZMA 4XUYA 2NSOA 1UD6A 3WL0A 1D8CA 1HX0A 3HQ1A 4U3AA 1UIPA 4C1NA 3WLNA 3P7YA 5H8PA 1NOWA 4J1OA 4AD5A 3GWQA 3PPCA 1ADSA 1O66A 4Q22A 4UQ9A 3MCMA 2VC6A 3PZQA 2VRJA 3DGRA 3AIEA 4XG1A 2Z1BA 4G7EB 2AQWA 2ZRXA 3AIVA 4ZTYA 2O55A 2QDHA 4S39A 1F6PA 3RLHA 2P0IA 1PZ1A 4MMWA 3A4WA 1NVMA 3FGCA 5HQEA 1H09A 3NZGA 2WNQA 2WZHA 2HBXA 4OHQA 2PDXA 3NQBA 1DWJM 2W92A 1XLEA 1GW9A 1BLIA 1HL8A 1EFZA 4B5NA 3LCLA 5IBXC 4GIEA 4MB5A 1NH6A 1CI1A 1V3KA 2GGJA 4Z2HA 1JXKA 1P7TA 1M7OA 3BG9A 3UF9A 5HMSA 1VIWA 1Y7VA 3W83A 1FP8A 2H3BA 2D73A 1A0EA 1M03A 3G1SA 1JJKA 4AXKA 2NQ9A 2IW0A 3WCZA 2VCCA 2A3AA 1LL6A 3C2OA 1WE5A 3VKKA 1K8CA 1M6JA 2WJDA 3H55A 3GXNA 2QCDB 2R14A 1FCQA 4DQWA 4HGXA 2O7SA 2XJ7A 2DIJA 4CD4A 1LDCA 5IM51 2PFHA 1QHZA 1Z32X 1A5BA 4FAMA 3T40A 3CGTA 1WB0A 3FVMA 3T08A 5A2BA 5FF7A 4B16A 1MW2A 4K36A 1MXDA 4ZB2A 4I6KA 4XVDA 3OGRA 1SZEA 4XAZA 3MP5A 3OYXA 4H04A 2NV9A 3BLKA 1PIFA 3LV6A 1GT8A 4JYFA 1TJ2A 4GIYA 3MC5A 3GNNA 1H3GA 1KXQA 1ZU8A 3FXYA 3SQMA 1M7XA 1TZ9A 2D23A 3FJNA 3IJLA 3QY6A 3UXAA 1ZALA 2F9RA 1HL2A 3SECA 5CPQA 2WLZA 4J3SA 4F9DA 4UNIA 2QJNA 1RLCL 3PZUA 3PB2A 3PS7A 2Y6ZA 3GDLA 3USBA 1OK4A 1Q6EA 3B8IA 3KCOA 4HA0A 1QPQA 1CB7B 3GE7A 4MZ8A 3OW1A 2X40A 1LL7A 1GTHA 1N82A 3M0KA 5GVJA 3WF3A 2J74A 1LP6A 1EL3A 2DW7A 3VO0A 4O1EA 1X6NA 1SW3A 4DF1A 5F1VA 3WLPA 3NL2A 1BWLA 4E0CA 5E93A 1T99A 1QVBA 3THDA 5AB3A 3WLKX 2JE8A 4IG2A 3ECQA 1GVYA 1GORA 2PLCA 3O06A 5CKSA 4O12A 3W84A 3ZWTA 4C6LA 2Z2UA 3HGSA 1UJQA 3NDYA 1NWSA 3TW6A 3U4FA 1XUUA 3RDKA 2VYOA 1YX1A 3OEXA 3G0SA 4QSFA 3G5EA 5D9NA 4H9VA 1R85A 1EJSC 5J8LA 1J7MA 4K8HA 5A2AA 3VM7A 2G3FA 2WMGA 1AL7A 3K8KA 1WCGA 3DYOA 4P7RA 3SGZA 2ZRZA 4IQEA 4G56A 2HEJA 2ZZ5A 3SCOA 4GXPA 4PMRA 1R3YA 3TFCA 1ELSA 3ITGA 5AKQA 1ZUAX 1MNSA 1LT7A 1CBGA 1NP2A 4JQ3A 4GFIA 4CGTA 4K37A 2OWWA 3VDBA 2FJUB 1UKPA 3ATZA 4PMVA 3DBNA 4M51A 4YTSA 3R89A 1UOKA 2VRQA 3L4XA 2QMJA 1I0DA 5JIPA 1WPCA 1UA3A 3SRKA 2XN0A 3E49A 1H1NA 1H41A 4ZQOA 4EAYA 4UXDA 5FJJA 4IJFA 4XBSA 3MUIA 3MUZ1 3KM8A 1AW5A 1FFRA 1VEMA 3W7GA 4IJBA 1JDDA 3AHTA 4MADA 4LV9A 4ALDA 1V4YA 3KAOA 3T44A 5GQBA 3HSHA 4IMDA 5F4WA 4RW3A 4KF1A 2PDUA 3ARWA 2PRHA 1CXKA 1LQAA 4HYVA 3FDGA 3WLJA 2WANA 5DT7A 4IBBA 4IPLA 2OOGA 4UTUA 1T8QA 1X39A 5D9PA 3P62A 4AH7A 4JL2A 1MDRA 4GPNA 2CWXA 4NP7A 4WGHA 5FI8A 3NPWA 1JIBA 4LEFA 3KW3A 1RCQA 2VFEA 3B0VC 1EJRC 2VGIA 1TJ1A 1KLYA 1UP0A 1UUOA 1TPDA 2BY1A 4GG9A 3TC3A 2PWDA 1DJYA 7XIMA 5KZEA 1XIEA 1HXJA 4UFMA 3RU6A 3PSWA 2DV0A 1OYAA 2QUUA 3N19B 2OYLA 2YDQA 1F3WA 1RVGA 3JS3A 1C8XA 2ATSA 1W8GA 1J8VA 4HNNA 3SN4A 3HMCA 5LXEA 1LBMA 5H91A 2YB4A 4JTUA 4E6MA 5KITA 2CFFA 1BHGA 3KOYA 3ZVHA 1J0JA 2B0MA 4WX2A 4L4LA 3WDHA 2DZUA 5T91A 1R47A 1KBLA 1EBHA 4XZWA 1W1ZA 3TQVA 3VZXA 3PN8A 9XIMA 4Q7IA 1J18A 4HIBA 3OLGA 1Z42A 2INZA 3DKLA 1FH7A 3PVFA 4DEFA 4B3LA 2ACSA 4YYCA 3LXAA 4OU1A 1F7BA 1W2PA 1CDGA 4AF0B 5REQA 1GZ1A 1Z7AA 1VC4A 2WHMA 5FEPA 4XQ6A 1GHSA 2Z1VA 2X1TA 3A4AA 1E71M 4Y2WA 3VINA 4MNMA 1VQTA 2QCLA 2QNEA 1VHNA 1Q6OA 3UJRA 2E77A 1KCKA 3BW2A 2XH0A 2F6XA 5DCBA 3VNIA 4AYSA 3QR1A 3GB6A 1FWBC 1OX6A 4R3UA 3KE0A 3U7VA 3W7OA 5MKGB 4LRTA 2ZXDA 3TQ0A 3VFLA 1SJCA 5D8WA 4WXYA 1TUXA 1XIFA 2GWGA 5AYYA 1RAKA 1MUCA 1U33A 1Q6RA 3Q65A 1Q66A 3DUGA 4RV8A 4QROA 3F2DA 3E2VA 1M3UA 1PDZA 1KTBA 3EX3A 4WRHA 4EX4A 5T8GA 1ZLPA 3ZJ7A 2OWCA 4L5ZA 3VD5A 5HK4A 2O4QA 2CWNA 3SI9A 3FHQA 5AC7A 4ZODA 1EPXA 1EB3A 3N9KA 1EP1A 2CLFA 4JTTA 4N4PA 3ES7A 3O6DA 2ONEA 4JTDA 4GK8A 3VIIA 3BSMA 5HWJA 2Y2HA 4EANA 2WPBA 2YSWA 3PWGA 1BF6A 1J5TA 4W7VA 2OFJA 3FA5A 3BLFA 4PTDA 4JTCA 3VMOA 1XV8A 2A3HA 4OJLA 4QIUA 1KTCA 5HUOA 4PL1A 3W2KA 2OSWA 2HRWA 4ZE4A 5K9CA 3UA4A 4C1NB 4ADUA 4RR4A 3JW7A 1YTKA 5FKYA 3IS4A 3V3WA 1V77A 3VC6A 3BAIA 3WG6A 3OPSA 3SCTA 1DEDA 3E1F1 3A3HA 4LYRA 4FSAA 3ZOAA 5DANA 1E5JA 4AZCA 2GUYA 1T8XA 1JQVA 2OOFA 2XVLA 1MEWA 3OVRA 3TONA 1KXTA 3FGCB 4OBSA 1GYNA 3V36A 1XYAA 3PSVA 2B4GA 2ZBTA 4PEKA 1TTIA 5F4XA 1V5XA 3O05A 1YMYA 3L4VA 2DSVA 2PDHA 3URBA 5BXSA 3WH8A 1K6AA 1RY0A 5D38A 2F84A 1NU5A 2CPUA 2PBGA 1P7TB 3CWOX 5FA5A 2WW5A 5BXPA 5AC6A 4V15A 4WSKA 4IF2A 3DFHA 3RILA 2X1SA 5CGQA 1ZCOA 5ABHA 2RJGA 5EKYA 1Z41A 2YYTA 2BWGA 2YDRA 4KGLA 1WDSA 1UKTA 4FR6A 1AD4A 1LRQA 2J8TA 3WD0A 1Q45A 3KL0A 4HOXA 3VD7A 2H8ZA 3QR0A 5AYBA 3OB8A 3W1MA 4H9XA 3KUMA 4RLIA 1QO2A 1OFBA 5ABTA 5AC8A 2G8ZA 1S2TA 5H2ZA 4E2VA 3O2LA 2V5LA 3F4DA 3HJEA 1EWEA 1VCVA 4MYXA 3W7HA 1VBRA 4DWDA 5EPDA 4Z0SA 3M07A 3HURA 3WBXA 2DT3A 1YPIA 2PD9A 3RR1A 1GZJA 3N3MA 5M2FX 4W9TA 4M0XA 4IMEA 2D0GA 2R1PA 3BOFA 3S6OA 2YPIA 4ECLA 3SRHA 3QV9A 2ZRUA 3K1GA 3AMDA 2X41A 2E8ZA 4MLJA 3EMQA 4LS0A 2YW3A 3K2GA 4CQCA 3QHNA 3KBJA 3VOIA 4I9JA 1IEQA 3EBVA 2WKJA 4AIOA 2CLLA 1IXOA 2NLIA 3QXBA 3FJ4A 1PIGA 3MQTA 1KO0A 1PCWA 4GVGA 1K9EA 2AL2A 5I02A 5LNVA 4JAWA 3WEZA 2E6AA 4IG2B 3SCUA 3KDOA 3DHPA 4L80A 2OKOA 4JCMA 3RG6A 1JZ8A 1BTMA 5HNRA 3TWBA 2PMQA 4KFPA 3EWXA 2PUZA 4PUEA 1L6GA 2WMHA 4YVXA 4PE8A 3N29A 4N6FA 4ENLA 3U4AA 4I90A 2POZA 3VMNA 3TCEA 4IBJA 4GQ0A 5CPTA 2EHHA 3TWAA 3ALGA 2DJXA 2FMNA 4MB4A 3S5YA 5I3HA 1TE6A 2YGYA 2EPKX 2OGYA 3B9EA 1FVPA 2Z1XA 1WDPA 3SCVA 1B57A 4EE9A 1B9BA 1BWKA 4AMCA 3S47A 1FDYA 2WHKA 4MSSA 3ARZA 4UMAA 4FZIA 3REQA 1GNXA 2OB3A 1XLJA 5D2TA 2HJPA 3SN0A 1GVQA 7A3HA 3AZTA 3WEMA 4H9YA 2ZA3A 4MTVA 1JFHA 1GOXA 2I56A 1IIGA 2HVNA 3DFSA 1XLGA 5CPLA 2DIEA 3MW7A 1E9YB 1H7OA 1QU4A 3CUHA 4JHOA 3M7WA 4GUJA 2FZNA 3AS0A 3VFCA 4J27A 3CQIA 3RM8A 1H7NA 1KM1A 3GVVA 2Y4SA 3C0JA 7ENLA 3BLDA 2GLKA 2YCJA 5A6JA 1XCWA 2ON3A 3PZOA 4LAMA 1E8BA 2VT0A 1BQCA 3K46A 3VGDA 1Y5VA 1GQJA 1A5MC 4GGHA 5D05A 5A6MA 4FOKA 1SO3A 1OIMA 2BG1A 2GQAA 2RGMA 2IKHA 1PX3A 2XG9A 3S1GA 1J0ZA 3AU6A 1U2YA 4Q8NA 3CZ8A 4PSPA 4CU6A 4MKVA 3HTWA 1EO7A 4LAZA 1MWOA 2V81A 2BGNE 4UOJA 4B92A 1CNVA 4KCVA 4O53A 3LLFA 1X6UA 3N3TA 4MWAD 4XAGA 3BV4A 4FIRA 3ANUA 5FD0A 4AWSA 3GW3A 1SM9A 2JEPA 3LHZA 3WZ0E 1EF3A 1OG6A 4KFOA 1W8SA 3QQ0A 1FCVA 3N17A 3W4RA 3GYCA 4F0LA 5HMDA 3R7MA 1GJPA 2QV5A 2I57A 2WVVA 3G1FA 3PZTA 1AQFA 3MY9A 4AFYA 1VCGA 1O6IA 1AFSA 2XIQA 1DTNA 3VNJA 3ERPA 1JPDX 2R6OA 4K8EA 4H4IA 1PHWA 4DIAA 2OQHA 2VFGA 3C61A 5FEZA 4JTRA 3H12A 1UH3A 3DYPA 3S2MA 5E6YA 3BAJA 1PO9A 3HPFA 4M1RA 4Q8VA 1KLZA 3MYPA 4EP8C 3M0XA 2DT0A 3V0TA 2BTMA 3TMLA 1XKYA 4LF2A 4H9ZA 3WNKA 3L12A 3LA4A 1W32A 2YL8A 3UWWA 2DH2A 3L4TA 2GVJA 3FW6A 2VCBA 4HN8A 5REQB 2E5DA 4YIWA 1RY8A 5DT5A 2NWSA 3C8NA 3W7EA 2VD9A 2Y7GA 3B0YA 3KP0A 3SCRA 2D0HA 4MPQA 2A6NA 4RXGA 1KCXA 5CXPA 4FNQA 3FK4A 1P6BA 3SW6A 1JGIA 3QQWA 1VIZA 5LZLA 3LU2A 2E5BA 3VDCA 3MHGA 3H4WA 1UOZA 5E5CA 1OSEA 4XZ9A 1PWLA 3BZJA 5LHFA 3G2GA 3MO7A 4IUGA 3H2OA 4KEVA 4FLRA 4W87A 1E1FA 1V3JA 1FWFC 4X60A 1BRLA 1IZJA 2ZWZA 2J27A 1OCQA 4LAKA 1TO3A 2WCSA 1HW6A 4E8CA 3W7DA 3UJEA 2VELA 1WOBA 6PTDA 1T40A 2HZGA 1H49A 1N8FA 5E9AA 3W7IA 2VEGA 2JE5A 1R38A 4DF2A 4F0KA 2WAGA 2FH6A 2Y7DA 1B90A 1TR1A 3GD6A 1Q65A 4HSNA 2FHCA 2VGGA 4AQLA 1QXLA 1FWNA 1WDDA 2GJRA 2QUVA 1FFQA 1LWIA 1X8FA 5LA1A 2Y62A 2YXXA 1RD6A 1DIOA 3VCRA 3HA1A 4M1BA 1DWHM 4LF1A 2Q8XA 5C7HA 4O10A 3MJYA 4JY8A 1DBTA 4BWLA 1BEUA 4UMBA 1DWFM 1OBAA 3H2FA 4J3TA 2OX4A 2OPJA 5DELA 3W87A 3SUSA 4EIVA 2XHYA 4WF7A 4AZIA 2YBVA 1XRFA 3CAVA 4HYWA 5CLTA 4DO6A 5I77A 1GQIA 3B9NA 4C5ZA 2XH4A 3OBAA 2VGFA 3UGRA 1B4KA 4HMCA 3RYSA 4HA1A 3Q2DA 4NIRA 4QLKA 4YN5A 4PBFA 4BI7A 2WBKA 3EDKA 3GVGA 3TCSA 4NUWA 4IMAA 1E1EA 3LXBA 4LSBA 3IUIA 1JXJA 4N4QA 5DF0A 2GQ3A 3AZRA 3EOLA 1KGWA 3U48A 1FWDC 3CYVA 3KLLA 4PMDA 2QHAA 4GNKB 5CAKA 3L2AA 2PWFA 1TREA 5F1UA 4FIQA 2XWDA 1Q2RA 4RXFA 3PF3A 2DIKA 2G4FA 4EXAA 1EJ7L 1ZJAA 3L5MA 3GXTA 3AISA 5CPMA 4LCRA 2AMXA 1XRVA 5LGXA 2EG7A 3SURA 1KXVA 2C3ZA 4A8RA 2INFA 5CBIA 2Y2GA 3NPVA 2YFOA 3TW9A 4QE4A 4GQRA 4MZ1A 1UB3A 3EDJA 3M0YA 3LCXA 3LQGA 1BGGA 3EX4A 3PUOA 5I5RA 4M3PA 3M7SA 3SADA 1WQ5A 3MHUA 4QEEA 2C19A 4JDBA 4DWSD 5C5YA 2EQDA 2GDVA 2CLIA 3L23A 1XL9A 1FHDA 2C91A 2QT3A 1TTPA 3HB9A 2HPIA 1LZOA 3VD3A 2GQ8A 2CESA 2GQ9A 3E2QA 3P14A 1TVPA 4DBWA 3QFWA 1FBAA 3GNOA 1XCXA 1ME9A 4Z2LA 2Y2NA 2OX1A 4C6OA 4PC8A 8XIAA 1V6TA 5AECA 1ONRA 4N2YA 4GQGA 3NJ3A 4KEZA 1H51A 3EOSA 4RJEA 3NQ8A 1US3A 2NQJA 1FWTA 3OZYA 3NURA 4AMAA 2AL2B 3IJ7A 5ECVA 3WBYA 1JZ6A 3BDKA 5D4YA 2OYKA 2NV2A 2XGIA 4TV6A 5E70A 1UD8A 4C7DA 4HPNA 3DG3A 2OELA 4QE1A 5D32A 1MQQA 1KCLA 1G94A 3ZLGA 1FA2A 4A2SA 1PCKA 3E38A 2HV5A 2YJQA 2XZ9A 4LNYA 4Z0JA 3M9YA 3W07A 1AZ2A 4RX0A 2QPXA 1CGVA 4XSLA 3AHZA 2GSEA 1TWWA 1XYCA 5D8ZA 2BSLA 3GSMA 2BOFX 1X1OA 2TAAA 5JU6A 4HA4A 3TN4A 3ARRA 1D3CA 1Z44A 3OGSA 1M53A 1D9EA 3VZYA 3CMJA 1K9FA 1K4GA 3KBWA 4M6UA 3U5YA 1FHUA 5KTLA 1QW8A 3W6MA 2YX0A 2Y5SA 1NWUA 4M81A 3NGJA 5DBTA 2ISDA 1Y5XA 1NQ6A 4WGXA 1W1VA 2CBUA 1ONXA 1TWDA 2BB0A 2PWHA 1TQXA 1ONWA 1H8PA 1W5OA 2B7OA 3QVQA 3D3AA 3C0LA 3EOEA 4GUFA 1QI3A 2WC4A 4JIRA 4C1LA 1ME8A 2I16A 4V1XA 1M5WA 2RUSA 3LNPA 4UTIA 3WQ5A 4O1DA 2DQXA 4HK6A 1QNOA 5K4XA 3UWQA 4ROQA 2J25A 4EACA 2NUYA 5IFTA 1TR9A 1W9BM 2BY2A 5I3GA 3MT1A 2O92A 4MGGA 2BBFA 3JZEA 5CZ0A 3WH6A 1NDYA 2V0TA 3DU0A 4IGHA 4GYPA 4MPKA 3WNMA 4ZB5A 4Q32A 3F2BA 3B8WA 4PMNA 2A0NA 1H7XA 1J11A 5HJYA 4NVTA 1HGYA 2PWVA 3CHCA 2YXOA 4BEQA 3HIJA 1SJDA 4YLWA 1X38A 1XLHA 1GVFA 4DJFC 4YCPA 4XWUA 3RRXA 1XKJA 4IHCA 3WD3A 8TIMA 1UZ1A 1V02A 4DUWA 1UD3A 4RE4A 3E2SA 1EAKA 1LRTA 3ENLA 3RK8A 3LRKA 1UD5A 4H8HA 3R79A 2Y2OA 3G77A 3GW0A 3MDUA 1JRBA 4AAJA 5CCZA 5AZ1A 2WVVB 3PNUA 4J9JA 4DAIA 5FSDC 1QWKA 2JCHA 4KW2A 1UD4A 1BTCA 3ARYA 2VOMA 1C93A 1KKOA 3BK0A 3VILA 1LUCA 5BRPA 2ZRVA 5FF3A 4DNMA 1WUEA 3TH6A 3UGVA 2PDBA 3UEQA 2Y70A 1XIHA 6A3HA 3DBPA 2GJLA 3NDOA 1ISVA 2GZXA 1CGUA 2FJKA 3HV9A 1UH2A 2FB2A 3M6DA 4LVFA 4K68A 3PFRA 3V4BA 3W70A 5RUBA 3OLEA 4ATLA 3AOFA 1BVNP 2VR2A 3WO8A 1J0IA 2C0HA 4O0ZA 4Q4KA 4ICNA 4H6RA 4Q8PA 4JCLA 1LWJA 2XVPA 4LYPA 3M1ZA 4JX5A 2VDHA 3OIXA 1S2UA 3W1LA 1QT1A 3F4VA 3FAWA 3DFYA 3DXIA 4DELA 4FF7A 2VXNA 1GQLA 3O8AA 4BF5A 3E0VA 1UP2A 2G4JA 4TMCA 1JPMA 4ZQRA 1J2BA 2VX6A 1X7FA 3TYEA 1DJGA 1ISZA 1WKDA 2X1IA 5JH1A 2Z1SA 1WXYA 1UKQA 1J79A 1G69A 3QLDA 3AROA 4QHRA 4JIQA 5K9DA 2W9MA 3M5VA 4C91A 4YU1A 5DX7A 4J5NA 3OODA 1KGUA 2QCHA 3I4KA 4S3KA 3MO4A 1BRLB 3CTLA 4B2DD 1O5RA 4ZOBA 4W4QA 4IICA 2VX7A 5DBUA 1UZHA 2E28A 1BKSA 1JCLA 2AOSA 1KKRA 1MZRA 2EEXA 3IV8A 2CZ5A 3VUPA 2Z4GA 4IPPA 4PCPA 3NSXA 3ZJKA 2IXUA 5T26A 3SRDA 2VEIA 5M3WA 1H4PA 3K30A 2J7DA 4U5IA 3NEHA 4FNRA 3PTDA 4AZ6A 2ZOXA 3CAWA 4I9MA 4L1XA 2CIPA 3UW6A 2QVHA 2A7RA 3SCPA 2X7VA 4OOUA 3W27A 2ZDSA 1AH3A 3FNDA 3IIXA 4H6QA 3WDPP 1DJIA 4IGMA 1TJ0A 5AVHA 1VH7A 4PODA 5CBBA 4QQUA 1GTEA 1XIIA 1FXQA 2VVNA 2WSPA 3AU2A 2QUTA 1GOOA 5BW6A 4L9XA 2WLYA 4FEZA 5A6LA 4CQ8A 3D6NA 4XTIA 1SMDA 1WBJA 5FF2A 2B31A 1QK0A 3C0SA 4IBGA 3A6OA 4L6HA 3N4EA 1BGAA 4FF5A 4MLRA 1CGYA 1PKNA 3A3WA 3I7SA 4YJ5A 2C15A 2BHUA 3ONCA 3F03K 3UXLA 2GUBA 1KM2A 3N18A 1S1PA 3PZMA 3VD9A 4LCSA 3EKZA 3ITVA 2XSAA 3BOXA 2QDDA 3AFBA 1XXXA 1YADA 5AOUA 4GYKA 1D2KA 3CZLA 3O63A 4IP7A 4LWWA 5CJ5A 3G6LA 3HMJG 1O1HA 1YU3A 3S9ZA 3B03A 1VZWA 1XR2A 1OHLA 4ZR8A 4INFA 4UNKA 4PCFA 2G97A 2XINA 3GUGA 2PP3A 4V2XA 4W7UA 4E2BA 3C4UA 4DUXA 1T0OA 2POTA 3E0FA 1QI4A 4ZSUA 3VE7A 5FL0A 2VQUA 2VDGA 4FOJA 1CXEA 2XFRA 4M29A 2IPWA 4GI8A 4GXWA 2D1ZA 4H9UA 3N2CA 1P0EA 3LMZA 3RJYA 3W7LA 1XH0A 2FZ9A 4TVCA 1PVNA 2YBUA 1C92A 2ZQ0A 4OJYA 2WNWA 5G1TA 4IIBA 4U31A 1JNDA 3ARUA 4JFSA 3M4HA 1UWTA 4X61A 4AB4A 1L6WA 3POHA 2PTXA 4AEOA 1K8YA 5AYIA 2V5DA 5G4WA 3UNTA 1VLIA 1UR0A 1HKJA 3GHRA 3ZYZA 4I8DA 3O15A 3TLQA 3GX9A 2YL6A 4L64A 1VR6A 4K1WA 2QJMA 2VZOA 2GK1B 3IGSA 4L1WA 4LGXA 1P1XA 4X9SA 2V63A 4EXBA 3IJ9A 4PH6A 4NZ1A 3BAKA 4FXSA 3E02A 1R6WA 5BOFA 1MFVA 4PB5A 2WZIA 3OHIA 1V51A 3HBLA 1VRXA 2X2YA 1ZAJA 3EEZA 3LB0A 1VB9A 2ZRWA 1EQCA 1L6FA 4W86A 3T05A 3STFA 2CBIA 1R5YA 2CHRA 6XIMA 3RRAA 5FJPA 4U2ZA 4JN8A 1KWGA 1SJAA 1V6WA 2JK2A 1N55A 3KVJA 2D2GA 1CXLA 1S5MA 4IXHA 5HA7A 3T2PA 3PPFA 4HNOA 4U33A 1EOMA 2PLJA 2HS6A 4BF7A 3LBMA 4AWUA 2PF8A 2QF7A 2PP1A 1Q6DA 1E6QM 1K77A 1W5QA 3VIHA 4FPSA 4X2RA 1PYMA 3E3HA 3ITTA 2JALA 5GNXA 3VIFA 1A5KC 5ENLA 3WQCA 2CHNA 4XAPA 1XLAA 3MMTA 2XYLA 4OGZA 4UTFA 1Q7MA 4D1IA 3UCDA 2VGBA 1WAUA 1Q4NX 4N9BA 2VWSA 3S6DA 1PHQA 3TFXA 2WMKA 3URNA 1NELA 3NEVA 4FXFA 4H00A 2E3ZA 1MW1A 1O1ZA 2PGFA 1NF7A 2UY4A 3L4WA 1JAKA 2G41A 2X16A 3OGVA 2JQXA 4M56A 3T2OA 3WLHA 4KERA 4D6JA 2I14A 4F8XA 1AL8A 2Z26A 2XU2A 5ABFA 1KFBA 2FTYA 4ZEPA 3KEHA 2NXGA 3PUGA 2D69A 3DI0A 1ODZA 2W6RA 2D2HA 3A64A 3UZXA 4GHAA 1FHLA 1NSJA 2WZTA 4IBCA 4QX4A 2Y2KA 4I7WA 5JMUA 3NPXA 4HCDA 3VGFA 1Q6CA 4QLJA 1VFTA 1TV2A 4LT9A 5H6HA 1WUFA 3A24A 2X30A 2AKMA 3RFAA 1W9DM 3OTRA 5CC7A 4H83A 4LBSA 4ZB0A 3WD1A 3U2ZA 2Z6JA 4K38A 4AVFA 5C2GA 4XB3A 3TA9A 3K4AA 4Y9OA 4QSHA 3PPGA 3BMWA 3CU2A 1TWZA 4WOZA 4DRSA 5A3HA 2H8XA 3BURA 3TQKA 3BCDA 4K2SA 5EMYA 3VNKA 1YTDA 1R46A 1XFCA 1UP3A 1YPFA 2ZC1A 4G1KA 5FAGA 3RU8X 4OBTA 2OEMA 1E3XA 1LUCB 3ABQA 2FTWA 2A3LA 3TZFA 4NY2A 2XFYA 2Y24A 3AMLA 2VFDA 3SUWA 2FFCA 4IISA 4TX6A 1MFUA 4WQ6A 4UFJA 3UZZA 4KBXA 1I75A 5E0FA 3MJMA 4MNLA 3AMKA 4PL2A 4UTHA 3CUIA 2YCKX 3L26A 4GZIA 4V28A 3QGVA 3AHVA 1X7IA 4DNHA 3UZYA 3N9RA 4DUVA 2ISSA 2Z29A 1J01A 1ZB5A 3VI2A 2PDQA 3WF4A 1WXZA 3XIMA 2DFAA 5IHRA 3TP4A 2NX1A 3QZAA 3W2JA 4PTVA 1XGEA 5F2IA 3WDJA 3SCQA 1YE4A 4C1KA 1J12A 4IPJA 3GVWA 4I5XA 3RX4A 3UR8A 1OJXA 4H6EA 4IXXA 5I24A 2JIEA 3F7JA 4J4KA 4AC1X 4QS6A 2OO0A 3VIMA 4XK2A 1UZDA 3SQLA 3T6CA 1KTNA 1JUKA 3EPNA 4JTKA 3PTKA 4NJKA 2TODA 4Q4MA 3EOOA 4IIDA 4OZOA 4L7ZA 2QLYA 3GG7A 3CL7A 4BHYA 4DLMA 1FRBA 4D6HA 4QP0A 4ZOCA 4R7OA 5CSRA 3VIOA 4AYGA 5JBEA 3WLQA 3GC4A 3W26A 3M0HA 5GJNA 2I1OA 2Y61A 3LCWA 3BARA 3CTTA 3GIPA 1BYAA 1RHCA 5J04A 5J5RA 3TJIA 4J7RA 4PR4A 4LVDA 2PDIA 3OVQA 1FH8A 4R88A 3W29A 2R1LA 3ORWA 5FJIA 1PBGA 5EYWA 4GXMA 2JKAA 4KQNA 1YU0A 1VFUA 1XYFA 3N73A 4OECA 5DMLA 3V7PA 2C71A 4E5TA 3MCNA 1NM9A 1OK6A 1H1ZA 2SFPA 3UY7A 2CBJA 1TWIA 3GNDA 3BMXA 2DSZA 3W7CA 1MMFA 3WL1A 3QQ1A 4ASTA 1JDCA 4EWND 3HG5A 2PWGA 4MHBA 2FN2A 1E9ZB 4IBDA 2XIOA 3LPOA 1EP3A 1OFPA 3ALFA 2XN2A 5A6KA 3I6EA 1IR1A 2YIHA 2HDJA 3SCNA 3B04A 3U6WA 1LF1A 3L9CA 2V8ZA 3R25A 2G95A 1FWSA 3LHWA 1XDLA 2OLHA 3RM9A 2VEFA 4LUJA 2HROA 4IP5A 4Z2IA 1EIBA 5C54A 1BXCA 1Q5MA 1WXJA 4FS9A 1UBPC 2QIWA 4NZ3A 4BQ3A 3UG5A 1C7SA 1RBOB 5KSWA 4DPQA 2H90A 4F0MA 2G5WA 3AXHA 4NHVA 4IFKA 1ZZMA 1YXDA 1ECQA 5DMMA 2EAWA 2IKJA 3CPGA 3N13A 3WD4A 5KEZA 1QHPA 4L1GA 1T41A 1EYWA 3H21A 4CNOA 1F6YA 1A3WA 4B9YA 2DZWA 2GOKA 2IQDA 3NO3A 3LGEA 3V18A 1TPVA 5I09A 4XX6A 4QNWA 4LU0A 1J10A 2X8RA 3TR9A 3P8IA 4UFLA 1CLXA 1XLFA 4RKAA 3IUDA 5AHFA 5JH2A 2G96A 2MNRA 4FB7A 2A7NA 3NOYA 4AX6A 4TR9A 1ZJIA 2PLMA 1HL9A 1XC6A 1XX1A 1MW0A 2EJAA 1UHVA 4J2MA 4CCCA 4MAZA 3OOQA 1QI5A 2ABBA 1HO1A 4KRZA 4JXCA 2FZ8A 3FS2A 4LH8A 4WR3A 3IRSA 1AJ2A 3HPXA 2QCMA 3QLLA 4BZYA 2OZTA 2BOEX 3HN3A 2QPUA 1FWWA 2VFHA 3LNMA 3BVJA 1M1BA 2FVLA 1VYPX 3HU7A 5A6TC 1MZHA 3ARXA 5H8MA 4X9YA 2EKGA 5BXTA 1TWSA 3C2YA 4Q4OA 2CXEA 5HANA 2W67A 4ZCWA 3SFWA 2OEJA 4MIMA 1ZAHA 4QBXA 3R0UA 2PS2A 5FIPA 4H01A 4C6PA 4RZ4A 2DY3A 4O54A 2GWNA 2G3IA 2CZEA 3F5LA 4ZZ9A 1H1YA 5K4ZA 5CZSA 1L2UA 3L5AA 3W7MA 3K8MA 5CPOA 1TA3A 1I1XA 3M46A 1YIXA 2P76A 4EK7A 3TYZA 3G1RA 4GMEA 4N42A 1K9DA 1F61A 1XLBA 2XIIA 1E6PA 3L27A 1G7VA 2C1GA 2E0PA 4KETA 4WDWA 1NFBA 4D71A 2E1DA 1ZHAA 2WHJA 2ZUWA 1F76A 2W3ZA 4F9JA 3PTQA 4LC6A 1Q13A 1ONEA 3W82A 2YA2A 3FCPA 4AWTA 1R7AA 3VK5A 4QNEA 5AFDA 3PY2A 3GHUA 4ZXOA 1PAMA 1LT8A 4YWSA 3DN5A 3TXZA 2PE4A 3A22A 2F6UA 4RW5A 4G7EA 2OZ3A 4REQA 4E8DA 2GGEA 4FP1A 4Y9MA 4BKNA 1UWIA 4PB4A 3EA1A 1BPLB 3UNDA 3W7JA 4ZQCA 3SBFA 4DXVA 4R7WA 5HQLA 4MOZA 1NJJA 1HJWA 4Q8WA 4DJEC 3E0LA 1EIXA 4UFKA 4RDVA 3KZPA 1GKQA 3ZJ8A 4G6CA 2OSYA 4I6VA 4UTWA 3B97A 5ABFB 3QPEA 3HQNA 1TX2A 1ITCA 2Y8KA 1KFKA 3MV01 1DWIM 3TYCA 1I45A 1AW2A 4HK5A 1UW9A 3DFQA 3AICA 2F8QA 4Q8QA 4IIGA 3BLOA 1G4SA 3DFNA 4W88A 3ZJ6A 1FOBA 5D2WA 2V68A 4MJMA 4FNSA 2RHGA 1VFSA 3W1NA 2ZX6A 3SN1A 1HVQA 4Y8FA 2WHLA 3MBDA 4F66A 4C6JA 2OJPA 1GYLA 3A3XA 3AIBA 2VEKA 1EP2A 1ZENA 3FN9A 4KPLA 4B91A 5CPSA 4MWAA 4R33A 5TIMA 1KRMA 2QYGA 3TTEA 4MUZA 4WJEA 5LA0A 1WKFA 1YQ2A 4ATDA 2ZYFA 3NXLA 2ZUUA 3MU7A 4J28A 2DW6A 4H8VA 4OJ6A 3BMVA 1JF5A 2F7FA 2ALDA 2HQAA 3ISIX 1HT6A 4RL3A 4DI9A 4LVGA 1B3YA 5AC5A 2EPMX 3UA3A 2DZBA 3MZ2A 5G5IA 1KBBA 2XIJA 4FK9A 3C86A 4GZEA 3ZXWA 3FV9A 3MYOA 2D20A 4YVVA 4N7QA 3IWPA 1Q6FA 2ZCGA 4DWSC 4UQCA 3LCFA 3MUXA 3PTMA 1OF6A 4XKYB 5DFAA 4E8GA 2TPSA 2DU2A 3UZWA 3RX2A 2PI6A 1B3WA 1OCNA 2W27A 3E5PA 4NASA 5DXXA 4U28A 4MM1A 4C5YA 2WKLA 1CZ1A 1XCFA 4UTLA 4RUBA 2PTZA 3AALA 4K3ZA 3FLUA 1TVNA 4C6CA 4L6DA 1P5BA 1U83A 1UD2A 4JDYA 2ATMA 1IZKA 5LIUX 4NJHA 4ATWA 2F61A 4JYEA 4O18A 3APYA 2JIWA 4S2CA 2J47A 4RDYA 3DZ1A 1LOQA 4AVNA 1OABA 2VD8A 2C1IA 5A6BD 5CC6A 3F5KA 1XH1A 2XFWA 5BWFA 2ZTKA 2UY2A 4B9ZA 5C0QA 1W1IE 2J8GA 1BYBA 5JBFA 1IXQA 4DLFA 3H7VA 4QR6A 2VZTA 3OO2A 3UG8A 4DJDA 1J2WA 1SVDA 2GDQA 2YDAA 2XVGA 4JNZA 2BNJA 1TSIA 1I1WA 1BD0A 1KRBC 4PRRA 2DVUA 3CWHA 1QOXA 1GHRA 3L66A 3PPHA 3GNXA 3GIQA 4CNSA 8XIMA 3PZVA 3QY8A 4YCOA 1W3TA 3W86A 3FX4A 3PWAA 4HTBA 3NCOA 3B40A 2A85A 1D7FA 3BANA 1SZNA 4UCGA 1QCWA 5I78A 2RJHA 5LNRA 2IKIA 3OG3A 4P8XA 1AUSL 3T7VA 2I5IA 4WY0F 4PUWA 1I6NA 2ZXAA 2J6XA 3O9NA 4AVOA 1K7EA 4H8NA 3UCCA 1A4LA 4E2DA 1NDZA 2HSAA 3HF3A 3VNDA 2UV8G 1PV8A 4MY8A 4QGCA 5AHEA 3WQPA 1G7UA 1F3EA 4UTTC 4Y9AA 2XWEA 3N12A 1AQ0A 3GR8A 3HPAA 4MFEA 1I60A 3CAQA 1YDOA 1OB0A 2QUNA 4R9XA 1HJQA 3BXWA 1EJXC 4AISA 3EDFA 4PFHA 4MZYA 3FYOA 3GS6A 3C3UA 4Z2KA 3QKEA 4OJ5A 4CEXC 2EO7A 2QAPA 3PC0A 3EXTA 4PFMA 2ZRYA 1GEHA 1T7LA 1X6LA 4CNNA 1Q2SA 3LX9A 2VVSA 2YL5A 2X1UA 3NGFA 4M6QA 1UR8A 5DCEA 5EMUA 1NTHA 1R9YA 2GSHA 4JTFA 2LLEA 5CPNA 1W1B1 5A1AA 3PB0A 4IFKB 1XICA 3OU8A 1TX0A 4KT2A 1YLVA 2O7QA 3AZSA 3G1YA 3V75A 2J9ZA 3N15A 1ICSA 2ASHA 4RV3A 5CQ1A 1K1DA 3DI1A 3LCIA 5U4NA 1W5NA 4Z2JA 4O14A 3VZZA 3GHSA 1W6TA 2YCLA 2X05A 5XIAA 4CVUA 1LQ0A 3THAA 3BLLA 2PD5A 4HHHA 2BDQA 3OQ8A 2P8BA 3RHGA 1RLDA 4YMZA 3BQ6A 1C90A 5EMMA 3C56A 3B4YA 5JVLA 2W61A 4H8UA 4Z2GA 1JD7A 3M44A 2GJXA 5FF0A 5C9XA 5HR7A 2ZUVA 3S5SA 2Q8LA 3WQVA 1E5NA 3JUGA 6ALDA 4XZHA 4EPDC 1EOKA 1TMQA 2TYSA 3PAOA 3DX5A 1KM5A 2A7PA 2G3MA 1RH9A 3VOCA 3KBMA 3NUKA 4KFNA 1YU4A 3NIYA 4JN6A 1PX8A 3H7RA 2VEMA 3LZ5A 3E12A 1SO4A 2VI0A 4XV0A 3PWIA 3WUEA 4A29A 3RO6A 4LVBA 3S9YA 5IHSA 2X0HA 3SRFA 3GU9A 2QIIA 5D04C 3TTQA 3QV6A 1TA3B 3FOKA 1CXHA 4QG8A 4MJ4A 3PBYA 4GJJA 2E9MA 3CNYA 4O13A 1K8ZA 1C9DA 2CETA 3L68A 4P7QA 2H3DA 4MVAA 1XLMA 1LOSA 3GNPA 1W1TA 2Z2BA 1TJPA 8A3HA 4NZ4A 4JICA 4RCXA 3DHUA 2VL4A 3WX7A 1XGDA 1EX5A 1M7PA 2YOCA 3MSYA 4HZMA 1WKYA 2FYMA 2BASA 1AJ0A 3UP8A 3P82A 3L67A 1BVWA 2GJNA 2ZX7A 4F0RA 3M0ZA 4REQB 4H19A 4J3UA 1KQYA 4Q6XA 1KW1A 1DYSA 2AGKA 1EWDA 3LERA 2P10A 3EWYA 3DG7A 4JTEA 2MUCA 4NXKA 2XVNA 1W37A 2OMAA 5HNNA 1BAGA 2QS8A 2J7BA 3WH9A 4M24A 3G6MA 2XVKA 2VCAA 1J93A 4DJFD 1EHNA 3A5FA 1SQ7A 1D3HA 4XAFA 2QDEA 4RE3A 5E1QA 2KAUC 3ARPA 3W28A 5C8BB 1AQMA 1P0BA 5CJMA 2CKRA 3AC0A 2OTDA 4ZO7A 3NA8A 3NZ1A 1R3VA 1TE1A 5CEWA 4OE7A 1XSIA 4DXXA 3NQMA 1VS1A 4IMCA 4HMEA 2WQPA 4Q4SA 3S9IA 1IE7C 5L9FA 1G4TA 2FFFB 1L6JA 2J7CA 4KIRA 1A5UA 1ZSXA 3BLIA 1V3IA 3CEPA 1W5MA 2D24A 4HP5A 4A35A 3DKJA 3NYDA 3A47A 2WMJA 4NNBA 1PDYA 3QGKC 4LS2A 4S3CA 1K6WA 4UC5A 1FDJA 4JIEA 3VC5A 4RNJA 4LUIA 2V5JA 4XTDA 4IIHA 1O4UA 1TFVA 1OG0A 3LLDA 1H7RA 4MFDA 2WSKA 4H2HA 4G8TA 4MWAB 3DEQA 1W3NA 2GFTA 4C6DA 2O56A 4Z08A 1LOLA 1OGGA 1VJZA 2X09A 5EMLA 4WDXA 1EHAA 3EPMA 1YYAA 2XGZA 4K7YA 3C52A 1E1CB 4Z42C 1XDJA 2IPGA 2VJXA 3MSGA 3DECA 3PJTA 4O15A 3EEGA 1JCJA 2ISFA 4BCEA 1A3HA 1XIMA 3IEBA 3KL3A 4JTQA 1OYBA 3VKDA 4G5DA 1E0VA 2QULA 2ZWYA 4IP4A 3ITYA 4V27A 3H2AA 3MKCA 3W2MA 3NNTA 5H1WA 3MQLA 2DUZA 1A5LC 2IPFA 3FY1A 1EUNA 3EYPA 4JS3A 4PMUA 4BQ2A 1JCNA 1PDCA 1NFGA 3EX6A 4B5UA 2V3GA 9XIAA 5GJMA 4NQ1A 4L6OA 3I4EA 4GJIA 3APTA 3UYIA 3LSBA 3WK2A 4HT3A 3GG0A 2DSKA 4IM4A 3MB9A 4JEQA 4Q6JA 3TV8A 4RK8A 4MKNA 2X0YA 4KH2A 4LYKA 5T9BG 1UCWA 3CT2A 5EMKA 3DHDA 1VFOA 4DAFA 4JTSA 1I0BA 1NP0A 1ECEA 4I7UA 4MYAA 5DLCA 1CTNA 1TPB1 1O94A 1F3XA 3AXXA 3MS8A 2PDCA 4O1CA 1EUAA 3L0NA 1REQA 2NXIA 4WJXA 4W8AA 3VMPA 3BG3A 4NZCA 1XG4A 3LTSA 1TPFA 3AO0A 4IWWA 1CIUA 4D6EA 3MMWA 2R91A 2J8FA 1JCYA 5LIWX 2RDXA 4AZ7A 1TZ7A 3AHXA 4RPQA 6CGTA 1CPUA 4ZGYA 2DVXA 3SO7A 1E55A 3B05A 4B2DA 3THUA 1NWTA 4S3AA 1KR0A 2NT0A 3L4YA 2XM2A 1TRIA 1FDZA 4Q3MA 1NQKA 4YYFA 1AIWA 1ZFJA 4FLOA 4HNVA 5I7GA 1OCJA 3VGEA 1TPWA 4S3JA 1IWAA 1H0IA 5FF4A 3BLPX 3ARSA 5C6MA 2ZUTA 1IXNA 1SFJA 4QDPA 5EMJA 5D33A 1YDVA 3PJWA 3W7NA 3S1XA 4FLQA 3APGA 3NQAA 9RUBA 3GDKA 3IUHA 4W93A 4UZSA 3WF2A 3EAUA 5A8OA 3AS3A 3KWSA 1QWGA 1A47A 4GE8A 2F6KA 4JTJA 2NQLA 3PZIA 1E0XA 4XUGA 1QASA 2OVLA 3N2XA 3I10A 5IBXA 1LORA 3EWDA 3GU2A 3SY1A 3SCSA 4JEJA 5BCAA 3TOYA 3PAJA 4PMJA 3R8GA 2NUWA 3CS2A 4HNLA 2B81A 1EJWC 3TTOA 1YUEA 1VPQA 3MVTA 3LG3A 4PBEA 3QRHA 3WJYA 1ZP3A 1XSKA 2BOGX 4JX4A 1UYQA 1BYDA 2ZKMX 2PC4A 1W91A 4OQVA 4K39A 2NVAA 3P80A 4AXNA 1PTDA 1IT0A 4LANA 3LRLA 5A8MA 3WLMA 5MHBA 3ABSA 1H5VA 4D6GA 1W1YA 4I5UA 1DQXA 4LFYA 3R43A 1OX5A 4EOUA 3O0KA 3VIKA 2J24A 1DHKA 1KBKA 2YZRA 5EA9A 3TEVA 2DZAA 2HNHA 1XM3A 3IVTA 3RLUA 3EZ4A 4C6NA 4DXKA 1MUWA 3NPUA 1JR1A 5F4SA 1UMLA 4C6IA 5J5DA 2YCLB 1KQZA 4ML9A 1P43A 1Z8AA 1HKIA 2ISVA 1YRRA 2NWRA 3CM4A 3BCFA 4MB1A 4I3GA 1J0YA 1JCMP 5B7ZA 3G1AA 3WQFA 1F9CA 3DAQA 3THQA 4X2PA 4HNUA 1V08A 4S3BA 1AMKA 2WMIB 4NYUA 4PUUA 4KWWA 4PSRA 3INPA 1MDLA 4S1FA 5HAOA 8CGTA 4HA3A 2GJXB 3HPSA 5JQ9A 2CERA 1VJSA 2Y2JA 3H53A 2UWXA 5FJUA 5LKYA 2XIBA 3EA2A 3PUDA 4XD6A 3BQ5A 4DWSB 2DZVA 5LXXA 1JRCA 2IUZA 3W1RA 1KBIA 1GG0A 1CWYA 4HYRA 2Q71A 1YXCA 4NNAA 1A0CA 3DDMA 3LI0A 4PTMA 5FESA 3LGDA 2WCAA 4GI9A 1BFNA 1FH9A 3E0WA 4X0NA 3HFYA 1AZ1A 3LK6A 5AHMA 2WOQA 1VPXA 3VDHA 1YBQB 2DP3A 1Q63A 2OWXA 3GH7A 1YU1A 2ZFAA 4XZBA 3UR5A 1SZRA 2W62A 4QITA 3BUVA 4XD3A 2ZZ1A 1ICPA 1W3IA 3A4JA 4PUDA 2NVCA 4Y6GA 4E3VA 3VGGA 3BTNA 1Y65A 5A94A 3T1GA 4HN4A 4UQAA 2CW6A 1CCWB 3UWVA 1H61A 5TNVA 5K2ZA 2PRMA 4Q8MA 3T07A 1HVXA 4LW7A 4DYKA 3AIWA 4GIRA 1JZ2A 1KM4A 3GR7A 4H1ZA 3ZVIA 3ANYA 3E9AA 3W81A 3FEMA 4AEFA 3SB0A 1OQFA 5CJNA 1SUXA 2O9PA 3C2EA 3N04A 1UUQA 1FWJC 5ABEA 1W3LA 2NXHA 1KV5A 3UG4A 4QCEA 2OKTA 4F3HA 3T8LA 4HJFA 4RE0A 1SZGA 4LB4A 3TNOA 4HMNA 3B0PA 4TXEA 4JR5A 3OQEA 2WJZA 3UJSA 3GRIA 4EF8A 1K9TA 1WDQA 1EC8A 3IK4A 3KHJA 2P5NA 1QJWA 1Q3NA 3QEZA 5I3KA 1DKWA 1RPXA 1C9WA 2E40A 1RK6A 3WENA 4U10A 1WX0A 2IPJA 1JDFA 1HJVA 1GPFA 2CLKA 4GKLA 2FTPA 3IV3A 4GUHA 2RKXA 3OVGA 4DZHA 1OT1A 1MYRA 2W0UA 5JBDA 1C7TA 2Y2QA 1R7OA 2AMGA 3A23A 2EPHA 1XSJA 1RBLA 4AY1A 1JAEA 4WIWA 5CGMA 1IV8A 1UASA 3HPZA 1AH4A 4GCAA 1S46A 2FGBA 1JPHA 2NW0A 1PZ3A 3OA5A 3UR7A 4UQBA 1QOPA 3RX3A 1E9LA 3WJSA 1G1YA 3U2EA 4GIAA 1OFAA 3O7UA 3LBCA 1QNPA 3EKLA 1RCOB 1C91A 2Z2AA 4HPXA 4RDWA 4Z1DA 5BOOA 1G4EA 1DQUA 2ZZ3A 3MANA 3TJ4A 1UR3M 4TTUA 4FOUA 1EC7A 3AJXA 4MDOA 3D5HA 3D46A 4TIMA 4AY7A 3FJ6A 4R27A 3HG3A 4IJRA 3IRDA 4DZIA 3NYZA 4A2RA 1O5XA 3UETA 2Y7EA 3VAVA 4AD2A 4YS1A 4XO7A 1PZ2A 2Y85A 1G0CA 5IRPA 1SGJA 2GUUA 3VYLA 4OWGA 1EKOA 1XUZA 2V9DA 1SFLA 1BSIA 4LB3A 2FH8A 2PF0A 4Z1AA 5EGRA 1BSLA 1XG3A 3LRMA 3S1UA 4ERAA 3K4WA 3CV7A 1GKPA 1PB0A 1ITQA 3P61A 5GNZA 3IVSA 3D47A 3CV2A 3HO8A 1XYZA 3QYSA 3EX2A 1CW2A 2E7FA 2G50A 1JI1A 4JZ5A 1E88A 1RQHA 3UYCA 3ATYA 4JX6A 4ZA0A 3NM1A 3P6LA 3GXFA 3Q58A 3AIUA 5I79A 2CEQA 1G01A 4NI3A 2ACQA 4JNYA 3HGJA 1ISYA 1EGVA 1QK2A 3USZA 3N3FA 3R2GA 5CBJA 4C6EA 3K13A 4BJHA 1VLWA 4PCSA 1TPH1 3NZPA 5D9OA 4NRSA 4NZ5A 1A80A 4ZENA 4S3EA 2B7NA 1V6UA 4ZO9A 2BXYA 3WDIA 1QNQA 1REQB 3I3DA 3SGGA 3W53A 5LA2A 2ZDRA 4DX3A 3D0CA 5DXYA 1F07A 5CC5A 1ML1A 2PEVA 3PFMA 3VNLA 3W76A 2WB5A 4LUYA 4LUSA 1E0UA 2DVTA 3PJUA 1EJVC 2YLLA 4TV5A 2ZVRA 2JF6A 3O3RA 4H9TA 3TN5A 2EKCA 4EVZA 2JGYA 1H11A 2W66A 3H8AA 3VUSA 4HU0A 2QCCA 4M80A 5KZMA 1JGMA 2YCIX 1US2A 4LS1A 1VD6A 2V82A 4NSBA 3Q45A 1DJWA 3CT7A 3C8FA 5E9XA 2E25A 5C7VA 2ZICA 4AWEA 5BRQA 1X96A 5HATA 5JXQA 4AHQA 2Q3RA 1QAPA 1OFOA 3EB3A 1KGXA 1X1ZA 4AHPA 3V16A 4M6VA 1LYXA 5CZJA 1EA9C 5AHIA 3PP7A 1XWYA 4I9AA 3WJXA 1LBLA 4I9TA 3RNDA 5DEZA 2V67A 4JTHA 5AHLA 5B80A 2DZPA 4KIEA 5F2LA 3SUUA 2QGHA 3UCQA 3KRSA 3EXRA 1Q8JA 1F2JA 2JGQA 2Y88A 1P1MA 1QBAA 1EO5A 3M6YA 1N2VA 5HMEA 3SUVA 5TD4A 1VENA 4P8VA 1J4EA 3FFSA 3V1PA 2Y5EA 1IWPA 3RN6A 3TZNA 1WZAA 3EOUA 4OUEA 3NZRA 2ZE0A 1HG3A 2UZ9A 3A9BA 3C3NA 4L61A 4P8UA 3N2BA 3VM5A 5TQLA 2INEA 4H3DA 5A8PA 3TN3A 2PDMA 1P0NA 3ME3A 4WDUA 4B5TA 3QH2A 1JFXA 3AUOA 3QMSA 1W56A 3HQOA 1OADA 3W25A 3GQYA 4TTGA 7CGTA 1C8YA 2BP1A 1MRQA 5A6SA 4QLLA 4H41A 1THFD 1WZLA 3E0IA 3GH4A 3GAKA 3C2FA 3PK7A 4MAVA 1O68A 1IIHA 4M8UA 2EBNA 1KFWA 1W9VA 3NVTA 4RNHA 3W1TA 3HG4A 2QAFA 3W2UA 4FO4A 3G0XA 4IIFA 3VD4A 1EX1A 1UR9A 1UWSA 3NQEA 3MUCA 4XD5A 4AY8A 1DIDA 1BWVA 4HU4A 2QMKA 1B4EA 3HG2A 1LM1A 2PAJA 3LHUA 1EGZA 2D22A 3DERA 1AVAA 4Y96A 3UZ5A 3WLSA 3GY1A 4MKSA 1YKWA 3TYDA 4JIPA 1MXGA 2IOUA 4HU8A 3QM3A 3HJZA 2PZ0A 3WH5A 1UPPA 3DC8A 4ZOAA 1J6PA 1FX6A 1PX4A 2PP0A 4M7SA 2OGJA 4S3FA 1CX9A 3CL8A 2JBMA 2F38A 1XD1A 3WMSA 3ANVA 5DY3A 2QF8A 3CH0A 1RQEA 1SJBA 3CQ0A 4ORIA 1ENUA 3S5NA 4QJ4B 5FJRA 2YR1A 3R8RA 4BQ4A 2XD5A 4CN1A 3AXMA 1KFJA 1LTDA 4UR9A 2OSXA 4GNVA 2ABAA 4HHPA 1A5NC 2JFEX 3PR2A 3ABZA 3GBDA 3B8VA 4NAFB 2FFIA 1TV7A 1UIOA 1DE5A 2E09A 3EX1A 3TSDA 4KEUA 1UJPA 4R7JA 1MSSA 1EYEA 1PIIA 1V0LA 2FGLA 1QRQA 2QUMA 1NEYA 2Y2WA 4O11A 1KFLA 1CXWA 5BPVA 3QW3A 5HQMA 3LBOA 3GG8A 2Z27A 2X7WA 1R86A 5FL1A 5F2MA 3VNMA 3R0KA 5XINA 1I2NA 4M7TA 2F2HA 1V0MA 2PBOA 4DJED 1UR1A 3URAA 5HR6A 3LN3A 3S2JA 1U30A 2WNZA 3G0UA 1EJUC 3FVDA 4O0KA 2W5FA 3UESA 4W5UA 1EXBA 4F2BA 2QQ6A 1L8NA 4C6KA 5HDRA 4U3CA 4KEMA 5HULA 3B0XA 2P8CA 1PSCA 2HWGA 1Q4WA 1OEPA 4GI6A 3DENA 3VIJA 4N9EA 3OVPA 5JUVA 1CB2A 1XRSA 5LYRA 3AUJA 4IMFA 1W31A 3RMJA 4JN7A 3W02A 2GGIA 5FAJA 4H7VA 2ISWA 4HZ6A 4UB9A 4IMGA 3G3DA 2NQ5A 4GVFA 2ADAA 3FKRA 3BAXA 4F4RA 1UWUA 2ZUMA 2CKSA 1EXPA 1W54A 1HQTA 2QJGA 3G1XA 2YLAA 1VGAA 1HJXA 7PTDA 2ZA1A 5M17A 5FCZA 3WQDA 1V7AA 2DZSA 3RAOA 2GVYA 3SFKA 3GXIA 3QTGA 2PODA 3UWYA 3QV8A 3ZLHA 3LM3A 1JVNA 2OLSA 3VGBA 3DGBA 5LSMA 1YNYA 2V3EA 3O16A 4E4PA 4TVDA 4JKLA 1A50A 4GYFA 3BJFA 2VX5A 3DFOA 4PMQA 5HJXA 3PG9A 2W63A 4RZ6A 5G1YA 3TKFA 2W91A 3WFAA 3S46A 1TIWA 2FB3A 1IGSA 1RQBA 4O1AA 4CQDA 5DY2A 4KKXA 1LLZA 1MRAA 3QOMA 3RJXA 1SFTA 2D2JA 2W4XA 5AY7A 4O1FA 4KMQA 2FIQA 4QE5A 1F4AA 4JTGA 3R5EA 1T96A 1K70A 2NX3A 2VC7A 3BLEA 3LI1A 4J35A 4DB7A 4PMOA 3T09A 3O6AA 3DFPA 1B3XA 2IMRA 1VEOA 1R3TA 1N7KA 3ICJA 1DQWA 1WV2A 3T2QA 3V1HA 4LY8A 4PRWA 2C16A 1UUMA 1B9ZA 3H22A 2CLEA 2H9AB 1K03A 3NQVA 3ZO9A 4FNUA 1M01A 1H60A 4HB7A 4FXJA 3QC3A 2PGRA 1FWAC 5CZTA 4QDMA 4PN2A 1FQ0A 2DJLA 3T0CA 3TK7A 3QZ6A 2GK1A 3SEPA 3STGA 4QAIA 2C18A 4GKTA 3M0IA 3AMCA 1E70M 3LTPA 1X1NA 4GLEA 2A21A 2OODA 3M5YA 2UY5A 3LSCA 3S3GA 2E8YA 1ZJBA 5I3FA 1MI3A 2IQ0A 2J9XA 3OBKA 4O28A 3HV8A 1VFFA 4ERGA 3TAOA 5E0CA 1ZS2A 3QFEA 3M0VA 1SR0A 4LG2A 1XD0A 2V38A 5C9WA 1JCTA 4ZE5A 4KCTA 3IPWA 4GRSA 1E6RA 6REQA 4LPCA 3BGAA 1W3HA 3B8DA 1Z89A 5D30A 1JPIA 1N8IA 4AZ5A 3WLOA 1RPKA 1LQ2A 1UG6A 5A6BA 4DZ5A 4LUSB 7REQA 2J77A 1PL9A 4J3VA 4TQTA 5FOOA 3M7PA 1JDAA 3M5XA 1KNWA 3F2CA 3FIGA 1XLKA 5EFFA 3N2MA 3CBWA 4UTKA 2BVYA 2TSYA 4FI4A 4D9PA 5U7SA 3W6YA 2D49A 5LIKX 5F2GA 3WF1A 1OFRA 1O95A 2VQTA 2PA6A 3IGUA 5DQPA 3IJIA 1JQXA 2CLHA 3ITXA 3S83A 3W75A 1TPUA 2R8WA 1CGWA 3VCNA 3NZQA 3BW3A 1W3JA 4IBKA 4FXRA 1R87A 4IX0A 3H2NA 1B31A 1KR1A 4GH3A 2O9OA 3EGJA 4AZBA 1ZCCA 5BMXA 7ODCA 4B3KA 1L6YA 4WHBA 3QPZA 4LQ1A 4NZJA 1A5AA 4EWJA 2ZX9A 3PM6A 3TSBA 1XYMA 3LPFA 2Z1WA 4NILA 1KC7A 1JG9A 4PRTA 3II1A 1FCUA 2YZ5A 4A05A 3ZR4A 3O0FA 3UXDA 2VUNA 1EZ2A 4H2CA 6TAAA 1IYXA 3PZ9A 4DM1A 3GH5A 4P5UA 3V0UA 4ML4A 3BG5A 3EWZA 1QPOA 3GBEA 5BU9A 1CGTA 3WDRA 1TV4A 4PUMA 2NV1A 4GACA 2QZRA 2WXDM 4AIBA 3W72A 1C29A 1S5VA 5LHEA 1XDMA 1MNZA 2XGBA 1QUMA 4US5D 3N9SA 4M6PA 3GHTA 2J6VA 4PUNA 4HPGA 1S2CA 3LY0A 2VTFA 3CZEA 4GNJA 4V1YA 1AW1A 4UFIA 4DN1A 3VE9A 2Q09A 4JIHA 1E0WA 3IJ8A 3WDQA 4LV4A 1QFEA 1IF2A 1KBJA 1BVZA 4CD8A 2YCEA 1A5OC 1UWRA 5IDIA 4YPJA 3WQ8A 1SSGA 4W7WA 1YTEA 1GW1A 4K6AA 2DGAA 1WYIA 4PTWA 2ACUA 3WKZA 4LY4A 2CCRA 1V0KA 4F79A 3GFZA 3MUY1 1EQPA 3L28A 1DE6A 1FWIC 5D2XA 2GVLA 4OT7A 1UROA 2R9RA 4A21A 1H5YA 3IAPA 2QR6A 3CIWA 2OZ0A 2V69A 4A4AA 3AYTA 1QMLA 4ICMA 1W17A 1SW0A 3C2RA 3P5ZA 8RUCA 1VRDA 2WVSA 1V3HA 4JD4A 1KFEA 3QW4B 3LCGA 3TC6A 1VKFA 1PKYA 1P6WA 1ZBVA 3STCA 5D02A 4HNCA 1V8EA 3WQWA 4XBKA 1IGWA 4H9MA 3R4IA 4P7NA 1EH9A 4KS0A 3JZUA 4D8ZA 2CXGA 4U5KA 3ZM8A 3ARQA 2PGWA 5DCDA 4PULA 5FJTA 1DJNA 3WNPA 1F8MA 1BKHA 5FJOA 3CEUA 3VU2A 4UIOA 3BICA 3MSRA 4RE2A 3CB8A 4KGJA 3WJWA 1YW1A 3SGUA 3BC9A 1JD9A 4GC4A 3ZR6A 5KZDA 2WC3A 4JBRA 2J9YA 3L7RA 4QTGA 3TR2A 1A3XA 1J6OA 2KZHA 1ZBWA 4KWVA 2JKEA 1RA0A 4PUKA 4QG6A 2PLKA 1S38A 1L9WA 3ZR5A 2DSUA 2ZZ6A 1AA1B 2FZBA 5BNKA 5TAOA 4US6A 4UTJA 1R0MA 1E15A 4Y90A 2YA1A 3MDWA 2BVDA 1M04A 1XF0A 2BVWA 2RH9A 3GTXA 4WKHA 3UG3A 4C6FA 1Q6QA 3WBEA 4UMCA 3L2LA 4UOZA 2WK2A 5HINA 2CZFA 3VIPA 3VOFA 3LOTA 3I3EA 2XH2A 3A9IA 4QISA 3LS9A 2QCGA 4RPPA 2ZXBA 1E4MM 1MUMA 2KX9A 3P74A 5D2YA 1KCZA 5A5WA 4LOCA 5A95A 3ZLFA 5K3VA 3JRKA 5C9ZA 5DRIA 3NFUA 4GZ7A 5LNWA 1PPIA 3I7QA 3KFTA 3MMUA 1Y5WA 1V3LA 1Q85A 2CZVA 3R0DA 5LIXX 1EEPA 2HVOA 1FWHC 1B3ZA 3GK0A 5A8GA 3DH7A 3UWUA 1GEQA 5I2UA 4PZVA 2FVMA 5I3IA 2Y2LA 1GOKA 1XGZA 4DJFA 5HWNA 2P3EA 1A5SA 1RUSA 3A12A 1TZZA 2Y5JA 3AJ7A 3NQ2A 1PUDA 3KS8A 3SDOA 3CHDA 3W85A 1C8VA 1F5ZA 3GYEA 2PU0A 1ADOA 2WZEA 2ZADA 2PDJA 2D2OA 3WK3A 1TUFA 1TV3A 1SO6A 3R11A 4UQEA 3AXKA 1QI0A 2CBVA 1VEPA 4HK7A 3P84A 5IFPA 2VUYA 4ZFMA 2OZ8A 2J78A 1QPRA 1UKOA 4KCUA 3CQJA 4Q4QA 5CLWA 1HFBA 1AG1O 5BU6A 4CVWA 3AAMA 3KVMA 2WMFA 5TBOA 3I3BA 3CUZA 4PCTA 3PULA 1JF6A 3W22A 1R2SA 1I2PA 4WVXA 2HNEA 1VBHA 1GPWA 3UR2A 5C2CA 1G5AA 4C6MA 2VFFA 4QFUA 1TJRA 4I5RA 2FLIA 4B5VA 1YXYA 3MPGA 4RNFA 2V5BA 5CSSA 1B2YA 1H62A 3DESA 4ZO6A 4OOZA 2V30A 3CIXA 3CL6A 4D6FA 1NDWA 2I5QA 4QJ5B 3IAQA 3ZT5A 2BY3A 3FXGA 1K8XA 2PWEA 1XI3A 5FSEC 4B4FA 1SPQA 5IOBA 3WEOA 3EWCA 3BSGA 3BWWA 4BF9A 2RAGA 4XO6A 5C9UA 2GPTA 4GHRA 1J0KA 2C79A 3O1NA 3WQGA 3GTIA 2J62A 4LUTA 4ACZA 4CKQA 1O5QA 4B5WA 4QJ1A 4UOQA 3M0LA 4BQ5A 2ICSA 3MHFA 3QYQA 2P1FA 3L65A 4Z1BA 1H7WA 1RZMA 4IH3A 1UWAA 1XPYA 1GJWA 4ROPA 2OXNA 4HHLA 3Q67A 4KRUA 4GC3A 1D7KA 4KRTA 5CZKA 1WKEA 4Q7NA 3U8GA 3BH4A 3VOGA 2HK0A 4JQ1A 6REQB 4YXGA 3G22A 2Q3OA 1NARA 2V5CA 3CASA 4WOQA 2BZNA 3M64A 4LYQA 3GM8A 3K4DA 4AG0A 4AD3A 4XZLX 1OY0A 1RJQA 1B30A 3MBFA 4GJ1A 2ZIDA 2VZUA 7REQB 3B4UA 5LNSA 1XS2A 3P8JA 1NDVA 2GVGA 2VP8A 1OZMA 3PNZA 7TIMA 3VKJA 3W74A 4GABA 1XINA 3W01A 5C55A 4O52A 4OJPA 1KS0A 2ZZ7A 5H8UA 2FPTA 4IFRA 4PYSA 2NVDA 2FPYA 3CHFA 1FP9A 4NL1A 3QZEA 4HPJA 4C7FA 4R53A 1XIJA 1E6NA 3HZ3A 3TTSA 3ZMRA 4GINA 2TMDA 3VKBA 1R3SA 2Z24A 4LXFA 2AGTA 1UH4A 3SZ8A 3ZQ9A 4BS0A 2WJEA 3CZGA 3H54A 3GTNA 1FUYA 1VAHA 4O1BA 4QJ3B 2MANA 3HGRA 2QV4A 1WBHA 2A2IA 1ZAIA 3LDVA 2QXWA 4XISA 1IT8A 3S2NA 2XSXA 3TMQA 3NQ7A 5IDZA 1LG2A 3N11A 2J7HA 4F2TA 1JNEA 2EG6A 3P81A 4GBUA 3NWRA 1I2OA 5ABGA 3N4FA 1V6YA 2EF9A 2NLYA 4I7VA 3WNNA 1QTWA 4PUJA 4GHLA 3VDGA 2YL9A 3ES8A 2W79A 1DVJA 1MQRA 3VNZA 4TUFA 5XIMA 1XBZA 4UWMA 3I7RA 4LJ3A 3MCOA 4BWLC 3MTWA 2PDPA 3LD5A 1JZ7A 4OKDA 4E38A 5KZ6A 3R94A 4IUOA 3VIGA 2V2HA 4E4FA 4LEQA 4NRRA 3HGOA 4JIIX 3PHAA 4S3DA 2I7GA 3QKZA 3AS2A 4UZUA 1W9PA 3WLIA 4D2JA 4MNJA 1GVOA 2J4GA 1HTIA 1VFHA 1OM0A 3EWBX 4QQ3A 3GR4A 2BY0A 3BJTA 3L0GA 2GYIA 3RCNA 1ZNNA 4A22A 5HWMA 4WKAA 2VR5A 2XPKA 3RR4A 4GUIA 4YL2A 2A3CA 3WUFA 3LPPA 3BZGA 1DTUA 4ZMGA 1O60A 4HU3A 2VM8A 4WSJA 4XKYA 4CLMA 1TRDA 1TTJA 1VJIA 2AAMA 1IR2A 3GNRA 3O6YX 4QCFA 2E6FA 4IT1A 1R3QA 4YWIA 1IT7A 3B9DA 1U5JA 3CUFA 3W3OA 2VO5A 3L4UA 2HCVA 3KRBA 3PZNA 1NAL1 1RVKA 1X97A 4LALA 2CLMA 2Y1HA 3L25A 5DO8A 3BL3A 1OGSA 3MWAA 2VENA 2NQHA 1RK5A 3CXOA 4O4WA 3ZVHB 4HZ7A 3ELFA 5DMYA 5I6SA 1DP0A 3AI0A 1XBYA 3EDEA 3QF0A 3AHYA 3GFXA 3WH7A 1EC9A 3G8RA 1PEZA 3NO1A 1TYGA 2JKPA 4IL2A 3TYAA 1D3GA 1R9ZA 1CK7A 2C13A 4ONVA 4PBGA 3IIOA 4J3ZA 1B5TA 3MA8A 4S2BA 2FVKA 3ZFHA 1HKMA 5CG7A 2WYSA 2PC8A 3BCJA 4JFVA 3GXMA 2YXGA 2DZTA 4O16A 4NJIA 4KWUA 3EA3A 1JUEA 3N2TA 2RDWA 2PTWA 1TPC1 3DC0A 1NWRA 2Y8VA 1XHGA 4HZ8A 1XPGA 4DJDD 2YB1A 4DHGA 3TROA 3C0QA 3F4WA 4R9OA 2WVUA 3OYZA 3B9OA 2Y89A 4QEHA 4A8LA 4JFUA 4GZJA 5A8QA 2FHFA 3T9PA 1OCBA 1C8QA 3UFYA 2ALRA 4IGNA 3OA3A 4QXIA 3H24A 1A53A 4ZVJA 4F0SA 2I5GA 4PMXA 5D2VA 3L0KA 5HMFA 3L2IA 2PDLA 4JOMA 4J3XA 3FKEA 1MVYA 4P61A 4EPEC 4DYJA 1SFSA 4FNPA 3ARVA 3S5OA 1XJBA 1NF0A 1QW7A 3O6CA 5BYWA 4XZIA 3D3FA 1HP4A 1B1YA 3N6QA 1A49A 3STPA 3GDRA 3WK0A 4KCWA 1V6XA 4W8BA 1J9YA 1OC5A 4GFSA 2QW5A 1W9UA 1MW3A 1JPKA 1QI2A 3CH9A 4P7LA 1IQ8A 2DUXA 4AZCB 3WN6A 2R24A 3EB4A 4Z17A 4LX4A 5BMWA 2BGQA 4FHAA 4C90A 1KV8A 4GYPC 4F40A 3NQFA 3KBNA 3RPTA 3FJLA 1WO2A 4CQ9A 3KCLA 3WMBA 1FWEC 4IPIA 3GTFA 3EKGA 2HMCA 5I03A 4PTXA 1QNRA 4DO5A 4CQAA 4Z1YA 3G3MA 1HKVA 4HOWA 3ABXA 3GO2A 3IARA 3C6CA 4HQVA 3IGXA 4XZNX 2A3EA 1ME7A 4EKJA 1O5KA 3N14A 5CG0A 3S2CA 1VYSX 4MJ2A 1S3HA 3UPMA 4NX5A 5D37A 4UTMA 5F7UA 6XIAA 3EWUA 2CC0A 2ZVIA 3CLMA 3COTA 2OU4A 2OR2A 3W73A 1XRTA 1QNSA 2ZC8A 1XIDA 3L4ZA 2QGYA 4YHGA 4JL1A 2P50A 3WLLA 1YU2A 2O4MA 4GO9A 1QHOA 3AYVA 1K7XA 5C70A 1TELA 4AUBA 2VC5A 4GOAA 4GQBA 3SIMA 1KB3A 1LJYA 1ESWA 3EDDA 2R82A 4LUTB 1ED7A 4ACZB 4NAEA 1GOWA 3PBVA 2B7QA 5I3JA 4H7CA 4EXQA 1KM6A 1WDRA 3QSRA 5G1MA 2RGLA 3SAZA 1H7PA 1UC5A 1VP5A 1S2VA 3GTHA 3GZ3A 3GKFA 1GVEA 1LL4A 1RJRA 4OBRA 1EPVA 4BFAA 2CHOA 3W1PA 4IGSA 2P3ZA 3CPUA 3GIYA 2VHLA 1E51A 4LBUA 3BAWA 4D6IA 2J7GA 4O8AA 2E4TA 2D3LA 1HKKA 4BI6A 3TUUA 4A3UA 1JEZA 1I9CB 5I06A 1RA5A 1TV5A 3BSHA 3F4NA 2OT1A 4CD5A 1I8JA 2AL1A 3TOPA 2A5HA 4YNGA 2G3JA 3ITCA 3TE9A 5GNYA 3KL5A 3NM3A 1QR7A 4U4MA 3GC2A 4JQ4A 1C3FA 4IZGA 1DXIA 1BG9A 3TJLA 2V6AA 2FKPA 3N1AA 4D8AA 2R1KA 1HNYA 3CMGA 1QNVA 4B4HA 3TU9A 3P67A 3AMGA 1UWQA 1GUVA 1RCXB 1TTQA 1A4MA 1V02E 3AS1A 3E96A 4E4UA 1XIBA 4L4OA 3WBWA 4JFWA 2E6DA 3BO9A 5DRCA 3TNBA 4C65A 4S38A 1GKRA 3O07A 1MO0A 3U9IA 4WD0A 1J96A 5HPCA 1AQHA 2DH3A 3G18A 3W7QA 3T78A 1W1A1 4FX7A 3NL3A 3Q94A 3REQB 4O4VA 3I68A 4IOTA 3W7KA 1UR4A 3MMDA 5DN1A 4IQLA 1Q6GA 2FDSA 3WK1A 4K8GA 3PJXA 1VBJA 3WUGA 5AVNA 1ZRQA 4AX7A 2WBGA 3EXSA 4BEUA 1X98A 3LYEA 4GUGA 1FKWA 3HM7A 1VF8A 1DIEA 3LGGA 3VVGA 3PBWA 2AQVA 3VTRA 1OD0A 1TPEA 5CAHA 3TVAA 3XISA 5KETA 5DMNA 3R58A 4XBJA 5LNUA 4NKCA 1GWJA 1POKA 1RP9A 3GLCA 2ZTJA 1L0PA 5HNUA 4B5XA 3T81A 1H63A 5G2HA 1E1CA 2G0WA 4KWOA 4MUPA 3GDTA 4M19A 1NOUA 3M41A 3LXCA 1CT5A 1R3RA 2O9TA 3FEQA 3CZKA 2Y63A 2VX4A 3I6TA 4O50A 1CEOA 4YTUA 3RLVA 2GVEA 1U1UA 3B8SA 4ZXLA 2FGZA 3WBAA 4XVEA 5EL1A 4XD4A 3W9ZA 4W5ZA 5HXMA 4ICCX 2I9EA 4UUIA 4FX8A 4HD5A 1FTXA 3P5YA 3JU2A 1JULA 3MI3A 1R2TA 1OFEA 4IPNB 3RF9A 4PCNA 1UA7A 3W24A 3WYZA 1JZ4A 4ZQPA 3G1VA 4F48A 3N25A 3V5FA 3DIPA 4PEEA 4CCZA 3CLWA 4NX0A 2WSQA 1MEIA 1EDTA 4Q33A 4ZBCA 1QATA 3TTYA 4XAYA 2IS7A 1GXDA 3CUXA 3A21A 1S3TC 3KP1A 2YYUA 5K7JA 1GQNA 3U3HA 1FWCC 4Q4RA 4C6BA 3P2VA 1SSDA 4GA8A 4IX2A 3W00A 3LQLA 1XH2A 1G6CA 2Q8ZA 1XLCA 1IEVA 4E2OA 3L29A 4MJZA 2J88A 4DYEA 1ISXA 1ZQ5A 2WC7A 3K8LA 2PTYA 3FSTA 2VEPA 3RCYA 4HOZA 3MKVA 2Y2PA 1RR2A 3QMRA 2XSBA 3RITA 2X0SA 1F05A 4UCFA 2PZNA 1S39A 5AC4A 3KS6A 2QCFA 1F6KA 4ZQNA 4A3YA 4CU8A 2F2KA 4P2VA 1E0TA 1FXPA 3EB2A 2ZA2A 3M43A 1U1JA 1W0MA 5HOSA 3QR3A 3QY7A 2Z28A 1TCMA 3BGJA 1S2WA 5EBAA 3WSUA 2GL5A 1EDQA 1WP6A 3G1HA 3WIJA 4LBRA 4WLCA 3S42A 3JR2A 2FPVA 1YHTA 4NJGA 1LRNA 3M0MA 4NF7A 4JPGA 4K1GA 2CU0A 3TDFA 2VNCA 3WNLA 1DJZA 1W3KA 3PG8A 1PWMA 3CK5A 1ZTVA 3E6EA 3SY8A 4J40A 2YW4A 3V5OA 3XINA 2ZUNA 3T0BA 1M41A 2RFGA 3KWXA 4ERIA 4DJEA 2OYMA 4WUIA 3FA4A 3CO4A 5L6UA 1ALDA 4XKMA 3OLIA 2A3BA 3UQNA 4JKMA 1DWAM 3B8UA 3NTYA 2BG5A 1TCDA 1HGWA 2X1RA 4TU1A 3GKAA 3BW4A 5D09A 1HN1A 3I65A 4C7GA 1B3VA 3TC7A 4YHEA 2HE8A 1DV7A 1Y0EA 4TOQA 1HF6A 3S4TA 2AKZA 3N6JA 1WA3A 1IHIA 3KS5A 1KD0A 4AD4A 4UQDA 3VABA 2GSJA 2QJIA 4A3HA 4B90A 3UJ2A 2OLAA 4B15A 2YKKA 3I6RA 3GXDA 1K3UA 2P53A 1ZL1A 4G1NA 1DPMA 1TMLA 7TAAA 1WNOA 4JTLA 3GVQA 4WK9A 3HONA 4Y8EA 3T8QA 1TIMA 3FA3A 1QW9A 3DHFA 1W1PA 1M68A 3HQPA 5CH9A 4LTSA 4PGLA 5E6ZA 4NXSA 3PANA 4JQ2A 2WMIA 4PA8A 4DZAA 3VNYA 2QJHA 3UPBA 4L56A 2XDFA 4AW7A 3S2LA 1AJZA 2Z0IA 1DORA 9CGTA 2V3DA 2EJ1A 4DWSA 1M65A 3M16A 2V3FA 4KWSA 3S8HA 2BX7A 4GVHA 1G4PA 4XIMA 4Q7BA 3RM4A 3QGAC 2Y8UA 3AIRA 4FR1A 1CGXA 1UMYA 2CZDA 3W71A 4O0QA 3NOEA 1YBQA 3MP3A 1DWGM 3B3DA 4NAEB 5EFDA 3ZWSA 3IIPA 2E9BA 5BWAA 2PURA 2YDSA 1WZMA 1E3ZA 4YVPA 3TN6A 3CUJA 1FWGC 3MP4A 2WV8A 5BRBA 1PJ9A 3F5JA 1RSCA 1F8IA 5AYZA 3URQA 1EGMA 1NFPA 3IACA 1YDYA 1GONA 4OFCA 2PDYA 3UERA 3S1VA 2EPLX 4AIEA 5A69A 1PE1A 2WWCA 2VRKA 4FLSA 4NU7A 1GYMA 2OQLA 2RDUA 4A8IA 4MNKA 1I4NA 1Q8AA 2QVNA 3WD2A 3SR7A 1ZBKA 2E68A 2R1NA 1WZKA 4EPBC 1NOFA 1DJXA 1Z69A 4CUCA 3S5ZA 4Y9PA 3U2CA 2HVMA 4BK9A 3B9AA 1M7JA 4HTYA 1LLOA 3AIQA 5K9XA 2BS9A 1CXFA 4RZBA 2J7FA 3VX0A 4GD0A 3WLRA 4BA0A 3LZ3A 1SR9A 4CNTA 4Q8UA 2E6YA 4Y9NA 1UKSA 4GX8A 1F74A 2A6LA 3BE7A 1US0A 2J13A 3P0XA 1DHPA 3MV11 4PMZA 1YNQA 4CCEA 1I2QA 2Z00A 5EY5A 1KWKA 3S6TA 3W2LA 4PB3A 1UQYA 4URIA 4DBDA 1XP3A 3TXVA 2ZE3A 1OFDA 1OX4A 3KTSA 4UTTA 4GYJA 3RCMA 3KTXA 1KFCA 2UBPC 3KZSA 2A1YA 1YDNA 1U1HA 1EJTC 2V2CA 3H26A 3T42A 3OZMA 1VBGA 3W88A 1RD5A 4ADTA 2DUAA 1BQGA 5HBFA 4OV4A 4BI5A 1VFLA 2WZMA 4N0RA 2HXTA 1ITXA 3U2OA 3KX6A 3E2RA 5E0KA 1U5HA 2VWTA 2RDTA 4ES4A 2D0FA 3K1DA 3B0UX 1IZCA 1FY6A 1TMHA 2J79A 5G2IA 4IJCA 3VA8A 2IXVA 3H2CA 1AH0A 2QPSA 1EA0A 2VOTA 3GG1A 3F4CA 2VKZG 4Y7EA 3GFYA 3KBVA 3UXKA 3FAXA 3N34A 1VPYA 4E3TA 4HJWA 4N9CA 3WLTA 4Q8OA 1GCYA 3U7BA 3J7HA 2Z1KA 3WQEA 3W6LA 2EPNA 1BXNA 1QO5A 1VCFA 3GVRA 1WDWA 1DOSA 4IBFA 3DFTA 3C2VA 4US5A 1ADDA 1JYNA 1DL3A 1A0DA 2EGZA 1BYCA 3CUGA 1AK5A 1OF8A 1E40A 4HCLA 1QPKA 1FHVA 4TVUA 1CLKA 3EPOA 3GU1A 3IGHX 4NZFA 1OFQA 2DEPA 1YE6A 5PTDA 2I9UA 4WKFA 2BGSA 2NZLA 2QKFA 5A8NA 2D3NA 5LIYX 4UBPC 4CN6A 2XFFA 4XZMX 1S1RA 2Z7GA 1MXSA 2C0AA 2ODOA 5EBUA 4D6DA 3ITLA 1A5CA 5M1TA 3VXGA 3NG3A 2PRLA 3CPRA 4XIAA 3U5UA 4DVOA 2FMOA 4DBEA 3CQHA 4IIEA 1W2VA 1K4HA 3WELA 1SU5A 2XUCA 2OT0A 1OVDA 4DBUA 1F73A 2J75A 4M5PA 3RLGA 4F0HA 2PPGA 3E74A 2XIMA 5IXEA 3QBUA 4W8LA 4GGBA 2ANUA 1ZJHA 4POCA 3LM7A 4AZGA 3W1AA 3UD6A 2DPEA 1S5WA 1Z48A 2WM0A 3UXIA 3H4GA 1FWRA 4WDTA 3TSMA 1OC6A 2E67A 3HOJA 4UNLA 4CU7A 3AWOA 3W1QA 3POCA 4PMYA 4HMDA 4S23A 3RIKA 1ISWA 3MI6A 3U57A 3H4XA 4A8NA 4O19A 1OIFA 3ITOA 4QS5A 3T4CA 3TLLA 5G2WA 3MI2A 3LPGA 2ZZ2A 3IJQA 3AQUA 4IBIA 3CJPA 5T9CE 4P8WA 1DXEA 4UR7A 2CYGA 3CC1A 1GOQA 4Z1CA 2Y7FA 3GAYA 3OZOA 4GY7A 4AZHA 3ABOA 1R2RA 4M82A 4L4PA 2VMFA 3DG6A 2NUXA 1RJPA 5EU9A 3ABRA 1AD1A 1JUBA 1KM3A 3QMTA 1MQPA 2CITA 1JL8A 4GO8A 3NQ6A 3UWEA